F430419

General Info

Members Datasets Scaffolds Average Seq Length
386 214 772 450

Family's Representative Sequence

Representative Sequence 3300005355|Ga0070671_100204445|Ga0070671_1002044451
Length 475
Sequence MAQQSTDWKHTAAAITESATAAQEVPVVEAARIQVEASDIQAIVLRPRPKPYRGEYVILRVGDAAQGREMLRRILPHVAPADEWWTPSLPGWLGIAITFEGLKALGVPQASLDSFPIEFRQGMAARAAILHDFGANAPEHWEHPFGTPDVHVALALYAKDDETLQQVLELARKAHHDLADISVVYRMQFGELPEGRNPFGFKDGLHNPHVEGSSSVAQAGSEASIKAGEFIMGYPDERGEIANGPIPAELRHNGSFVALRKFHMDVAAFRRYLRAQASSREEEELIAAKMVGRWRSGAPLVLAPDHDDAHLGSDPNRNNAFSYAADMRGLNCPFSAHIRRINPRDALKDEIVAVNLHHFLRRGTNYGPPLPEGVFEDDGVERGGVFLLIGAHLQRQFEFIQSQWATDGNFIGHGTEQDPLIGNNDGDGVFTIPRRPARRRLHGLPQFVTVRGGEYCFIPGLRALRWLAALGSSST

Samples

Sample ID Description Type Environment
1 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
2 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
7 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
10 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
11 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
16 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
19 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
24 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
25 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
28 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
29 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
30 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
31 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
32 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
33 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
34 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
35 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
36 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
37 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
38 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
39 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
40 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
41 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
42 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
43 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
44 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
45 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
46 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
47 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
48 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
49 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
50 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
51 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
52 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
53 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
54 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
75 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
76 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
77 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
78 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
79 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
81 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
82 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
83 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
84 3300031889 Wild Oat associated soil bacterial communities from Lone Jack Road, Encinitas, CA, USA - WO Metagenome Rhizosphere
85 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
86 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
87 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
88 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
89 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
90 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
91 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
92 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
93 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
94 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
95 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
96 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
97 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
98 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
99 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
100 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
101 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
102 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
103 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
104 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
105 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
106 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
114 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
115 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
116 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
117 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
118 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
119 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
120 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
121 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
122 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
123 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
124 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
125 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
126 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
127 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
128 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
129 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
130 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
131 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
132 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
133 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
134 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
135 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
136 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
137 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
138 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
139 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
140 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
141 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
142 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
143 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
144 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
145 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
156 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
157 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
160 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
161 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
162 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
163 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
168 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
169 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
170 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
171 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
182 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
183 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
184 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
185 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
186 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
187 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
188 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
189 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
190 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
191 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
192 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
193 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
194 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
195 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
196 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
197 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
198 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
199 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
200 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
201 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
202 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
203 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
204 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
205 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
206 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
207 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
208 2643221613 Oerskovia sp. Root22 Isolate Unclassified
209 2643221711 Terrabacter sp. Root85 Isolate Unclassified
210 2643221721 Oerskovia sp. Root918 Isolate Unclassified
211 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
212 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
213 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
214 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.67
Metatranscriptomes 0.52
Isolates 1.81

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 0
Rhizoplane 12.44
Rhizosphere 81.87
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070671_100204445 3300005355 Bacteria 1675
2 Ga0065165_1002823 3300005262 Bacteria 13592
3 Ga0070683_100046052 3300005329 Bacteria 4027
4 Ga0070683_100242590 3300005329 Bacteria 1714
5 Ga0070680_100025027 3300005336 Bacteria 4771
6 Ga0070682_100034915 3300005337 Bacteria 3065
7 Ga0070674_100012894 3300005356 Bacteria 5148
8 Ga0070674_100179899 3300005356 Bacteria 1619
9 Ga0070659_100019332 3300005366 Bacteria 5160
10 Ga0070713_100069010 3300005436 Unclassified 2980
11 Ga0070713_100083732 3300005436 Bacteria 2727
12 Ga0070713_100160861 3300005436 Bacteria 2004
13 Ga0070711_100002828 3300005439 Archaea 9967
14 Ga0070705_100007242 3300005440 Bacteria 5455
15 Ga0070700_100035696 3300005441 Bacteria 3010
16 Ga0070694_100019780 3300005444 Bacteria 4285
17 Ga0070678_100065406 3300005456 Bacteria 2700
18 Ga0068867_100074620 3300005459 Bacteria 2543
19 Ga0070685_10091214 3300005466 Bacteria 1844
20 Ga0070706_100134656 3300005467 Bacteria 2306
21 Ga0070707_100121067 3300005468 Bacteria 2541
22 Ga0070699_100132741 3300005518 Bacteria 2196
23 Ga0070679_100043519 3300005530 Bacteria 4472
24 Ga0070679_100148970 3300005530 Bacteria 2317
25 Ga0070684_100043462 3300005535 Bacteria 3880
26 Ga0070684_100164323 3300005535 Bacteria 2015
27 Ga0070697_100105766 3300005536 Bacteria 2341
28 Ga0070695_100090182 3300005545 Bacteria 2045
29 Ga0070665_100005892 3300005548 Bacteria 12557
30 Ga0070665_100095535 3300005548 Bacteria 2977
31 Ga0068855_100020063 3300005563 Bacteria 8026
32 Ga0068857_100048673 3300005577 Bacteria 3763
33 Ga0068856_100068374 3300005614 Bacteria 3511
34 Ga0081455_10016429 3300005937 Bacteria 7148
35 Ga0081538_10006752 3300005981 Bacteria 10031
36 Ga0081538_10020815 3300005981 Bacteria 4815
37 Ga0081540_1000103 3300005983 Bacteria 91274
38 Ga0070716_100032133 3300006173 Bacteria 2860
39 Ga0070712_100005242 3300006175 Bacteria 8018
40 Ga0070712_100005923 3300006175 Archaea 7566
41 Ga0070712_100035170 3300006175 Bacteria 3399
42 Ga0070712_100049870 3300006175 Bacteria 2909
43 Ga0075429_100009322 3300006880 Archaea 8522
44 Ga0075435_100008807 3300007076 Bacteria 7269
45 Ga0105245_10023091 3300009098 Bacteria 5458
46 Ga0105245_10023231 3300009098 Bacteria 5443
47 Ga0105245_10030967 3300009098 Bacteria 4732
48 Ga0105245_10076923 3300009098 Bacteria 3041
49 Ga0105245_10130582 3300009098 Bacteria 2356
50 Ga0105247_10009381 3300009101 Bacteria 5942
51 Ga0114129_10283803 3300009147 Archaea 2212
52 Ga0105243_10020603 3300009148 Bacteria 4999
53 Ga0105241_10046124 3300009174 Bacteria 3309
54 Ga0105237_10008682 3300009545 Bacteria 10976
55 Ga0105237_10110590 3300009545 Bacteria 2739
56 Ga0105238_10010303 3300009551 Bacteria 9378
57 Ga0105239_10162441 3300010375 Bacteria 2496
58 Ga0157369_10014450 3300013105 Bacteria 8913
59 Ga0157369_10017824 3300013105 Bacteria 7971
60 Ga0157374_10034808 3300013296 Bacteria 4604
61 Ga0157372_10017238 3300013307 Bacteria 7753
62 Ga0157372_10021028 3300013307 Bacteria 7046
63 Ga0157372_10063781 3300013307 Bacteria 4133
64 Ga0157372_10108504 3300013307 Bacteria 3177
65 Ga0157375_10040043 3300013308 Bacteria 4514
66 Ga0157375_10380971 3300013308 Bacteria 1577
67 Ga0182008_10027214 3300014497 Unclassified 2898
68 Ga0157377_10079049 3300014745 Bacteria 1918
69 Ga0157379_10093548 3300014968 Bacteria 2697
70 Ga0157376_10011634 3300014969 Bacteria 6495
71 Ga0157376_10042047 3300014969 Bacteria 3745
72 Ga0157376_10103178 3300014969 Bacteria 2496
73 Ga0206354_11145596 3300020081 Bacteria 3889
74 Ga0206353_10269411 3300020082 Bacteria 5936
75 Ga0213875_10000009 3300021388 Bacteria 451129
76 Ga0207426_1000990 3300025302 Bacteria 27830
77 Ga0207684_10108317 3300025910 Bacteria 2378
78 Ga0207671_10101553 3300025914 Bacteria 2179
79 Ga0207693_10009285 3300025915 Bacteria 8025
80 Ga0207693_10082869 3300025915 Bacteria 2512
81 Ga0207663_10026969 3300025916 Bacteria 3342
82 Ga0207663_10033416 3300025916 Bacteria 3064
83 Ga0207660_10037770 3300025917 Bacteria 3367
84 Ga0207657_10023150 3300025919 Bacteria 5790
85 Ga0207652_10014711 3300025921 Bacteria 6341
86 Ga0207652_10038523 3300025921 Bacteria 4053
87 Ga0207646_10100281 3300025922 Bacteria 2595
88 Ga0207694_10051246 3300025924 Bacteria 3199
89 Ga0207687_10014049 3300025927 Bacteria 5235
90 Ga0207687_10026876 3300025927 Bacteria 3856
91 Ga0207687_10032028 3300025927 Bacteria 3557
92 Ga0207687_10056615 3300025927 Bacteria 2751
93 Ga0207700_10004173 3300025928 Bacteria 8481
94 Ga0207700_10084012 3300025928 Bacteria 2494
95 Ga0207664_10006279 3300025929 Bacteria 8166
96 Ga0207664_10011991 3300025929 Bacteria 6187
97 Ga0207644_10121250 3300025931 Bacteria 1991
98 Ga0207669_10045381 3300025937 Bacteria 2589
99 Ga0207665_10006391 3300025939 Bacteria 7817
100 Ga0207665_10021851 3300025939 Bacteria 4207
101 Ga0207661_10057596 3300025944 Bacteria 3125
102 Ga0207702_10009581 3300026078 Bacteria 8132
103 Ga0207648_10040938 3300026089 Bacteria 4069
104 Ga0207648_10097060 3300026089 Bacteria 2579
105 Ga0207675_100144542 3300026118 Bacteria 2261
106 Ga0207698_10038139 3300026142 Bacteria 3547
107 Ga0210000_1003877 3300027462 Archaea 2164
108 Ga0209999_1003008 3300027543 Bacteria 2997
109 Ga0210002_1002056 3300027617 Bacteria 2902
110 Ga0209966_1005995 3300027695 Bacteria 2101
111 Ga0207428_10013081 3300027907 Archaea 7266
112 Ga0207428_10025166 3300027907 Bacteria 4984
113 Ga0268266_10023352 3300028379 Bacteria 5266
114 Ga0307408_100008819 3300031548 Bacteria 6660
115 Ga0307405_10002150 3300031731 Bacteria 8601
116 Ga0307405_10023473 3300031731 Bacteria 3506
117 Ga0307405_10218274 3300031731 Bacteria 1397
118 Ga0307413_10035804 3300031824 Bacteria 2851
119 Ga0307410_10006116 3300031852 Bacteria 6458
120 Ga0307410_10011307 3300031852 Bacteria 5099
121 Ga0307410_10032791 3300031852 Bacteria 3348
122 Ga0307410_10035551 3300031852 Bacteria 3236
123 Ga0307410_10098775 3300031852 Bacteria 2088
124 Ga0326468_10000204 3300031889 Bacteria 6135
125 Ga0307406_10035027 3300031901 Bacteria 3084
126 Ga0307406_10069875 3300031901 Bacteria 2297
127 Ga0307406_10071681 3300031901 Bacteria 2271
128 Ga0307406_10133444 3300031901 Bacteria 1746
129 Ga0307407_10003285 3300031903 Bacteria 6593
130 Ga0307407_10042951 3300031903 Bacteria 2538
131 Ga0307407_10090910 3300031903 Bacteria 1870
132 Ga0307412_10043152 3300031911 Bacteria 2935
133 Ga0307409_100006598 3300031995 Bacteria 6842
134 Ga0307409_100019532 3300031995 Bacteria 4591
135 Ga0307409_100022044 3300031995 Bacteria 4383
136 Ga0307409_100027844 3300031995 Bacteria 4013
137 Ga0307409_100051409 3300031995 Bacteria 3153
138 Ga0307409_100074903 3300031995 Bacteria 2707
139 Ga0307409_100092276 3300031995 Bacteria 2484
140 Ga0307409_100198319 3300031995 Bacteria 1793
141 Ga0307409_100226460 3300031995 Bacteria 1691
142 Ga0307409_100272469 3300031995 Bacteria 1559
143 Ga0307416_100001615 3300032002 Bacteria 12395
144 Ga0307416_100002457 3300032002 Bacteria 10647
145 Ga0307416_100016064 3300032002 Bacteria 5189
146 Ga0307416_100019982 3300032002 Bacteria 4765
147 Ga0307416_100077119 3300032002 Bacteria 2797
148 Ga0307416_100147696 3300032002 Bacteria 2150
149 Ga0307414_10099003 3300032004 Bacteria 2189
150 Ga0307411_10031266 3300032005 Bacteria 3273
151 Ga0307411_10059030 3300032005 Bacteria 2542
152 Ga0307411_10071074 3300032005 Bacteria 2357
153 Ga0307411_10107771 3300032005 Bacteria 1986
154 Ga0307415_100001347 3300032126 Bacteria 11679
155 Ga0307415_100008974 3300032126 Bacteria 5576
156 Ga0307415_100011525 3300032126 Bacteria 5065
157 Ga0307415_100012297 3300032126 Bacteria 4942
158 Ga0307415_100025908 3300032126 Bacteria 3690
159 Ga0307415_100061325 3300032126 Bacteria 2603
160 Ga0307415_100162518 3300032126 Bacteria 1732
161 Ga0307510_10009912 3300033180 Bacteria 11328
162 Ga0373929_0013681 3300035085 Bacteria 1558
163 Ga0373934_0004638 3300035086 Bacteria 5081
164 Ga0373944_0008339 3300035089 Bacteria 2798
165 Ga0373923_0001059 3300035111 Bacteria 7529
166 Ga0373936_0000751 3300035113 Bacteria 11366
167 Ga0373936_0005346 3300035113 Bacteria 4833
168 Ga0373945_0001439 3300035116 Bacteria 7250
169 Ga0373945_0006865 3300035116 Bacteria 3679
170 Ga0373953_0010218 3300035117 Bacteria 3257
171 Ga0373954_0024330 3300035118 Bacteria 2761
172 Ga0373956_0007177 3300035119 Bacteria 4486
173 Ga0373943_0002775 3300035170 Bacteria 7968
174 Ga0373943_0004133 3300035170 Bacteria 6586
175 Ga0373946_0000098 3300035171 Bacteria 24414
176 Ga0373946_0000206 3300035171 Bacteria 18285
177 Ga0373955_0005081 3300035172 Bacteria 5880
178 Ga0373924_0000075 3300035410 Bacteria 26419
179 Ga0373924_0012025 3300035410 Bacteria 3226
180 Ga0373935_0000989 3300035692 Bacteria 15455
181 Ga0373935_0004986 3300035692 Bacteria 7812
182 Ga0373935_0028871 3300035692 Bacteria 3429
183 Ga0373927_0004245 3300035695 Bacteria 10064
184 Ga0373927_0045966 3300035695 Bacteria 2825
185 Ga0373933_0004415 3300035724 Bacteria 7724
186 Ga0373947_0000155 3300035725 Bacteria 36076
187 Ga0373947_0007630 3300035725 Bacteria 6258
188 Ga0373937_0016648 3300036401 Bacteria 6531
189 Ga0373937_0016779 3300036401 Bacteria 6510
190 Ga0373925_0010107 3300037068 Bacteria 6855
191 Ga0395900_0030222 3300037418 Bacteria 5561
192 Ga0395900_0165720 3300037418 Bacteria 2252
193 Ga0395900_0283644 3300037418 Bacteria 1647
194 Ga0395898_0009631 3300037466 Bacteria 10141
195 Ga0395898_0019361 3300037466 Bacteria 6928
196 Ga0395905_0072081 3300037471 Bacteria 3238
197 Ga0395905_0075232 3300037471 Bacteria 3165
198 Ga0395905_0151838 3300037471 Bacteria 2179
199 Ga0436364_1201245 3300037853 Bacteria 33298
200 Ga0395901_0004450 3300038443 Bacteria 14134
201 Ga0395901_0085794 3300038443 Bacteria 3292
202 Ga0395901_0323394 3300038443 Bacteria 1595
203 Ga0436365_0134839 3300039437 Bacteria 2083
204 Ga0436365_0167362 3300039437 Bacteria 2728
205 Ga0436365_0364773 3300039437 Bacteria 2537
206 Ga0436365_0414961 3300039437 Bacteria 1816
207 Ga0436363_0814100 3300039450 Bacteria 4693
208 Ga0436363_1223490 3300039450 Bacteria 4129
209 Ga0436363_1624542 3300039450 Bacteria 1640
210 Ga0436363_1695548 3300039450 Bacteria 1761
211 Ga0436362_0822246 3300039453 Bacteria 5135
212 Ga0451793_0008904 3300041452 Bacteria 14819
213 Ga0451793_0927743 3300041452 Bacteria 3387
214 Ga0451837_1558096 3300041494 Bacteria 4052
215 Ga0451843_1171658 3300041509 Bacteria 3378
216 Ga0439448_0019147 3300042005 Bacteria 2105
217 Ga0439455_0011956 3300042012 Bacteria 1940
218 Ga0439463_001498 3300042016 Bacteria 6160
219 Ga0439440_0007785 3300042993 Bacteria 2184
220 Ga0495592_0001480 3300046454 Bacteria 16342
221 Ga0495592_0012930 3300046454 Bacteria 6345
222 Ga0495603_0003119 3300046455 Bacteria 9850
223 Ga0495629_0011201 3300046459 Bacteria 6512
224 Ga0495641_0001726 3300046461 Bacteria 18231
225 Ga0495651_0001503 3300046462 Bacteria 18037
226 Ga0495651_0001782 3300046462 Bacteria 16593
227 Ga0495651_0173788 3300046462 Bacteria 1531
228 Ga0495653_0001807 3300046463 Bacteria 16850
229 Ga0495653_0012966 3300046463 Bacteria 6800
230 Ga0495653_0017113 3300046463 Bacteria 5897
231 Ga0495650_0000070 3300046471 Bacteria 258497
232 Ga0495580_0001037 3300046472 Bacteria 24392
233 Ga0495582_0000105 3300046473 Bacteria 43680
234 Ga0495662_0000435 3300046476 Bacteria 18745
235 Ga0495662_0015566 3300046476 Bacteria 3692
236 Ga0495664_0000562 3300046477 Bacteria 18703
237 Ga0495664_0001936 3300046477 Bacteria 11036
238 Ga0495664_0006151 3300046477 Bacteria 6624
239 Ga0495594_0008098 3300046499 Bacteria 5405
240 Ga0495596_0013508 3300046500 Bacteria 3462
241 Ga0495608_0000622 3300046511 Bacteria 24409
242 Ga0495608_0001998 3300046511 Bacteria 14614
243 Ga0495618_0002308 3300046514 Bacteria 12347
244 Ga0495618_0006706 3300046514 Bacteria 6976
245 Ga0495618_0033119 3300046514 Bacteria 3239
246 Ga0495628_0007443 3300046516 Bacteria 9476
247 Ga0495628_0015356 3300046516 Bacteria 6395
248 Ga0495630_0001376 3300046517 Bacteria 16753
249 Ga0495630_0011206 3300046517 Bacteria 6488
250 Ga0495630_0016992 3300046517 Bacteria 5325
251 Ga0495663_0011789 3300046525 Bacteria 2434
252 Ga0495666_0002768 3300046526 Bacteria 8758
253 Ga0495652_0002199 3300046529 Bacteria 20464
254 Ga0495652_0016736 3300046529 Bacteria 6552
255 Ga0495665_0000177 3300046531 Bacteria 32368
256 Ga0495640_0001107 3300046533 Bacteria 21011
257 Ga0495640_0003292 3300046533 Bacteria 12994
258 Ga0495586_0001077 3300046535 Bacteria 15418
259 Ga0495587_0000531 3300046536 Bacteria 26373
260 Ga0495587_0005992 3300046536 Bacteria 7925
261 Ga0495598_0017913 3300046537 Bacteria 1833
262 Ga0495645_0010436 3300046543 Bacteria 6510
263 Ga0495667_0001212 3300046559 Bacteria 16873
264 Ga0495667_0001278 3300046559 Bacteria 16482
265 Ga0495667_0009099 3300046559 Bacteria 6743
266 Ga0495656_0014563 3300046615 Bacteria 2950
267 Ga0495634_0000938 3300046642 Bacteria 27627
268 Ga0495634_0012603 3300046642 Bacteria 6121
269 Ga0495635_0001138 3300046663 Bacteria 17745
270 Ga0495635_0003392 3300046663 Bacteria 11008
271 Ga0495635_0007000 3300046663 Bacteria 7877
272 Ga0495635_0101701 3300046663 Bacteria 1964
273 Ga0495588_0003982 3300046674 Bacteria 6488
274 Ga0495588_0010088 3300046674 Bacteria 4381
275 Ga0495657_0013498 3300046675 Bacteria 6024
276 Ga0495599_0000728 3300046678 Bacteria 18578
277 Ga0495599_0000955 3300046678 Bacteria 16170
278 Ga0495599_0031632 3300046678 Bacteria 3321
279 Ga0495599_0062376 3300046678 Bacteria 2329
280 Ga0495623_0104927 3300046679 Bacteria 1718
281 Ga0495646_0001975 3300046680 Bacteria 12369
282 Ga0495646_0008846 3300046680 Bacteria 6394
283 Ga0495658_0027239 3300046683 Bacteria 3073
284 Ga0495613_0040765 3300046689 Bacteria 3439
285 Ga0495624_0000610 3300046690 Bacteria 27927
286 Ga0495624_0003853 3300046690 Bacteria 11068
287 Ga0495624_0052906 3300046690 Bacteria 2565
288 Ga0495670_0014470 3300046691 Bacteria 3879
289 Ga0495589_0021686 3300046794 Bacteria 3282
290 Ga0495600_0001626 3300046809 Bacteria 12536
291 Ga0495600_0001677 3300046809 Bacteria 12363
292 Ga0495581_0004888 3300047315 Bacteria 7750
293 Ga0495604_0001364 3300047317 Bacteria 19978
294 Ga0495604_0002957 3300047317 Bacteria 13605
295 Ga0495636_0046815 3300047318 Bacteria 1805
296 Ga0495674_0000963 3300047319 Bacteria 27536
297 Ga0495674_0004699 3300047319 Bacteria 13134
298 Ga0495674_0005143 3300047319 Bacteria 12563
299 Ga0495674_0023482 3300047319 Bacteria 5681
300 Ga0495674_0123374 3300047319 Bacteria 2187
301 Ga0495676_0000301 3300047321 Bacteria 40028
302 Ga0495676_0002234 3300047321 Bacteria 17190
303 Ga0495680_0003393 3300047322 Bacteria 15720
304 Ga0495680_0004205 3300047322 Bacteria 13819
305 Ga0495680_0011249 3300047322 Bacteria 7933
306 Ga0495675_0001317 3300047444 Bacteria 15035
307 Ga0495675_0018262 3300047444 Bacteria 4451
308 Ga0495685_007311 3300047447 Bacteria 3644
309 Ga0495684_0000258 3300047471 Bacteria 41955
310 Ga0495684_0001534 3300047471 Bacteria 18510
311 Ga0495684_0001774 3300047471 Bacteria 17304
312 Ga0495684_0029153 3300047471 Bacteria 4236
313 Ga0495593_0000346 3300047673 Bacteria 25656
314 Ga0495602_0005891 3300048088 Bacteria 12875
315 Ga0495602_0012715 3300048088 Bacteria 8634
316 Ga0495614_0018348 3300048089 Bacteria 3031
317 Ga0496100_0012553 3300048903 Bacteria 4859
318 Ga0496100_0029232 3300048903 Bacteria 3407
319 Ga0496101_0006699 3300048904 Bacteria 7429
320 Ga0496101_0009542 3300048904 Bacteria 6381
321 Ga0496101_0010592 3300048904 Bacteria 6091
322 Ga0496102_0004075 3300048905 Bacteria 12390
323 Ga0496102_0017241 3300048905 Bacteria 6324
324 Ga0496102_0023606 3300048905 Bacteria 5464
325 Ga0496102_0059380 3300048905 Bacteria 3497
326 Ga0496102_0122023 3300048905 Bacteria 2434
327 Ga0496103_0004268 3300048906 Bacteria 8683
328 Ga0496103_0029226 3300048906 Bacteria 3349
329 Ga0496104_0007393 3300048907 Bacteria 9706
330 Ga0496104_0011596 3300048907 Bacteria 7899
331 Ga0496105_0010306 3300048908 Bacteria 7348
332 Ga0496105_0012081 3300048908 Bacteria 6837
333 Ga0496105_0022241 3300048908 Bacteria 5135
334 Ga0496105_0041100 3300048908 Bacteria 3812
335 Ga0496105_0071823 3300048908 Bacteria 2860
336 Ga0496106_0111856 3300048909 Bacteria 2127
337 Ga0496107_0010290 3300048910 Bacteria 6495
338 Ga0496108_0028015 3300048911 Bacteria 4659
339 Ga0496108_0046131 3300048911 Bacteria 3640
340 Ga0496108_0163827 3300048911 Bacteria 1922
341 Ga0496109_0019472 3300048912 Bacteria 5988
342 Ga0496109_0025868 3300048912 Bacteria 5231
343 Ga0496109_0048424 3300048912 Bacteria 3867
344 Ga0496109_0078506 3300048912 Bacteria 3040
345 Ga0496110_0020118 3300048913 Bacteria 5630
346 Ga0496110_0078389 3300048913 Bacteria 2941
347 Ga0496110_0116410 3300048913 Bacteria 2406
348 Ga0496111_0014680 3300048914 Bacteria 5357
349 Ga0496111_0014787 3300048914 Bacteria 5343
350 Ga0496111_0039736 3300048914 Bacteria 3375
351 Ga0496112_0011943 3300048915 Bacteria 7958
352 Ga0496113_0003211 3300048916 Bacteria 9744
353 Ga0496113_0131297 3300048916 Bacteria 1966
354 Ga0496114_0001519 3300048917 Bacteria 17612
355 Ga0496114_0001606 3300048917 Bacteria 17148
356 Ga0496114_0014180 3300048917 Bacteria 6393
357 Ga0496114_0019592 3300048917 Bacteria 5482
358 Ga0496114_0040321 3300048917 Bacteria 3866
359 Ga0496114_0042437 3300048917 Bacteria 3771
360 Ga0496115_0009510 3300048918 Bacteria 7220
361 Ga0496115_0010164 3300048918 Bacteria 7022
362 Ga0496115_0044012 3300048918 Bacteria 3560
363 nmdc:mga05p37_170546_c1 3300050507 Archaea 2654
364 nmdc:mga05p37_44291_c1 3300050507 Bacteria 5476
365 nmdc:mga08y16_76815_c1 3300050511 Bacteria 3481
366 nmdc:mga0rr50_7818_c1 3300050513 Bacteria 6628
367 nmdc:mga0a205_81215_c1 3300050515 Bacteria 3132
368 Ga0495601_0003915 3300053077 Bacteria 8564
369 Ga0495601_0007770 3300053077 Bacteria 6306
370 Ga0495601_0151967 3300053077 Bacteria 1511
371 Ga0495612_0000332 3300053078 Bacteria 19042
372 Ga0500635_0000183 3300053080 Bacteria 32119
373 Ga0495595_0005955 3300053084 Bacteria 4949
374 Ga0495595_0015658 3300053084 Bacteria 3236
375 Ga0495619_0006427 3300053085 Bacteria 7445
376 Ga0495619_0017384 3300053085 Bacteria 4554
377 Ga0495619_0117478 3300053085 Bacteria 1821
378 Ga0500568_0002437 3300053139 Bacteria 10951
379 Ga0530510_0238773 3300061734 Bacteria 1353
380 2644080975 2643221613 Bacteria 4622396
381 2644610681 2643221711 Bacteria 4865335
382 2644663714 2643221721 Bacteria 4486924
383 2723642288 2721755702 Bacteria 4373124
384 2774392931 2773857762 Bacteria 5971770
385 2812351112 2811994878 Bacteria 5992952
386 2819666401 2818991458 Bacteria 4794049
387 Ga0070671_100204445
388 Ga0065165_1002823
389 Ga0070683_100046052
390 Ga0070683_100242590
391 Ga0070680_100025027
392 Ga0070682_100034915
393 Ga0070674_100012894
394 Ga0070674_100179899
395 Ga0070659_100019332
396 Ga0070713_100069010
397 Ga0070713_100083732
398 Ga0070713_100160861
399 Ga0070711_100002828
400 Ga0070705_100007242
401 Ga0070700_100035696
402 Ga0070694_100019780
403 Ga0070678_100065406
404 Ga0068867_100074620
405 Ga0070685_10091214
406 Ga0070706_100134656
407 Ga0070707_100121067
408 Ga0070699_100132741
409 Ga0070679_100043519
410 Ga0070679_100148970
411 Ga0070684_100043462
412 Ga0070684_100164323
413 Ga0070697_100105766
414 Ga0070695_100090182
415 Ga0070665_100005892
416 Ga0070665_100095535
417 Ga0068855_100020063
418 Ga0068857_100048673
419 Ga0068856_100068374
420 Ga0081455_10016429
421 Ga0081538_10006752
422 Ga0081538_10020815
423 Ga0081540_1000103
424 Ga0070716_100032133
425 Ga0070712_100005242
426 Ga0070712_100005923
427 Ga0070712_100035170
428 Ga0070712_100049870
429 Ga0075429_100009322
430 Ga0075435_100008807
431 Ga0105245_10023091
432 Ga0105245_10023231
433 Ga0105245_10030967
434 Ga0105245_10076923
435 Ga0105245_10130582
436 Ga0105247_10009381
437 Ga0114129_10283803
438 Ga0105243_10020603
439 Ga0105241_10046124
440 Ga0105237_10008682
441 Ga0105237_10110590
442 Ga0105238_10010303
443 Ga0105239_10162441
444 Ga0157369_10014450
445 Ga0157369_10017824
446 Ga0157374_10034808
447 Ga0157372_10017238
448 Ga0157372_10021028
449 Ga0157372_10063781
450 Ga0157372_10108504
451 Ga0157375_10040043
452 Ga0157375_10380971
453 Ga0182008_10027214
454 Ga0157377_10079049
455 Ga0157379_10093548
456 Ga0157376_10011634
457 Ga0157376_10042047
458 Ga0157376_10103178
459 Ga0206354_11145596
460 Ga0206353_10269411
461 Ga0213875_10000009
462 Ga0207426_1000990
463 Ga0207684_10108317
464 Ga0207671_10101553
465 Ga0207693_10009285
466 Ga0207693_10082869
467 Ga0207663_10026969
468 Ga0207663_10033416
469 Ga0207660_10037770
470 Ga0207657_10023150
471 Ga0207652_10014711
472 Ga0207652_10038523
473 Ga0207646_10100281
474 Ga0207694_10051246
475 Ga0207687_10014049
476 Ga0207687_10026876
477 Ga0207687_10032028
478 Ga0207687_10056615
479 Ga0207700_10004173
480 Ga0207700_10084012
481 Ga0207664_10006279
482 Ga0207664_10011991
483 Ga0207644_10121250
484 Ga0207669_10045381
485 Ga0207665_10006391
486 Ga0207665_10021851
487 Ga0207661_10057596
488 Ga0207702_10009581
489 Ga0207648_10040938
490 Ga0207648_10097060
491 Ga0207675_100144542
492 Ga0207698_10038139
493 Ga0210000_1003877
494 Ga0209999_1003008
495 Ga0210002_1002056
496 Ga0209966_1005995
497 Ga0207428_10013081
498 Ga0207428_10025166
499 Ga0268266_10023352
500 Ga0307408_100008819
501 Ga0307405_10002150
502 Ga0307405_10023473
503 Ga0307405_10218274
504 Ga0307413_10035804
505 Ga0307410_10006116
506 Ga0307410_10011307
507 Ga0307410_10032791
508 Ga0307410_10035551
509 Ga0307410_10098775
510 Ga0326468_10000204
511 Ga0307406_10035027
512 Ga0307406_10069875
513 Ga0307406_10071681
514 Ga0307406_10133444
515 Ga0307407_10003285
516 Ga0307407_10042951
517 Ga0307407_10090910
518 Ga0307412_10043152
519 Ga0307409_100006598
520 Ga0307409_100019532
521 Ga0307409_100022044
522 Ga0307409_100027844
523 Ga0307409_100051409
524 Ga0307409_100074903
525 Ga0307409_100092276
526 Ga0307409_100198319
527 Ga0307409_100226460
528 Ga0307409_100272469
529 Ga0307416_100001615
530 Ga0307416_100002457
531 Ga0307416_100016064
532 Ga0307416_100019982
533 Ga0307416_100077119
534 Ga0307416_100147696
535 Ga0307414_10099003
536 Ga0307411_10031266
537 Ga0307411_10059030
538 Ga0307411_10071074
539 Ga0307411_10107771
540 Ga0307415_100001347
541 Ga0307415_100008974
542 Ga0307415_100011525
543 Ga0307415_100012297
544 Ga0307415_100025908
545 Ga0307415_100061325
546 Ga0307415_100162518
547 Ga0307510_10009912
548 Ga0373929_0013681
549 Ga0373934_0004638
550 Ga0373944_0008339
551 Ga0373923_0001059
552 Ga0373936_0000751
553 Ga0373936_0005346
554 Ga0373945_0001439
555 Ga0373945_0006865
556 Ga0373953_0010218
557 Ga0373954_0024330
558 Ga0373956_0007177
559 Ga0373943_0002775
560 Ga0373943_0004133
561 Ga0373946_0000098
562 Ga0373946_0000206
563 Ga0373955_0005081
564 Ga0373924_0000075
565 Ga0373924_0012025
566 Ga0373935_0000989
567 Ga0373935_0004986
568 Ga0373935_0028871
569 Ga0373927_0004245
570 Ga0373927_0045966
571 Ga0373933_0004415
572 Ga0373947_0000155
573 Ga0373947_0007630
574 Ga0373937_0016648
575 Ga0373937_0016779
576 Ga0373925_0010107
577 Ga0395900_0030222
578 Ga0395900_0165720
579 Ga0395900_0283644
580 Ga0395898_0009631
581 Ga0395898_0019361
582 Ga0395905_0072081
583 Ga0395905_0075232
584 Ga0395905_0151838
585 Ga0436364_1201245
586 Ga0395901_0004450
587 Ga0395901_0085794
588 Ga0395901_0323394
589 Ga0436365_0134839
590 Ga0436365_0167362
591 Ga0436365_0364773
592 Ga0436365_0414961
593 Ga0436363_0814100
594 Ga0436363_1223490
595 Ga0436363_1624542
596 Ga0436363_1695548
597 Ga0436362_0822246
598 Ga0451793_0008904
599 Ga0451793_0927743
600 Ga0451837_1558096
601 Ga0451843_1171658
602 Ga0439448_0019147
603 Ga0439455_0011956
604 Ga0439463_001498
605 Ga0439440_0007785
606 Ga0495592_0001480
607 Ga0495592_0012930
608 Ga0495603_0003119
609 Ga0495629_0011201
610 Ga0495641_0001726
611 Ga0495651_0001503
612 Ga0495651_0001782
613 Ga0495651_0173788
614 Ga0495653_0001807
615 Ga0495653_0012966
616 Ga0495653_0017113
617 Ga0495650_0000070
618 Ga0495580_0001037
619 Ga0495582_0000105
620 Ga0495662_0000435
621 Ga0495662_0015566
622 Ga0495664_0000562
623 Ga0495664_0001936
624 Ga0495664_0006151
625 Ga0495594_0008098
626 Ga0495596_0013508
627 Ga0495608_0000622
628 Ga0495608_0001998
629 Ga0495618_0002308
630 Ga0495618_0006706
631 Ga0495618_0033119
632 Ga0495628_0007443
633 Ga0495628_0015356
634 Ga0495630_0001376
635 Ga0495630_0011206
636 Ga0495630_0016992
637 Ga0495663_0011789
638 Ga0495666_0002768
639 Ga0495652_0002199
640 Ga0495652_0016736
641 Ga0495665_0000177
642 Ga0495640_0001107
643 Ga0495640_0003292
644 Ga0495586_0001077
645 Ga0495587_0000531
646 Ga0495587_0005992
647 Ga0495598_0017913
648 Ga0495645_0010436
649 Ga0495667_0001212
650 Ga0495667_0001278
651 Ga0495667_0009099
652 Ga0495656_0014563
653 Ga0495634_0000938
654 Ga0495634_0012603
655 Ga0495635_0001138
656 Ga0495635_0003392
657 Ga0495635_0007000
658 Ga0495635_0101701
659 Ga0495588_0003982
660 Ga0495588_0010088
661 Ga0495657_0013498
662 Ga0495599_0000728
663 Ga0495599_0000955
664 Ga0495599_0031632
665 Ga0495599_0062376
666 Ga0495623_0104927
667 Ga0495646_0001975
668 Ga0495646_0008846
669 Ga0495658_0027239
670 Ga0495613_0040765
671 Ga0495624_0000610
672 Ga0495624_0003853
673 Ga0495624_0052906
674 Ga0495670_0014470
675 Ga0495589_0021686
676 Ga0495600_0001626
677 Ga0495600_0001677
678 Ga0495581_0004888
679 Ga0495604_0001364
680 Ga0495604_0002957
681 Ga0495636_0046815
682 Ga0495674_0000963
683 Ga0495674_0004699
684 Ga0495674_0005143
685 Ga0495674_0023482
686 Ga0495674_0123374
687 Ga0495676_0000301
688 Ga0495676_0002234
689 Ga0495680_0003393
690 Ga0495680_0004205
691 Ga0495680_0011249
692 Ga0495675_0001317
693 Ga0495675_0018262
694 Ga0495685_007311
695 Ga0495684_0000258
696 Ga0495684_0001534
697 Ga0495684_0001774
698 Ga0495684_0029153
699 Ga0495593_0000346
700 Ga0495602_0005891
701 Ga0495602_0012715
702 Ga0495614_0018348
703 Ga0496100_0012553
704 Ga0496100_0029232
705 Ga0496101_0006699
706 Ga0496101_0009542
707 Ga0496101_0010592
708 Ga0496102_0004075
709 Ga0496102_0017241
710 Ga0496102_0023606
711 Ga0496102_0059380
712 Ga0496102_0122023
713 Ga0496103_0004268
714 Ga0496103_0029226
715 Ga0496104_0007393
716 Ga0496104_0011596
717 Ga0496105_0010306
718 Ga0496105_0012081
719 Ga0496105_0022241
720 Ga0496105_0041100
721 Ga0496105_0071823
722 Ga0496106_0111856
723 Ga0496107_0010290
724 Ga0496108_0028015
725 Ga0496108_0046131
726 Ga0496108_0163827
727 Ga0496109_0019472
728 Ga0496109_0025868
729 Ga0496109_0048424
730 Ga0496109_0078506
731 Ga0496110_0020118
732 Ga0496110_0078389
733 Ga0496110_0116410
734 Ga0496111_0014680
735 Ga0496111_0014787
736 Ga0496111_0039736
737 Ga0496112_0011943
738 Ga0496113_0003211
739 Ga0496113_0131297
740 Ga0496114_0001519
741 Ga0496114_0001606
742 Ga0496114_0014180
743 Ga0496114_0019592
744 Ga0496114_0040321
745 Ga0496114_0042437
746 Ga0496115_0009510
747 Ga0496115_0010164
748 Ga0496115_0044012
749 nmdc:mga05p37_170546_c1
750 nmdc:mga05p37_44291_c1
751 nmdc:mga08y16_76815_c1
752 nmdc:mga0rr50_7818_c1
753 nmdc:mga0a205_81215_c1
754 Ga0495601_0003915
755 Ga0495601_0007770
756 Ga0495601_0151967
757 Ga0495612_0000332
758 Ga0500635_0000183
759 Ga0495595_0005955
760 Ga0495595_0015658
761 Ga0495619_0006427
762 Ga0495619_0017384
763 Ga0495619_0117478
764 Ga0500568_0002437
765 Ga0530510_0238773
766 2644080975
767 2644610681
768 2644663714
769 2723642288
770 2774392931
771 2812351112
772 2819666401

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF21105

DyP_N

DyP dimeric alpha+beta barrel domain

39

190

0.73

Structural Annotation

Top 5 Hits

ID Description Score Start End
4au9-assembly2.cif.gz_B crystal structure of a fungal dyp-type peroxidase from auricularia auricula-judae 0.7792 7 456
5c2i-assembly1.cif.gz_B crystal structure of anabaena sp. dyp-type peroxidese (anapx) 0.7766 12 455
4au9-assembly2.cif.gz_B crystal structure of a fungal dyp-type peroxidase from auricularia auricula-judae 0.776 7 456
5ag1-assembly2.cif.gz_B dyp-type peroxidase of auricularia auricula-judae (aaudypi) with meso- nitrated heme 0.7757 10 456
4w7n-assembly2.cif.gz_B crystal structure of a decolorizing peroxidase (dyp) from auricularia auricula-judae. y147s and w377s double mutant 0.7742 9 456
ID Description Score Start End Superfamily
1vdhC01 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Apc35880; domain 1 0.6011 27 160 3.30.70.1030
af_Q86WU2_267_377_3.30.70.2190 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5825 27 161 3.30.70.2190
af_I1JPQ4_419_506_3.30.1360.40 Alpha Beta;2-Layer Sandwich;Gyrase A; domain 2; 0.5571 25 158 3.30.1360.40
af_Q8N465_276_395_3.30.70.2190 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5521 26 163 3.30.70.2190
af_Q9C1X2_273_393_3.30.70.2190 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits; 0.5515 26 163 3.30.70.2190
ID Description Score Start End GO Terms
AF-A0A2S8NL01-F1-model_v4 deleted 0.9224 246 327
AF-A0A2V5KIR3-F1-model_v4 Peroxidase 0.9203 9 158 GO:0004601
GO:0020037
AF-A0A2T1GCC8-F1-model_v4 DyP dimeric alpha+beta barrel domain-containing protein 0.9125 11 160
AF-A0A2S8NL01-F1-model_v4 deleted 0.9016 246 327
AF-A0A7G3DA93-F1-model_v4 deleted 0.9004 26 158

Map