F430308

General Info

Members Datasets Scaffolds Average Seq Length
385 219 770 275

Family's Representative Sequence

Representative Sequence 3300048908|Ga0496105_0008532|Ga0496105_0008532_3256_4155
Length 299
Sequence VTFSILSCSFSLRFPRAARNGVLGSGVLTPTATPAIKSIADEAFAAFNSGGRRVQSFSARYPGFTLDDAYRVTALANGLRVAKGWKPVGRKIGFTNRQMWKEYGVGAPNWGYVYDGTFHDLAVPLPLAPYTEPKIEPEIMFGLATAPSPGMDDAALLSCIAWVAHGFEIVQSIFPGWKFSLPDCTAANAMHGALLIGPRHEIGTRADEWLRTLPQFEVELYCNGKLMDRGRGSNVLDGPLSAVRHLVELLARDPDNPPLAAGEIVSTGTLTRALPAKAGETWTTKLKGIDLEGASLRFE

Samples

Sample ID Description Type Environment
1 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
18 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
19 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
28 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
29 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
30 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
31 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
34 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
35 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
36 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
37 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
38 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
39 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
40 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
41 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
42 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
43 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
44 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
45 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
46 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
47 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
54 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
55 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
56 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
57 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
58 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
59 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
60 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
61 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
62 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
63 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
64 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
65 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
66 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
71 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
100 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
101 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
102 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
103 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
104 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
105 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
106 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
107 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
109 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
110 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
111 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
112 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
113 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
114 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
115 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
116 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
117 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
118 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
119 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
120 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
121 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
122 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
123 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
124 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
125 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
126 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
127 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
128 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
133 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
134 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
135 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
136 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
137 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
138 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
139 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
140 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
141 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
142 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
143 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
144 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
145 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
146 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
147 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
148 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
149 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
150 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
153 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
156 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
157 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
158 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
166 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
167 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
172 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
173 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
174 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
175 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
176 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
183 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
187 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
188 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
189 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
190 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
191 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
192 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
193 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
194 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
195 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
199 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
200 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
208 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
209 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
210 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
211 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
212 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
213 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
214 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
215 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
216 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
217 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
218 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
219 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 98.96
Metatranscriptomes 0.78
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.08
Nodule 0.26
Rhizoplane 10.65
Rhizosphere 83.64
Stem 0
Stem Tuber 0
Unclassified 7.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496105_0008532 3300048908 Bacteria 7961
2 Ga0070658_10008781 3300005327 Bacteria 8120
3 Ga0070658_10035212 3300005327 Bacteria 4032
4 Ga0070658_10087588 3300005327 Bacteria 2563
5 Ga0070676_10211083 3300005328 Bacteria 1278
6 Ga0070683_100126768 3300005329 Unclassified 2413
7 Ga0070680_100012980 3300005336 Bacteria 6480
8 Ga0070680_100179468 3300005336 Bacteria 1783
9 Ga0070682_100139181 3300005337 Bacteria 1652
10 Ga0070660_100069856 3300005339 Bacteria 2740
11 Ga0070660_100070939 3300005339 Bacteria 2719
12 Ga0070691_10037076 3300005341 Unclassified 2300
13 Ga0070691_10051657 3300005341 Bacteria 1964
14 Ga0070661_100154720 3300005344 Bacteria 1734
15 Ga0070661_100166324 3300005344 Bacteria 1673
16 Ga0070661_100171274 3300005344 Bacteria 1649
17 Ga0070674_100214575 3300005356 Bacteria 1494
18 Ga0070673_100187516 3300005364 Bacteria 1774
19 Ga0070659_100183252 3300005366 Bacteria 1719
20 Ga0070667_100276427 3300005367 Bacteria 1507
21 Ga0070709_10000876 3300005434 Bacteria 16851
22 Ga0070709_10415433 3300005434 Bacteria 1007
23 Ga0070714_100003854 3300005435 Bacteria 11265
24 Ga0070714_100049845 3300005435 Bacteria 3564
25 Ga0070714_100536278 3300005435 Bacteria 1119
26 Ga0070713_100032437 3300005436 Bacteria 4172
27 Ga0070713_100050483 3300005436 Bacteria 3436
28 Ga0070713_100066192 3300005436 Bacteria 3038
29 Ga0070713_100120669 3300005436 Bacteria 2299
30 Ga0070713_100218193 3300005436 Bacteria 1729
31 Ga0070713_100434612 3300005436 Bacteria 1230
32 Ga0070710_10001739 3300005437 Bacteria 10290
33 Ga0070710_10032745 3300005437 Bacteria 2818
34 Ga0070710_10311542 3300005437 Unclassified 1030
35 Ga0070711_100003549 3300005439 Bacteria 9103
36 Ga0070711_100029314 3300005439 Bacteria 3630
37 Ga0070711_100103956 3300005439 Bacteria 2071
38 Ga0070711_100255584 3300005439 Bacteria 1376
39 Ga0070662_100109020 3300005457 Bacteria 2106
40 Ga0070681_10030862 3300005458 Bacteria 5379
41 Ga0070681_10054250 3300005458 Bacteria 3994
42 Ga0070681_10121108 3300005458 Unclassified 2551
43 Ga0070685_10201856 3300005466 Bacteria 1293
44 Ga0070679_100031790 3300005530 Bacteria 5218
45 Ga0070679_100059665 3300005530 Bacteria 3802
46 Ga0070679_100492082 3300005530 Bacteria 1170
47 Ga0070684_100002813 3300005535 Bacteria 12913
48 Ga0070684_100183712 3300005535 Unclassified 1901
49 Ga0068853_100098595 3300005539 Bacteria 2580
50 Ga0068853_100102041 3300005539 Bacteria 2538
51 Ga0068855_100050850 3300005563 Bacteria 4882
52 Ga0068855_100063448 3300005563 Bacteria 4312
53 Ga0068855_100092066 3300005563 Bacteria 3496
54 Ga0068855_100128982 3300005563 Bacteria 2889
55 Ga0068855_100258366 3300005563 Bacteria 1941
56 Ga0068857_100012332 3300005577 Bacteria 7438
57 Ga0068854_100055465 3300005578 Bacteria 2853
58 Ga0068852_100080175 3300005616 Bacteria 2893
59 Ga0068852_100334456 3300005616 Bacteria 1474
60 Ga0068851_10048712 3300005834 Bacteria 2148
61 Ga0081455_10057413 3300005937 Bacteria 3299
62 Ga0081540_1000731 3300005983 Bacteria 30244
63 Ga0070717_10064570 3300006028 Bacteria 3041
64 Ga0070717_10085388 3300006028 Bacteria 2656
65 Ga0075432_10008468 3300006058 Unclassified 3509
66 Ga0070715_10025357 3300006163 Bacteria 2347
67 Ga0070715_10109265 3300006163 Unclassified 1302
68 Ga0070716_100005142 3300006173 Bacteria 6323
69 Ga0070712_100089169 3300006175 Bacteria 2255
70 Ga0070712_100331291 3300006175 Bacteria 1240
71 Ga0075427_10000577 3300006194 Bacteria 4274
72 Ga0075370_10069820 3300006353 Bacteria 2009
73 Ga0068871_100041680 3300006358 Bacteria 3682
74 Ga0068871_100313187 3300006358 Bacteria 1380
75 Ga0075428_100220840 3300006844 Unclassified 2046
76 Ga0075428_100356783 3300006844 Bacteria 1569
77 Ga0075430_100001846 3300006846 Bacteria 17326
78 Ga0075431_100010844 3300006847 Bacteria 9167
79 Ga0075431_100039816 3300006847 Bacteria 4842
80 Ga0075433_10001346 3300006852 Bacteria 18007
81 Ga0075434_100009878 3300006871 Bacteria 8927
82 Ga0075434_100546506 3300006871 Unclassified 1178
83 Ga0075429_100060789 3300006880 Unclassified 3290
84 Ga0075436_100218804 3300006914 Bacteria 1351
85 Ga0097620_100174667 3300006931 Bacteria 2230
86 Ga0075435_100006725 3300007076 Bacteria 8156
87 Ga0105240_10043645 3300009093 Bacteria 5703
88 Ga0105240_10045619 3300009093 Bacteria 5559
89 Ga0105240_10097129 3300009093 Bacteria 3590
90 Ga0111539_10005016 3300009094 Bacteria 17214
91 Ga0114129_10094001 3300009147 Plasmid 4153
92 Ga0114129_10177207 3300009147 Unclassified 2903
93 Ga0105243_10299780 3300009148 Bacteria 1456
94 Ga0105242_10403312 3300009176 Bacteria 1277
95 Ga0105248_10092912 3300009177 Bacteria 3397
96 Ga0105248_10298185 3300009177 Bacteria 1815
97 Ga0105237_10082050 3300009545 Bacteria 3215
98 Ga0105237_10535707 3300009545 Bacteria 1178
99 Ga0105238_10037664 3300009551 Bacteria 4915
100 Ga0105238_10269892 3300009551 Unclassified 1682
101 Ga0105249_10222498 3300009553 Bacteria 1858
102 Ga0105239_10074576 3300010375 Bacteria 3730
103 Ga0157371_10049736 3300013102 Bacteria 2977
104 Ga0157371_10322960 3300013102 Bacteria 1120
105 Ga0157370_10155693 3300013104 Bacteria 2126
106 Ga0157369_10048225 3300013105 Bacteria 4622
107 Ga0157369_10197617 3300013105 Bacteria 2111
108 Ga0157378_10038588 3300013297 Bacteria 4234
109 Ga0157378_10200257 3300013297 Bacteria 1888
110 Ga0163162_10066124 3300013306 Bacteria 3664
111 Ga0163162_10291200 3300013306 Bacteria 1765
112 Ga0157372_10033046 3300013307 Bacteria 5679
113 Ga0157372_10254837 3300013307 Bacteria 2037
114 Ga0157375_10325547 3300013308 Bacteria 1702
115 Ga0163163_10011582 3300014325 Bacteria 8011
116 Ga0157376_10101309 3300014969 Bacteria 2517
117 Ga0163161_10271391 3300017792 Bacteria 1327
118 Ga0206353_11395020 3300020082 Bacteria 1742
119 Ga0213874_10026654 3300021377 Unclassified 1638
120 Ga0213874_10035497 3300021377 Bacteria 1465
121 Ga0207692_10001619 3300025898 Bacteria 8492
122 Ga0207692_10004063 3300025898 Bacteria 5769
123 Ga0207692_10097203 3300025898 Bacteria 1609
124 Ga0207685_10015933 3300025905 Bacteria 2394
125 Ga0207699_10007529 3300025906 Bacteria 5327
126 Ga0207699_10109331 3300025906 Bacteria 1769
127 Ga0207645_10103000 3300025907 Bacteria 1843
128 Ga0207705_10054616 3300025909 Bacteria 2879
129 Ga0207707_10004842 3300025912 Bacteria 11810
130 Ga0207707_10008811 3300025912 Bacteria 8758
131 Ga0207707_10073393 3300025912 Bacteria 2984
132 Ga0207707_10082519 3300025912 Bacteria 2806
133 Ga0207695_10063975 3300025913 Bacteria 3790
134 Ga0207671_10034979 3300025914 Bacteria 3730
135 Ga0207693_10001050 3300025915 Bacteria 24700
136 Ga0207693_10097522 3300025915 Bacteria 2305
137 Ga0207693_10151001 3300025915 Bacteria 1827
138 Ga0207693_10155623 3300025915 Bacteria 1798
139 Ga0207693_10259047 3300025915 Bacteria 1364
140 Ga0207663_10000235 3300025916 Bacteria 24574
141 Ga0207663_10006824 3300025916 Bacteria 5877
142 Ga0207663_10178161 3300025916 Bacteria 1516
143 Ga0207660_10010581 3300025917 Bacteria 5991
144 Ga0207657_10007814 3300025919 Bacteria 10915
145 Ga0207657_10068510 3300025919 Bacteria 3014
146 Ga0207657_10071646 3300025919 Bacteria 2934
147 Ga0207649_10138747 3300025920 Bacteria 1661
148 Ga0207652_10033686 3300025921 Bacteria 4314
149 Ga0207652_10058696 3300025921 Unclassified 3315
150 Ga0207652_10099385 3300025921 Bacteria 2567
151 Ga0207687_10042537 3300025927 Bacteria 3126
152 Ga0207700_10011613 3300025928 Bacteria 5627
153 Ga0207700_10050155 3300025928 Bacteria 3109
154 Ga0207700_10064398 3300025928 Bacteria 2792
155 Ga0207700_10349354 3300025928 Bacteria 1287
156 Ga0207664_10055548 3300025929 Bacteria 3142
157 Ga0207664_10164079 3300025929 Bacteria 1897
158 Ga0207644_10096085 3300025931 Unclassified 2217
159 Ga0207706_10013956 3300025933 Bacteria 7285
160 Ga0207706_10330071 3300025933 Bacteria 1327
161 Ga0207665_10000311 3300025939 Bacteria 33740
162 Ga0207711_10098687 3300025941 Bacteria 2581
163 Ga0207661_10136467 3300025944 Bacteria 2107
164 Ga0207667_10026981 3300025949 Bacteria 6265
165 Ga0207667_10042351 3300025949 Bacteria 4840
166 Ga0207667_10158050 3300025949 Bacteria 2332
167 Ga0207639_10056537 3300026041 Bacteria 3008
168 Ga0207639_10123099 3300026041 Bacteria 2134
169 Ga0207678_10197883 3300026067 Bacteria 1718
170 Ga0207674_10060975 3300026116 Bacteria 3813
171 Ga0207683_10083448 3300026121 Bacteria 2840
172 Ga0207698_10040765 3300026142 Bacteria 3454
173 Ga0207698_10136719 3300026142 Bacteria 2104
174 Ga0207428_10001429 3300027907 Bacteria 25093
175 Ga0307511_10100962 3300030521 Bacteria 1895
176 Ga0265760_10032522 3300031090 Bacteria 1540
177 Ga0265340_10029406 3300031247 Bacteria 2760
178 Ga0265339_10001704 3300031249 Bacteria 16196
179 Ga0265313_10000106 3300031595 Bacteria 83923
180 Ga0265313_10019962 3300031595 Bacteria 3712
181 Ga0265313_10021684 3300031595 Bacteria 3506
182 Ga0265342_10007190 3300031712 Bacteria 8190
183 Ga0316215_1000681 3300033544 Bacteria 3526
184 Ga0373923_0041306 3300035111 Bacteria 1901
185 Ga0373945_0059631 3300035116 Bacteria 1421
186 Ga0373953_0002954 3300035117 Bacteria 5197
187 Ga0373954_0085772 3300035118 Bacteria 1508
188 Ga0373957_0020826 3300035120 Bacteria 2321
189 Ga0373946_0044594 3300035171 Bacteria 1831
190 Ga0373955_0007075 3300035172 Bacteria 5139
191 Ga0373955_0012180 3300035172 Bacteria 4128
192 Ga0373955_0115439 3300035172 Bacteria 1556
193 Ga0373931_0076291 3300035691 Unclassified 1841
194 Ga0373935_0049521 3300035692 Bacteria 2663
195 Ga0373935_0269186 3300035692 Bacteria 1197
196 Ga0373927_0122231 3300035695 Unclassified 1699
197 Ga0373927_0197115 3300035695 Bacteria 1321
198 Ga0373947_0089579 3300035725 Bacteria 1916
199 Ga0373937_0017187 3300036401 Bacteria 6438
200 Ga0373937_0025635 3300036401 Bacteria 5324
201 Ga0373937_0064468 3300036401 Bacteria 3370
202 Ga0373937_0094082 3300036401 Bacteria 2779
203 Ga0372808_012393 3300036459 Unclassified 1210
204 Ga0373925_0117586 3300037068 Bacteria 2060
205 Ga0373925_0283269 3300037068 Bacteria 1335
206 Ga0436365_0156697 3300039437 Bacteria 4513
207 Ga0436365_0236315 3300039437 Bacteria 6412
208 Ga0436365_0396557 3300039437 Bacteria 1496
209 Ga0436360_0517928 3300039438 Bacteria 1030
210 Ga0436363_0007105 3300039450 Bacteria 3492
211 Ga0436363_0403748 3300039450 Bacteria 2113
212 Ga0495592_0005143 3300046454 Bacteria 9640
213 Ga0495592_0046619 3300046454 Bacteria 3230
214 Ga0495603_0112582 3300046455 Bacteria 1587
215 Ga0495603_0246660 3300046455 Unclassified 1028
216 Ga0495629_0003532 3300046459 Bacteria 11816
217 Ga0495629_0053264 3300046459 Bacteria 2831
218 Ga0495641_0121579 3300046461 Unclassified 1165
219 Ga0495580_0139549 3300046472 Bacteria 1680
220 Ga0495580_0325021 3300046472 Unclassified 1045
221 Ga0495639_0131552 3300046475 Bacteria 1198
222 Ga0495639_0140533 3300046475 Bacteria 1160
223 Ga0495664_0002406 3300046477 Bacteria 10045
224 Ga0495664_0014986 3300046477 Bacteria 4402
225 Ga0495664_0015746 3300046477 Bacteria 4303
226 Ga0495594_0318492 3300046499 Unclassified 886
227 Ga0495608_0014713 3300046511 Bacteria 5429
228 Ga0495608_0188353 3300046511 Bacteria 1303
229 Ga0495618_0008702 3300046514 Bacteria 6134
230 Ga0495618_0017157 3300046514 Bacteria 4437
231 Ga0495618_0119317 3300046514 Bacteria 1689
232 Ga0495628_0015577 3300046516 Bacteria 6348
233 Ga0495652_0060197 3300046529 Bacteria 3210
234 Ga0495652_0115327 3300046529 Bacteria 2152
235 Ga0495652_0191407 3300046529 Bacteria 1561
236 Ga0495640_0005720 3300046533 Bacteria 9882
237 Ga0495640_0028912 3300046533 Bacteria 3985
238 Ga0495640_0112622 3300046533 Bacteria 1776
239 Ga0495645_0006548 3300046543 Bacteria 8089
240 Ga0495645_0017444 3300046543 Bacteria 5142
241 Ga0495667_0007239 3300046559 Bacteria 7531
242 Ga0495667_0076120 3300046559 Bacteria 2183
243 Ga0495634_0016088 3300046642 Bacteria 5354
244 Ga0495634_0153761 3300046642 Unclassified 1453
245 Ga0495635_0023194 3300046663 Bacteria 4324
246 Ga0495657_0012055 3300046675 Bacteria 6432
247 Ga0495599_0169885 3300046678 Bacteria 1346
248 Ga0495623_0031488 3300046679 Bacteria 3409
249 Ga0495623_0045653 3300046679 Bacteria 2782
250 Ga0495646_0002962 3300046680 Bacteria 10517
251 Ga0495658_0145132 3300046683 Bacteria 1454
252 Ga0495613_0025680 3300046689 Bacteria 4390
253 Ga0495624_0217296 3300046690 Unclassified 1159
254 Ga0495600_0016056 3300046809 Bacteria 4746
255 Ga0495581_0023880 3300047315 Bacteria 3543
256 Ga0495604_0004163 3300047317 Bacteria 11475
257 Ga0495674_0017035 3300047319 Bacteria 6771
258 Ga0495674_0036689 3300047319 Bacteria 4410
259 Ga0495674_0068575 3300047319 Bacteria 3069
260 Ga0495674_0307964 3300047319 Bacteria 1293
261 Ga0495676_0244680 3300047321 Bacteria 1226
262 Ga0495676_0252993 3300047321 Unclassified 1201
263 Ga0495680_0007053 3300047322 Bacteria 10356
264 Ga0495680_0115061 3300047322 Bacteria 1990
265 Ga0495675_0002556 3300047444 Bacteria 10891
266 Ga0495684_0105879 3300047471 Bacteria 2125
267 Ga0495684_0169419 3300047471 Bacteria 1625
268 Ga0495593_0024102 3300047673 Bacteria 3376
269 Ga0495593_0058264 3300047673 Bacteria 2026
270 Ga0495602_0035094 3300048088 Bacteria 4681
271 Ga0496100_0043160 3300048903 Bacteria 2883
272 Ga0496100_0197310 3300048903 Bacteria 1465
273 Ga0496100_0264456 3300048903 Bacteria 1277
274 Ga0496101_0068283 3300048904 Bacteria 2598
275 Ga0496101_0183994 3300048904 Bacteria 1610
276 Ga0496102_0022705 3300048905 Bacteria 5561
277 Ga0496102_0116130 3300048905 Bacteria 2497
278 Ga0496103_0130623 3300048906 Bacteria 1604
279 Ga0496104_0005216 3300048907 Bacteria 11362
280 Ga0496104_0117238 3300048907 Bacteria 2555
281 Ga0496104_0406321 3300048907 Bacteria 1274
282 Ga0496104_0620636 3300048907 Unclassified 991
283 Ga0496105_0094504 3300048908 Bacteria 2469
284 Ga0496106_0063907 3300048909 Bacteria 2798
285 Ga0496106_0072646 3300048909 Bacteria 2631
286 Ga0496106_0156615 3300048909 Bacteria 1799
287 Ga0496107_0034348 3300048910 Bacteria 3633
288 Ga0496107_0083821 3300048910 Bacteria 2325
289 Ga0496107_0090990 3300048910 Bacteria 2229
290 Ga0496107_0195280 3300048910 Bacteria 1504
291 Ga0496108_0009704 3300048911 Bacteria 7801
292 Ga0496108_0049273 3300048911 Bacteria 3523
293 Ga0496109_0024526 3300048912 Bacteria 5363
294 Ga0496109_0041049 3300048912 Bacteria 4192
295 Ga0496109_0312767 3300048912 Bacteria 1482
296 Ga0496110_0084621 3300048913 Bacteria 2831
297 Ga0496111_0243285 3300048914 Bacteria 1336
298 Ga0496112_0004624 3300048915 Bacteria 11706
299 Ga0496112_0083140 3300048915 Bacteria 3166
300 Ga0496112_0119193 3300048915 Bacteria 2609
301 Ga0496112_0561687 3300048915 Bacteria 1075
302 Ga0496113_0127329 3300048916 Bacteria 1995
303 Ga0496114_0005739 3300048917 Bacteria 9741
304 Ga0496114_0050663 3300048917 Bacteria 3457
305 Ga0496114_0221761 3300048917 Bacteria 1660
306 Ga0496114_0503831 3300048917 Bacteria 1071
307 Ga0496115_0011370 3300048918 Bacteria 6669
308 Ga0496115_0127974 3300048918 Bacteria 2092
309 Ga0496115_0227907 3300048918 Unclassified 1537
310 Ga0496115_0305191 3300048918 Bacteria 1304
311 Ga0496121_0054129 3300048924 Bacteria 3356
312 Ga0496126_0026675 3300048929 Bacteria 5533
313 Ga0496126_0091722 3300048929 Bacteria 2670
314 Ga0501032_0206462 3300049569 Bacteria 1281
315 Ga0501033_0117876 3300049570 Bacteria 1928
316 Ga0501034_0002279 3300049571 Bacteria 23553
317 Ga0501034_0048334 3300049571 Bacteria 4294
318 Ga0501034_0094828 3300049571 Bacteria 2980
319 Ga0501034_0327950 3300049571 Bacteria 1462
320 Ga0501036_0019321 3300049572 Bacteria 5718
321 Ga0501036_0109293 3300049572 Bacteria 2336
322 Ga0501037_0003059 3300049573 Bacteria 12126
323 Ga0501037_0195101 3300049573 Bacteria 1432
324 Ga0501038_0114829 3300049574 Bacteria 2226
325 Ga0501039_0289540 3300049575 Bacteria 1287
326 Ga0501043_0059996 3300049579 Bacteria 2985
327 Ga0501046_0031651 3300049580 Bacteria 4286
328 Ga0501046_0264240 3300049580 Bacteria 1263
329 Ga0501047_0002756 3300049581 Bacteria 16693
330 Ga0501047_0099673 3300049581 Bacteria 2784
331 Ga0501048_0000429 3300049582 Bacteria 29567
332 Ga0501048_0059310 3300049582 Bacteria 2712
333 Ga0501067_0062389 3300049583 Bacteria 2063
334 Ga0501069_0103490 3300049585 Bacteria 1617
335 Ga0501070_0055905 3300049586 Bacteria 3271
336 Ga0501070_0153829 3300049586 Bacteria 1897
337 Ga0501071_0171217 3300049587 Bacteria 1625
338 Ga0501071_0178602 3300049587 Bacteria 1590
339 Ga0501073_0041864 3300049589 Bacteria 3235
340 Ga0501073_0089565 3300049589 Bacteria 2139
341 Ga0501074_0040751 3300049590 Bacteria 3362
342 Ga0501079_0284651 3300049741 Bacteria 1292
343 Ga0501079_0327829 3300049741 Bacteria 1199
344 Ga0501080_0006227 3300049742 Bacteria 10708
345 Ga0501080_0076250 3300049742 Bacteria 3118
346 Ga0501080_0177707 3300049742 Bacteria 1960
347 Ga0501083_0004489 3300049744 Bacteria 9855
348 Ga0501083_0066852 3300049744 Bacteria 2394
349 Ga0501083_0298470 3300049744 Unclassified 1048
350 Ga0501035_0009884 3300049822 Bacteria 8856
351 Ga0501044_0020737 3300049823 Bacteria 7015
352 Ga0501044_0036857 3300049823 Bacteria 5115
353 Ga0501044_0052096 3300049823 Bacteria 4219
354 nmdc:mga0yw44_94290_c1 3300050492 Bacteria 1897
355 nmdc:mga07m45_84996_c1 3300050496 Bacteria 1809
356 nmdc:mga05p37_3938_c1 3300050507 Bacteria 14912
357 nmdc:mga09592_3119_c1 3300050508 Bacteria 13453
358 nmdc:mga0qj67_165561_c1 3300050509 Bacteria 1795
359 nmdc:mga0qj67_5979_c1 3300050509 Bacteria 8917
360 nmdc:mga06r32_311746_c1 3300050510 Bacteria 1559
361 nmdc:mga06r32_3736_c1 3300050510 Bacteria 13616
362 nmdc:mga08y16_3226_c2 3300050511 Bacteria 14776
363 nmdc:mga0n895_1795_c1 3300050512 Bacteria 16306
364 nmdc:mga0n895_410928_c1 3300050512 Bacteria 1368
365 nmdc:mga0rr50_1015_c1 3300050513 Bacteria 15232
366 nmdc:mga0a205_1082_c1 3300050515 Bacteria 22615
367 Ga0495601_0000963 3300053077 Bacteria 15732
368 Ga0495601_0072451 3300053077 Bacteria 2200
369 Ga0495601_0128031 3300053077 Bacteria 1652
370 Ga0495612_0008798 3300053078 Bacteria 4093
371 Ga0495595_0002125 3300053084 Bacteria 7698
372 Ga0495619_0004890 3300053085 Bacteria 8508
373 Ga0495619_0057335 3300053085 Bacteria 2584
374 Ga0495619_0354678 3300053085 Bacteria 1014
375 Ga0500566_0006955 3300053094 Bacteria 6700
376 Ga0500595_000680 3300053119 Bacteria 20345
377 Ga0500603_022825 3300053150 Unclassified 1553
378 Ga0500637_0001406 3300053178 Bacteria 10246
379 Ga0501084_0365453 3300054114 Bacteria 1219
380 Ga0500661_000472 3300055283 Bacteria 7449
381 Ga0501082_0002103 3300060353 Bacteria 17534
382 Ga0501082_0025665 3300060353 Bacteria 5077
383 Ga0501082_0139663 3300060353 Bacteria 2103
384 Ga0530510_0167348 3300061734 Bacteria 1628
385 2513892713 2513237141 Bacteria 8496279
386 Ga0496105_0008532
387 Ga0070658_10008781
388 Ga0070658_10035212
389 Ga0070658_10087588
390 Ga0070676_10211083
391 Ga0070683_100126768
392 Ga0070680_100012980
393 Ga0070680_100179468
394 Ga0070682_100139181
395 Ga0070660_100069856
396 Ga0070660_100070939
397 Ga0070691_10037076
398 Ga0070691_10051657
399 Ga0070661_100154720
400 Ga0070661_100166324
401 Ga0070661_100171274
402 Ga0070674_100214575
403 Ga0070673_100187516
404 Ga0070659_100183252
405 Ga0070667_100276427
406 Ga0070709_10000876
407 Ga0070709_10415433
408 Ga0070714_100003854
409 Ga0070714_100049845
410 Ga0070714_100536278
411 Ga0070713_100032437
412 Ga0070713_100050483
413 Ga0070713_100066192
414 Ga0070713_100120669
415 Ga0070713_100218193
416 Ga0070713_100434612
417 Ga0070710_10001739
418 Ga0070710_10032745
419 Ga0070710_10311542
420 Ga0070711_100003549
421 Ga0070711_100029314
422 Ga0070711_100103956
423 Ga0070711_100255584
424 Ga0070662_100109020
425 Ga0070681_10030862
426 Ga0070681_10054250
427 Ga0070681_10121108
428 Ga0070685_10201856
429 Ga0070679_100031790
430 Ga0070679_100059665
431 Ga0070679_100492082
432 Ga0070684_100002813
433 Ga0070684_100183712
434 Ga0068853_100098595
435 Ga0068853_100102041
436 Ga0068855_100050850
437 Ga0068855_100063448
438 Ga0068855_100092066
439 Ga0068855_100128982
440 Ga0068855_100258366
441 Ga0068857_100012332
442 Ga0068854_100055465
443 Ga0068852_100080175
444 Ga0068852_100334456
445 Ga0068851_10048712
446 Ga0081455_10057413
447 Ga0081540_1000731
448 Ga0070717_10064570
449 Ga0070717_10085388
450 Ga0075432_10008468
451 Ga0070715_10025357
452 Ga0070715_10109265
453 Ga0070716_100005142
454 Ga0070712_100089169
455 Ga0070712_100331291
456 Ga0075427_10000577
457 Ga0075370_10069820
458 Ga0068871_100041680
459 Ga0068871_100313187
460 Ga0075428_100220840
461 Ga0075428_100356783
462 Ga0075430_100001846
463 Ga0075431_100010844
464 Ga0075431_100039816
465 Ga0075433_10001346
466 Ga0075434_100009878
467 Ga0075434_100546506
468 Ga0075429_100060789
469 Ga0075436_100218804
470 Ga0097620_100174667
471 Ga0075435_100006725
472 Ga0105240_10043645
473 Ga0105240_10045619
474 Ga0105240_10097129
475 Ga0111539_10005016
476 Ga0114129_10094001
477 Ga0114129_10177207
478 Ga0105243_10299780
479 Ga0105242_10403312
480 Ga0105248_10092912
481 Ga0105248_10298185
482 Ga0105237_10082050
483 Ga0105237_10535707
484 Ga0105238_10037664
485 Ga0105238_10269892
486 Ga0105249_10222498
487 Ga0105239_10074576
488 Ga0157371_10049736
489 Ga0157371_10322960
490 Ga0157370_10155693
491 Ga0157369_10048225
492 Ga0157369_10197617
493 Ga0157378_10038588
494 Ga0157378_10200257
495 Ga0163162_10066124
496 Ga0163162_10291200
497 Ga0157372_10033046
498 Ga0157372_10254837
499 Ga0157375_10325547
500 Ga0163163_10011582
501 Ga0157376_10101309
502 Ga0163161_10271391
503 Ga0206353_11395020
504 Ga0213874_10026654
505 Ga0213874_10035497
506 Ga0207692_10001619
507 Ga0207692_10004063
508 Ga0207692_10097203
509 Ga0207685_10015933
510 Ga0207699_10007529
511 Ga0207699_10109331
512 Ga0207645_10103000
513 Ga0207705_10054616
514 Ga0207707_10004842
515 Ga0207707_10008811
516 Ga0207707_10073393
517 Ga0207707_10082519
518 Ga0207695_10063975
519 Ga0207671_10034979
520 Ga0207693_10001050
521 Ga0207693_10097522
522 Ga0207693_10151001
523 Ga0207693_10155623
524 Ga0207693_10259047
525 Ga0207663_10000235
526 Ga0207663_10006824
527 Ga0207663_10178161
528 Ga0207660_10010581
529 Ga0207657_10007814
530 Ga0207657_10068510
531 Ga0207657_10071646
532 Ga0207649_10138747
533 Ga0207652_10033686
534 Ga0207652_10058696
535 Ga0207652_10099385
536 Ga0207687_10042537
537 Ga0207700_10011613
538 Ga0207700_10050155
539 Ga0207700_10064398
540 Ga0207700_10349354
541 Ga0207664_10055548
542 Ga0207664_10164079
543 Ga0207644_10096085
544 Ga0207706_10013956
545 Ga0207706_10330071
546 Ga0207665_10000311
547 Ga0207711_10098687
548 Ga0207661_10136467
549 Ga0207667_10026981
550 Ga0207667_10042351
551 Ga0207667_10158050
552 Ga0207639_10056537
553 Ga0207639_10123099
554 Ga0207678_10197883
555 Ga0207674_10060975
556 Ga0207683_10083448
557 Ga0207698_10040765
558 Ga0207698_10136719
559 Ga0207428_10001429
560 Ga0307511_10100962
561 Ga0265760_10032522
562 Ga0265340_10029406
563 Ga0265339_10001704
564 Ga0265313_10000106
565 Ga0265313_10019962
566 Ga0265313_10021684
567 Ga0265342_10007190
568 Ga0316215_1000681
569 Ga0373923_0041306
570 Ga0373945_0059631
571 Ga0373953_0002954
572 Ga0373954_0085772
573 Ga0373957_0020826
574 Ga0373946_0044594
575 Ga0373955_0007075
576 Ga0373955_0012180
577 Ga0373955_0115439
578 Ga0373931_0076291
579 Ga0373935_0049521
580 Ga0373935_0269186
581 Ga0373927_0122231
582 Ga0373927_0197115
583 Ga0373947_0089579
584 Ga0373937_0017187
585 Ga0373937_0025635
586 Ga0373937_0064468
587 Ga0373937_0094082
588 Ga0372808_012393
589 Ga0373925_0117586
590 Ga0373925_0283269
591 Ga0436365_0156697
592 Ga0436365_0236315
593 Ga0436365_0396557
594 Ga0436360_0517928
595 Ga0436363_0007105
596 Ga0436363_0403748
597 Ga0495592_0005143
598 Ga0495592_0046619
599 Ga0495603_0112582
600 Ga0495603_0246660
601 Ga0495629_0003532
602 Ga0495629_0053264
603 Ga0495641_0121579
604 Ga0495580_0139549
605 Ga0495580_0325021
606 Ga0495639_0131552
607 Ga0495639_0140533
608 Ga0495664_0002406
609 Ga0495664_0014986
610 Ga0495664_0015746
611 Ga0495594_0318492
612 Ga0495608_0014713
613 Ga0495608_0188353
614 Ga0495618_0008702
615 Ga0495618_0017157
616 Ga0495618_0119317
617 Ga0495628_0015577
618 Ga0495652_0060197
619 Ga0495652_0115327
620 Ga0495652_0191407
621 Ga0495640_0005720
622 Ga0495640_0028912
623 Ga0495640_0112622
624 Ga0495645_0006548
625 Ga0495645_0017444
626 Ga0495667_0007239
627 Ga0495667_0076120
628 Ga0495634_0016088
629 Ga0495634_0153761
630 Ga0495635_0023194
631 Ga0495657_0012055
632 Ga0495599_0169885
633 Ga0495623_0031488
634 Ga0495623_0045653
635 Ga0495646_0002962
636 Ga0495658_0145132
637 Ga0495613_0025680
638 Ga0495624_0217296
639 Ga0495600_0016056
640 Ga0495581_0023880
641 Ga0495604_0004163
642 Ga0495674_0017035
643 Ga0495674_0036689
644 Ga0495674_0068575
645 Ga0495674_0307964
646 Ga0495676_0244680
647 Ga0495676_0252993
648 Ga0495680_0007053
649 Ga0495680_0115061
650 Ga0495675_0002556
651 Ga0495684_0105879
652 Ga0495684_0169419
653 Ga0495593_0024102
654 Ga0495593_0058264
655 Ga0495602_0035094
656 Ga0496100_0043160
657 Ga0496100_0197310
658 Ga0496100_0264456
659 Ga0496101_0068283
660 Ga0496101_0183994
661 Ga0496102_0022705
662 Ga0496102_0116130
663 Ga0496103_0130623
664 Ga0496104_0005216
665 Ga0496104_0117238
666 Ga0496104_0406321
667 Ga0496104_0620636
668 Ga0496105_0094504
669 Ga0496106_0063907
670 Ga0496106_0072646
671 Ga0496106_0156615
672 Ga0496107_0034348
673 Ga0496107_0083821
674 Ga0496107_0090990
675 Ga0496107_0195280
676 Ga0496108_0009704
677 Ga0496108_0049273
678 Ga0496109_0024526
679 Ga0496109_0041049
680 Ga0496109_0312767
681 Ga0496110_0084621
682 Ga0496111_0243285
683 Ga0496112_0004624
684 Ga0496112_0083140
685 Ga0496112_0119193
686 Ga0496112_0561687
687 Ga0496113_0127329
688 Ga0496114_0005739
689 Ga0496114_0050663
690 Ga0496114_0221761
691 Ga0496114_0503831
692 Ga0496115_0011370
693 Ga0496115_0127974
694 Ga0496115_0227907
695 Ga0496115_0305191
696 Ga0496121_0054129
697 Ga0496126_0026675
698 Ga0496126_0091722
699 Ga0501032_0206462
700 Ga0501033_0117876
701 Ga0501034_0002279
702 Ga0501034_0048334
703 Ga0501034_0094828
704 Ga0501034_0327950
705 Ga0501036_0019321
706 Ga0501036_0109293
707 Ga0501037_0003059
708 Ga0501037_0195101
709 Ga0501038_0114829
710 Ga0501039_0289540
711 Ga0501043_0059996
712 Ga0501046_0031651
713 Ga0501046_0264240
714 Ga0501047_0002756
715 Ga0501047_0099673
716 Ga0501048_0000429
717 Ga0501048_0059310
718 Ga0501067_0062389
719 Ga0501069_0103490
720 Ga0501070_0055905
721 Ga0501070_0153829
722 Ga0501071_0171217
723 Ga0501071_0178602
724 Ga0501073_0041864
725 Ga0501073_0089565
726 Ga0501074_0040751
727 Ga0501079_0284651
728 Ga0501079_0327829
729 Ga0501080_0006227
730 Ga0501080_0076250
731 Ga0501080_0177707
732 Ga0501083_0004489
733 Ga0501083_0066852
734 Ga0501083_0298470
735 Ga0501035_0009884
736 Ga0501044_0020737
737 Ga0501044_0036857
738 Ga0501044_0052096
739 nmdc:mga0yw44_94290_c1
740 nmdc:mga07m45_84996_c1
741 nmdc:mga05p37_3938_c1
742 nmdc:mga09592_3119_c1
743 nmdc:mga0qj67_165561_c1
744 nmdc:mga0qj67_5979_c1
745 nmdc:mga06r32_311746_c1
746 nmdc:mga06r32_3736_c1
747 nmdc:mga08y16_3226_c2
748 nmdc:mga0n895_1795_c1
749 nmdc:mga0n895_410928_c1
750 nmdc:mga0rr50_1015_c1
751 nmdc:mga0a205_1082_c1
752 Ga0495601_0000963
753 Ga0495601_0072451
754 Ga0495601_0128031
755 Ga0495612_0008798
756 Ga0495595_0002125
757 Ga0495619_0004890
758 Ga0495619_0057335
759 Ga0495619_0354678
760 Ga0500566_0006955
761 Ga0500595_000680
762 Ga0500603_022825
763 Ga0500637_0001406
764 Ga0501084_0365453
765 Ga0500661_000472
766 Ga0501082_0002103
767 Ga0501082_0025665
768 Ga0501082_0139663
769 Ga0530510_0167348
770 2513892713

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5d2k-assembly2.cif.gz_B 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with magnesium and 2-oxoadipate 0.9205 5 272
2wqt-assembly1.cif.gz_A dodecahedral assembly of mhpd 0.9168 8 272
5d2i-assembly2.cif.gz_B 4-oxalocrotonate decarboxylase from pseudomonas putida g7 - complexed with calcium and acetate 0.9149 8 272
2eb5-assembly1.cif.gz_E-2 crystal structure of hpcg complexed with oxalate 0.9122 8 272
2eb5-assembly1.cif.gz_A crystal structure of hpcg complexed with oxalate 0.9121 8 272
ID Description Score Start End Superfamily
5d2kB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9205 5 272 3.90.850.10
2wqtB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9168 8 272 3.90.850.10
af_I6XHH5_1_260_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9021 1 271 3.90.850.10
5d2kB00 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.9005 5 272 3.90.850.10
af_I6XHH5_1_260_3.90.850.10 Alpha Beta;Alpha-Beta Complex;Fumarylacetoacetate hydrolase; domain 2;Fumarylacetoacetase-like, C-terminal domain 0.8988 1 271 3.90.850.10
ID Description Score Start End GO Terms
AF-A0A833HBL0-F1-model_v4 Hydratase 0.978 6 272 GO:0005737
GO:0008684
AF-A0A4Q3Z9J1-F1-model_v4 Hydratase 0.9772 44 272 GO:0005737
GO:0008684
AF-A0A1X7PZX7-F1-model_v4 2-oxo-3-hexenedioate decarboxylase 0.9767 8 272 GO:0005737
GO:0008684
AF-A0A363TFC2-F1-model_v4 Hydratase 0.9751 10 272 GO:0005737
GO:0008684
AF-A0A4Z1BSR2-F1-model_v4 Hydratase 0.9742 7 272 GO:0005737
GO:0008684

Map