metagRoot

F430227

General Info

Members	Datasets	Scaffolds	Average Seq Length
385	257	373	358

Family's Representative Sequence

Representative Sequence	3300031090\|Ga0265760_10002779\|Ga0265760_100027792
Length	395
Sequence	VSARRCLIPVFKLNQRKTNKPKNRPADTGRSPIRMTEPSTKAFADSSAPVRKGEELDAARLGAYLAEQLHEPHARLEIEQFPQGFSNLTYLVRFGSEDYVLRRPPFGNTVKSAHDMGREYNVLSKLSKVYELAPKPIVYCTDEAVLGAPFYLMERRRGVILRRKLPKDLKLDPATFRGLGTAFIDNLARLHALDFRAAGLADLGKPEGYVERQVNGWIGRYEKAKTDEWPEMDSVAKWLVENRPPESGAALIHNDYKFDNVVLDSHDLTKIIGVLDWEMCTIGDPLMDLGCTLAYWIQADDTEALQYFVPGPTFLPGNLTRRELLERYAQTSDRDVRQVLFYYCYGLYKLAVIIQQIYARFARGFTQDPRFADMNQQVGSLSRSAARAIAIGGVS

Samples

	Sample ID	Description	Type	Environment
1	2585427649	Amycolatopsis japonica MG417-CF17, DSM 44213	Isolate	Unclassified
2	2643221593	Lysobacter sp. Root690	Isolate	Unclassified
3	2808606522	Amycolatopsis sp. BJA-103	Isolate	Unclassified
4	2818991436	Collimonas arenae 515	Isolate	Unclassified
5	2881714928	Pseudidiomarina mangrovi ZQ330	Isolate	Rhizosphere
6	2885270888	Paraburkholderia sp. UYCPa14C	Isolate	Unclassified
7	2915768154	Amycolatopsis pittospori PIP199	Isolate	Unclassified
8	2936361878	Neobacillus endophyticus BRMEA1	Isolate	Unclassified
9	2941489479	Lysobacter enzymogenes 2943	Isolate	Rhizosphere
10	2977254563	Bacillus sp. SORGH_AS 510	Isolate	Unclassified
11	2990275345	Bacillus sp. SLBN-46	Isolate	Unclassified
12	2995948881	Lysobacter enzymogenes B25	Isolate	Unclassified
13	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
14	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
15	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
16	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
17	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
18	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
19	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
20	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
21	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
22	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
23	3300003775	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2	Metagenome	Endosphere
24	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
25	3300003790	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2	Metagenome	Endosphere
26	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
27	3300005289	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2)	Metagenome	Rhizosphere
28	3300005295	Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2)	Metagenome	Rhizosphere
29	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
30	3300005330	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG	Metagenome	Rhizosphere
31	3300005336	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG	Metagenome	Rhizosphere
32	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
33	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
34	3300005365	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG	Metagenome	Rhizosphere
35	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
36	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
37	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
38	3300005438	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG	Metagenome	Rhizosphere
39	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
40	3300005444	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG	Metagenome	Rhizosphere
41	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
42	3300005458	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG	Metagenome	Rhizosphere
43	3300005467	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG	Metagenome	Rhizosphere
44	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
45	3300005471	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG	Metagenome	Rhizosphere
46	3300005518	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG	Metagenome	Rhizosphere
47	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
48	3300005536	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG	Metagenome	Rhizosphere
49	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
50	3300005545	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG	Metagenome	Rhizosphere
51	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
52	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
53	3300005549	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG	Metagenome	Rhizosphere
54	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
55	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
56	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
57	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
58	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
59	3300005719	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2	Metagenome	Rhizosphere
60	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
61	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
62	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
63	3300005844	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2	Metagenome	Rhizosphere
64	3300005937	Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1	Metagenome	Rhizosphere
65	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
66	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
67	3300006847	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5	Metagenome	Rhizosphere
68	3300006871	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3	Metagenome	Rhizosphere
69	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
70	3300007265	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1	Metagenome	Rhizosphere
71	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
72	3300009094	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2)	Metagenome	Rhizosphere
73	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
74	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
75	3300009148	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG	Metagenome	Rhizosphere
76	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
77	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
78	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
79	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
80	3300009553	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG	Metagenome	Rhizosphere
81	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
82	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
83	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
84	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
85	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
86	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
87	3300014326	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG	Metagenome	Rhizosphere
88	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
89	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
90	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
91	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
92	3300015689	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A02	Metagenome	Rhizosphere
93	3300024225	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5	Metagenome	Rhizosphere
94	3300024227	Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4	Metagenome	Rhizosphere
95	3300025207	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
96	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
97	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
98	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
99	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
100	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
101	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
102	3300025245	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3)	Metagenome	Endosphere
103	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
104	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
105	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
106	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
107	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
108	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
109	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
110	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
111	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
112	3300025885	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
113	3300025898	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
114	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
115	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
116	3300025910	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
117	3300025912	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
118	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
119	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
120	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
121	3300025917	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
122	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
123	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
124	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
125	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
126	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
127	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
128	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
129	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
130	3300025935	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
131	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
132	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
133	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
134	3300025961	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
135	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
136	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
137	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
138	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
139	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
140	3300027671	Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2)	Metagenome	Rhizosphere
141	3300028016	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1	Metagenome	Rhizosphere
142	3300028017	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4	Metagenome	Rhizosphere
143	3300028023	Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5	Metagenome	Rhizosphere
144	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
145	3300028380	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
146	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
147	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
148	3300030760	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
149	3300030878	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
150	3300031090	Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
151	3300031239	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG	Metagenome	Rhizosphere
152	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
153	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
154	3300031251	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG	Metagenome	Rhizosphere
155	3300031727	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5	Metagenome	Rhizosphere
156	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
157	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
158	3300031838	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM	Metagenome	Unclassified
159	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
160	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
161	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
162	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
163	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
164	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
165	3300033547	Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1	Metagenome	Unclassified
166	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
167	3300035111	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11	Metagenome	Rhizosphere
168	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
169	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
170	3300035398	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1	Metagenome	Rhizosphere
171	3300035410	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12	Metagenome	Rhizosphere
172	3300035691	Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4	Metagenome	Rhizosphere
173	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
174	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
175	3300035724	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1	Metagenome	Rhizosphere
176	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
177	3300036401	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16	Metagenome	Rhizosphere
178	3300036647	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA	Metagenome	Rhizosphere
179	3300036712	Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA	Metagenome	Rhizosphere
180	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
181	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
182	3300038725	Seagrass microbial communities from Seahorse Key, FL, USA - HV0818	Metagenome	Unclassified
183	3300038726	Seagrass microbial communities from Seahorse Key, FL, USA - TH0319	Metagenome	Unclassified
184	3300039093	Seagrass microbial communities from Seahorse Key, FL, USA - TH0818	Metagenome	Unclassified
185	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
186	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
187	3300039453	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2	Metagenome	Rhizosphere
188	3300041407	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416	Metagenome	Rhizosphere
189	3300042876	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED	Metagenome	Rhizosphere
190	3300044673	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED	Metagenome	Rhizosphere
191	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
192	3300044712	Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED	Metagenome	Rhizosphere
193	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
194	3300045051	Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED	Metagenome	Rhizosphere
195	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
196	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
197	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
198	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
199	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
200	3300046491	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere	Metagenome	Rhizosphere
201	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
202	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
203	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
204	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
205	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
206	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
207	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
208	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
209	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
210	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
211	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
212	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
213	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
214	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
215	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
216	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
217	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
218	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
219	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
220	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
221	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
222	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
223	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
224	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
225	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
226	3300049579	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01	Metagenome	Rhizosphere
227	3300049581	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02	Metagenome	Rhizosphere
228	3300049583	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01	Metagenome	Rhizosphere
229	3300049584	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02	Metagenome	Rhizosphere
230	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
231	3300049587	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02	Metagenome	Rhizosphere
232	3300049588	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03	Metagenome	Rhizosphere
233	3300049589	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01	Metagenome	Rhizosphere
234	3300049590	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02	Metagenome	Rhizosphere
235	3300049591	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03	Metagenome	Rhizosphere
236	3300049593	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02	Metagenome	Rhizosphere
237	3300049677	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control	Metagenome	Rhizosphere
238	3300049686	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control	Metagenome	Rhizosphere
239	3300049741	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01	Metagenome	Rhizosphere
240	3300049742	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02	Metagenome	Rhizosphere
241	3300049743	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03	Metagenome	Rhizosphere
242	3300049744	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02	Metagenome	Rhizosphere
243	3300049760	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control	Metagenome	Rhizosphere
244	3300049765	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought	Metagenome	Rhizosphere
245	3300049822	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02	Metagenome	Rhizosphere
246	3300050507	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation	Metagenome	Rhizosphere
247	3300050510	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation	Metagenome	Rhizosphere
248	3300050511	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation	Metagenome	Rhizosphere
249	3300050512	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation	Metagenome	Rhizosphere
250	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
251	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
252	3300053116	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere	Metagenome	Endosphere
253	3300053134	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere	Metagenome	Endosphere
254	3300053158	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere	Metagenome	Endosphere
255	3300054114	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03	Metagenome	Rhizosphere
256	3300060353	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01	Metagenome	Rhizosphere
257	3300061734	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2)	Metagenome	Rhizosphere

Type Distribution

Type	Percentage (%)
Metagenomes	94.55
Metatranscriptomes	2.34
Isolates	3.12

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	8.83
Nodule	0
Rhizoplane	3.64
Rhizosphere	82.08
Stem	0
Stem Tuber	0
Unclassified	5.45

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	JGI25162J39368_1000284	3300002737	Bacteria	47815
2	JGI25164J39214_1005003	3300002772	Bacteria	1469
3	JGI25151J46595_10000759	3300003187	Bacteria	26229
4	JGI25165J46597_1000384	3300003214	Bacteria	47815
5	Ga0055538_1000149	3300003751	Bacteria	47815
6	Ga0055539_1000199	3300003752	Bacteria	47773
7	Ga0055533_1000200	3300003756	Bacteria	47815
8	Ga0055525_1000276	3300003759	Bacteria	47773
9	Ga0055526_1000006	3300003771	Bacteria	330857
10	Ga0055537_1000290	3300003773	Bacteria	35612
11	Ga0055524_1000424	3300003775	Bacteria	35484
12	Ga0055534_1000269	3300003784	Bacteria	35498
13	Ga0055528_1000003	3300003790	Bacteria	330875
14	Ga0055541_1000130	3300003841	Bacteria	47815
15	Ga0065704_10078156	3300005289	Bacteria	4513
16	Ga0065707_10169799	3300005295	Unclassified	1480
17	Ga0070658_10018975	3300005327	Bacteria	5510
18	Ga0070658_10379272	3300005327	Bacteria	1213
19	Ga0070690_100045049	3300005330	Bacteria	2801
20	Ga0070680_100135511	3300005336	Bacteria	2062
21	Ga0070669_100000032	3300005353	Bacteria	153549
22	Ga0070669_100013220	3300005353	Bacteria	5868
23	Ga0070671_100114450	3300005355	Bacteria	2267
24	Ga0070688_100073747	3300005365	Unclassified	2189
25	Ga0070709_10009895	3300005434	Bacteria	5269
26	Ga0070713_100037912	3300005436	Bacteria	3900
27	Ga0070713_100097188	3300005436	Bacteria	2544
28	Ga0070713_100159999	3300005436	Unclassified	2009
29	Ga0070713_100465238	3300005436	Bacteria	1189
30	Ga0070710_10091771	3300005437	Bacteria	1793
31	Ga0070710_10159723	3300005437	Bacteria	1397
32	Ga0070701_10031512	3300005438	Bacteria	2631
33	Ga0070711_100002559	3300005439	Bacteria	10414
34	Ga0070711_100272245	3300005439	Unclassified	1337
35	Ga0070694_100026878	3300005444	Bacteria	3734
36	Ga0070708_100043881	3300005445	Bacteria	3930
37	Ga0070681_10034011	3300005458	Bacteria	5118
38	Ga0070681_10096006	3300005458	Bacteria	2913
39	Ga0070681_10317369	3300005458	Bacteria	1468
40	Ga0070706_100004067	3300005467	Bacteria	14219
41	Ga0070706_100005319	3300005467	Bacteria	12267
42	Ga0070707_100001003	3300005468	Bacteria	27969
43	Ga0070707_100187966	3300005468	Bacteria	2014
44	Ga0070698_100013735	3300005471	Bacteria	8570
45	Ga0070699_100008951	3300005518	Bacteria	8673
46	Ga0070699_100041952	3300005518	Bacteria	3959
47	Ga0070679_100012503	3300005530	Bacteria	8115
48	Ga0070679_100041296	3300005530	Bacteria	4590
49	Ga0070679_100050054	3300005530	Bacteria	4162
50	Ga0070697_100001166	3300005536	Bacteria	19926
51	Ga0070697_100022217	3300005536	Bacteria	5035
52	Ga0068853_100187569	3300005539	Bacteria	1878
53	Ga0070695_100001409	3300005545	Bacteria	13321
54	Ga0070695_100086431	3300005545	Bacteria	2084
55	Ga0070695_100114761	3300005545	Bacteria	1834
56	Ga0070693_100000798	3300005547	Bacteria	13919
57	Ga0070693_100013169	3300005547	Bacteria	4206
58	Ga0070665_100003662	3300005548	Bacteria	16282
59	Ga0070704_100019799	3300005549	Bacteria	4330
60	Ga0070704_100032234	3300005549	Bacteria	3533
61	Ga0070704_100083041	3300005549	Bacteria	2364
62	Ga0068855_100109704	3300005563	Bacteria	3168
63	Ga0068855_100322577	3300005563	Bacteria	1707
64	Ga0068857_100121025	3300005577	Bacteria	2356
65	Ga0068856_100024458	3300005614	Bacteria	5880
66	Ga0068859_100092062	3300005617	Bacteria	3083
67	Ga0068859_100373966	3300005617	Bacteria	1520
68	Ga0068864_100070391	3300005618	Bacteria	3044
69	Ga0068864_100086673	3300005618	Unclassified	2755
70	Ga0068864_100419182	3300005618	Unclassified	1275
71	Ga0068861_100198039	3300005719	Bacteria	1684
72	Ga0068863_100085364	3300005841	Bacteria	2991
73	Ga0068863_100134660	3300005841	Bacteria	2360
74	Ga0068858_100140815	3300005842	Bacteria	2264
75	Ga0068860_100059716	3300005843	Bacteria	3625
76	Ga0068862_100048309	3300005844	Bacteria	3632
77	Ga0081455_10016631	3300005937	Bacteria	7091
78	Ga0070717_10022578	3300006028	Bacteria	4973
79	Ga0070717_10444189	3300006028	Bacteria	1168
80	Ga0070716_100035190	3300006173	Bacteria	2752
81	Ga0070716_100069795	3300006173	Bacteria	2061
82	Ga0070716_100108406	3300006173	Bacteria	1716
83	Ga0075431_100291767	3300006847	Bacteria	1650
84	Ga0075434_100058409	3300006871	Bacteria	3834
85	Ga0097620_100092060	3300006931	Bacteria	3083
86	Ga0097620_100373961	3300006931	Bacteria	1520
87	Ga0099794_10047473	3300007265	Bacteria	2059
88	Ga0105240_10050927	3300009093	Bacteria	5215
89	Ga0105240_10123953	3300009093	Bacteria	3108
90	Ga0111539_10110709	3300009094	Bacteria	3222
91	Ga0111539_10460369	3300009094	Bacteria	1481
92	Ga0105245_10005757	3300009098	Bacteria	10876
93	Ga0105245_10041262	3300009098	Bacteria	4113
94	Ga0105247_10013718	3300009101	Bacteria	4860
95	Ga0105243_10211490	3300009148	Bacteria	1708
96	Ga0105241_10054780	3300009174	Bacteria	3054
97	Ga0105242_10211288	3300009176	Bacteria	1730
98	Ga0105237_10265061	3300009545	Bacteria	1721
99	Ga0105237_10380701	3300009545	Bacteria	1416
100	Ga0105237_10473942	3300009545	Bacteria	1258
101	Ga0105238_10018983	3300009551	Bacteria	7002
102	Ga0105238_10123880	3300009551	Bacteria	2564
103	Ga0105238_10385016	3300009551	Bacteria	1394
104	Ga0105249_10065993	3300009553	Bacteria	3331
105	Ga0157370_10089056	3300013104	Bacteria	2899
106	Ga0157369_10163855	3300013105	Bacteria	2345
107	Ga0157369_10322457	3300013105	Unclassified	1606
108	Ga0157378_10018762	3300013297	Bacteria	6080
109	Ga0157372_10080868	3300013307	Bacteria	3677
110	Ga0157375_10110976	3300013308	Bacteria	2841
111	Ga0163163_10132829	3300014325	Bacteria	2529
112	Ga0157380_10502331	3300014326	Unclassified	1178
113	Ga0182008_10014874	3300014497	Bacteria	4070
114	Ga0157379_10071752	3300014968	Bacteria	3098
115	Ga0182006_1007675	3300015261	Bacteria	4926
116	Ga0182005_1000589	3300015265	Bacteria	17823
117	Ga0183360_10001	3300015689	Bacteria	3943671
118	Ga0224572_1008913	3300024225	Unclassified	1863
119	Ga0228598_1004833	3300024227	Unclassified	2844
120	Ga0209760_100885	3300025207	Bacteria	3805
121	Ga0209784_100191	3300025224	Bacteria	48497
122	Ga0209566_100252	3300025225	Bacteria	51250
123	Ga0209674_100069	3300025226	Bacteria	243948
124	Ga0209563_100167	3300025230	Bacteria	47867
125	Ga0207427_100965	3300025231	Bacteria	12203
126	Ga0209437_100091	3300025233	Bacteria	243344
127	Ga0207425_1003538	3300025245	Bacteria	4968
128	Ga0209677_100039	3300025253	Bacteria	243974
129	Ga0209233_1000115	3300025261	Bacteria	243344
130	Ga0209565_1000001	3300025263	Bacteria	2950419
131	Ga0209673_1000001	3300025273	Bacteria	3176258
132	Ga0209675_1000001	3300025291	Bacteria	2950293
133	Ga0209025_1000005	3300025294	Bacteria	1272149
134	Ga0209564_1000001	3300025295	Bacteria	3176258
135	Ga0209758_1006792	3300025297	Bacteria	8027
136	Ga0209256_1000002	3300025299	Bacteria	1906740
137	Ga0207653_10002016	3300025885	Bacteria	6481
138	Ga0207692_10058739	3300025898	Bacteria	1983
139	Ga0207710_10001462	3300025900	Bacteria	11727
140	Ga0207699_10179564	3300025906	Bacteria	1422
141	Ga0207684_10005460	3300025910	Bacteria	11719
142	Ga0207707_10139057	3300025912	Bacteria	2123
143	Ga0207707_10192376	3300025912	Bacteria	1780
144	Ga0207695_10061850	3300025913	Bacteria	3868
145	Ga0207693_10061520	3300025915	Bacteria	2941
146	Ga0207663_10019072	3300025916	Bacteria	3855
147	Ga0207660_10066960	3300025917	Bacteria	2600
148	Ga0207652_10041313	3300025921	Bacteria	3920
149	Ga0207652_10115212	3300025921	Bacteria	2387
150	Ga0207646_10000165	3300025922	Bacteria	89540
151	Ga0207681_10000052	3300025923	Bacteria	112273
152	Ga0207681_10045597	3300025923	Bacteria	2944
153	Ga0207694_10066708	3300025924	Bacteria	2808
154	Ga0207694_10226069	3300025924	Bacteria	1527
155	Ga0207687_10007447	3300025927	Bacteria	7206
156	Ga0207687_10075583	3300025927	Bacteria	2418
157	Ga0207700_10001703	3300025928	Bacteria	12488
158	Ga0207664_10212026	3300025929	Bacteria	1676
159	Ga0207644_10096878	3300025931	Bacteria	2209
160	Ga0207709_10058285	3300025935	Bacteria	2399
161	Ga0207665_10094721	3300025939	Bacteria	2074
162	Ga0207661_10081901	3300025944	Bacteria	2667
163	Ga0207661_10123504	3300025944	Bacteria	2208
164	Ga0207661_10276469	3300025944	Bacteria	1500
165	Ga0207667_10051821	3300025949	Bacteria	4325
166	Ga0207712_10002524	3300025961	Bacteria	11776
167	Ga0207678_10024889	3300026067	Bacteria	5227
168	Ga0207702_10132606	3300026078	Bacteria	2243
169	Ga0207641_10236149	3300026088	Bacteria	1701
170	Ga0207676_10037049	3300026095	Bacteria	3714
171	Ga0207676_10244631	3300026095	Bacteria	1611
172	Ga0207674_10148134	3300026116	Bacteria	2305
173	Ga0209588_1002959	3300027671	Bacteria	4669
174	Ga0265354_1000043	3300028016	Bacteria	20369
175	Ga0265356_1000837	3300028017	Bacteria	5097
176	Ga0265357_1002864	3300028023	Unclassified	1449
177	Ga0268266_10001004	3300028379	Bacteria	35571
178	Ga0268265_10028818	3300028380	Bacteria	3979
179	Ga0268264_10001062	3300028381	Bacteria	27268
180	Ga0307511_10084513	3300030521	Bacteria	2202
181	Ga0265762_1000056	3300030760	Bacteria	14075
182	Ga0265762_1002134	3300030760	Bacteria	3594
183	Ga0265762_1003422	3300030760	Bacteria	2843
184	Ga0265770_1000453	3300030878	Bacteria	5644
185	Ga0265760_10001654	3300031090	Bacteria	6546
186	Ga0265760_10002254	3300031090	Bacteria	5637
187	Ga0265760_10002779	3300031090	Bacteria	5116
188	Ga0265760_10003853	3300031090	Bacteria	4348
189	Ga0265760_10004202	3300031090	Bacteria	4142
190	Ga0265328_10009107	3300031239	Bacteria	4054
191	Ga0265320_10050685	3300031240	Bacteria	2016
192	Ga0265325_10045384	3300031241	Bacteria	2283
193	Ga0265325_10055601	3300031241	Bacteria	2023
194	Ga0265327_10000804	3300031251	Bacteria	47927
195	Ga0316576_10216530	3300031727	Bacteria	1441
196	Ga0307405_10012717	3300031731	Bacteria	4468
197	Ga0307405_10309550	3300031731	Unclassified	1202
198	Ga0307413_10018136	3300031824	Bacteria	3685
199	Ga0307518_10017939	3300031838	Bacteria	5071
200	Ga0307410_10027926	3300031852	Unclassified	3572
201	Ga0307410_10052321	3300031852	Unclassified	2757
202	Ga0307406_10002189	3300031901	Bacteria	10638
203	Ga0307406_10046254	3300031901	Bacteria	2737
204	Ga0307406_10195897	3300031901	Bacteria	1483
205	Ga0307407_10015900	3300031903	Bacteria	3733
206	Ga0307416_100045881	3300032002	Bacteria	3444
207	Ga0307416_100183375	3300032002	Unclassified	1964
208	Ga0307416_100227908	3300032002	Bacteria	1794
209	Ga0307414_10011262	3300032004	Bacteria	5236
210	Ga0307415_100010941	3300032126	Bacteria	5164
211	Ga0316212_1005751	3300033547	Bacteria	1799
212	Ga0373926_0052483	3300035083	Bacteria	1473
213	Ga0373923_0003725	3300035111	Bacteria	4939
214	Ga0373923_0111543	3300035111	Bacteria	1215
215	Ga0373943_0010999	3300035170	Bacteria	4066
216	Ga0373943_0039572	3300035170	Bacteria	2272
217	Ga0373955_0029666	3300035172	Unclassified	2847
218	Ga0373955_0076580	3300035172	Bacteria	1882
219	Ga0373955_0192158	3300035172	Unclassified	1214
220	Ga0316574_0012847	3300035398	Bacteria	4801
221	Ga0316574_0041771	3300035398	Bacteria	2828
222	Ga0373924_0000164	3300035410	Bacteria	19459
223	Ga0373931_0190303	3300035691	Bacteria	1221
224	Ga0373935_0001696	3300035692	Bacteria	12318
225	Ga0373935_0082918	3300035692	Bacteria	2086
226	Ga0373927_0023081	3300035695	Bacteria	4074
227	Ga0373933_0000301	3300035724	Bacteria	31938
228	Ga0373933_0054652	3300035724	Bacteria	2394
229	Ga0373933_0207039	3300035724	Unclassified	1256
230	Ga0373947_0015462	3300035725	Bacteria	4381
231	Ga0373947_0154417	3300035725	Unclassified	1480
232	Ga0373937_0000288	3300036401	Bacteria	48158
233	Ga0373937_0002176	3300036401	Bacteria	16407
234	Ga0373937_0118302	3300036401	Unclassified	2468
235	Ga0373937_0184720	3300036401	Bacteria	1958
236	Ga0316582_0205127	3300036647	Bacteria	1346
237	Ga0316584_0028276	3300036712	Bacteria	4133
238	Ga0316584_0129075	3300036712	Bacteria	1888
239	Ga0373925_0040553	3300037068	Bacteria	3447
240	Ga0373925_0095575	3300037068	Bacteria	2276
241	Ga0373925_0284034	3300037068	Bacteria	1333
242	Ga0373925_0313660	3300037068	Bacteria	1268
243	Ga0395905_0001109	3300037471	Bacteria	33882
244	Ga0400484_20547	3300038725	Bacteria	4674
245	Ga0400484_38006	3300038725	Unclassified	2446
246	Ga0400490_07947	3300038726	Bacteria	4173
247	Ga0400489_46528	3300039093	Bacteria	2048
248	Ga0400489_52763	3300039093	Bacteria	16946
249	Ga0436365_0859520	3300039437	Bacteria	1194
250	Ga0436363_0841347	3300039450	Bacteria	4707
251	Ga0436362_0988190	3300039453	Bacteria	1767
252	Ga0439447_003841	3300041407	Bacteria	5271
253	Ga0451577_0003577	3300042876	Bacteria	17119
254	Ga0451577_0004024	3300042876	Bacteria	15808
255	Ga0451577_0006242	3300042876	Bacteria	11953
256	Ga0451577_0011061	3300042876	Bacteria	8570
257	Ga0451577_0083808	3300042876	Bacteria	2844
258	Ga0453683_0001494	3300044673	Bacteria	20028
259	Ga0453683_0003399	3300044673	Bacteria	11750
260	Ga0453683_0070897	3300044673	Bacteria	2180
261	Ga0453683_0118992	3300044673	Bacteria	1662
262	Ga0466963_0017413	3300044694	Bacteria	4480
263	Ga0453684_0003074	3300044712	Bacteria	38627
264	Ga0453684_0006038	3300044712	Bacteria	23425
265	Ga0453684_0006601	3300044712	Bacteria	21945
266	Ga0453684_0088464	3300044712	Bacteria	3835
267	Ga0453684_0176054	3300044712	Bacteria	2516
268	Ga0466957_0000141	3300044842	Bacteria	30925
269	Ga0451576_0041841	3300045051	Bacteria	4841
270	Ga0451576_0050861	3300045051	Bacteria	4345
271	Ga0451576_0130277	3300045051	Bacteria	2622
272	Ga0466958_0112030	3300045836	Bacteria	1704
273	Ga0466967_0060402	3300045976	Bacteria	3358
274	Ga0466967_0170393	3300045976	Bacteria	2048
275	Ga0495651_0011284	3300046462	Bacteria	6868
276	Ga0495653_0157503	3300046463	Unclassified	1580
277	Ga0495580_0065472	3300046472	Bacteria	2545
278	Ga0495580_0087669	3300046472	Bacteria	2168
279	Ga0495584_0163571	3300046491	Bacteria	1131
280	Ga0495608_0016255	3300046511	Bacteria	5147
281	Ga0495608_0121729	3300046511	Unclassified	1673
282	Ga0495628_0000554	3300046516	Bacteria	34331
283	Ga0495630_0052702	3300046517	Bacteria	3046
284	Ga0495652_0005051	3300046529	Bacteria	12489
285	Ga0495652_0005628	3300046529	Bacteria	11737
286	Ga0495652_0023066	3300046529	Bacteria	5518
287	Ga0495665_0036387	3300046531	Bacteria	2628
288	Ga0495587_0000157	3300046536	Bacteria	50388
289	Ga0495645_0017273	3300046543	Bacteria	5168
290	Ga0495623_0004368	3300046679	Bacteria	9302
291	Ga0495623_0026200	3300046679	Bacteria	3754
292	Ga0495646_0005191	3300046680	Bacteria	8215
293	Ga0495624_0032408	3300046690	Bacteria	3389
294	Ga0495660_0023997	3300046810	Bacteria	3476
295	Ga0495604_0030764	3300047317	Bacteria	4261
296	Ga0495604_0037473	3300047317	Bacteria	3818
297	Ga0495675_0000271	3300047444	Bacteria	37489
298	Ga0495675_0234978	3300047444	Bacteria	1105
299	Ga0495602_0000436	3300048088	Bacteria	39209
300	Ga0495602_0059540	3300048088	Bacteria	3333
301	Ga0495626_0002904	3300048091	Bacteria	11412
302	Ga0496102_0020162	3300048905	Bacteria	5887
303	Ga0496104_0043327	3300048907	Bacteria	4227
304	Ga0496104_0100329	3300048907	Bacteria	2771
305	Ga0496105_0004120	3300048908	Bacteria	10897
306	Ga0496109_0008727	3300048912	Bacteria	8630
307	Ga0496109_0069596	3300048912	Bacteria	3228
308	Ga0496110_0094580	3300048913	Unclassified	2676
309	Ga0496111_0003148	3300048914	Bacteria	10155
310	Ga0496112_0005604	3300048915	Bacteria	10891
311	Ga0496112_0015432	3300048915	Bacteria	7131
312	Ga0496112_0036760	3300048915	Bacteria	4778
313	Ga0496112_0049184	3300048915	Bacteria	4133
314	Ga0496112_0053168	3300048915	Bacteria	3977
315	Ga0496115_0153342	3300048918	Bacteria	1903
316	Ga0496121_0023588	3300048924	Bacteria	5916
317	Ga0501034_0020100	3300049571	Bacteria	6818
318	Ga0501034_0121261	3300049571	Bacteria	2601
319	Ga0501034_0164463	3300049571	Bacteria	2188
320	Ga0501043_0283743	3300049579	Bacteria	1269
321	Ga0501047_0024745	3300049581	Bacteria	5764
322	Ga0501047_0100344	3300049581	Bacteria	2774
323	Ga0501047_0131151	3300049581	Bacteria	2387
324	Ga0501047_0285007	3300049581	Bacteria	1496
325	Ga0501067_0000793	3300049583	Bacteria	17033
326	Ga0501067_0076115	3300049583	Bacteria	1859
327	Ga0501068_0129856	3300049584	Bacteria	1575
328	Ga0501070_0001376	3300049586	Bacteria	21740
329	Ga0501071_0015647	3300049587	Bacteria	5208
330	Ga0501072_0009028	3300049588	Bacteria	7578
331	Ga0501073_0004710	3300049589	Bacteria	10246
332	Ga0501074_0003077	3300049590	Bacteria	11771
333	Ga0501074_0003084	3300049590	Bacteria	11749
334	Ga0501075_0002787	3300049591	Bacteria	11703
335	Ga0501077_0015310	3300049593	Bacteria	4828
336	Ga0501077_0023633	3300049593	Bacteria	3897
337	Ga0501247_001686	3300049677	Unclassified	2191
338	Ga0501257_001235	3300049686	Bacteria	5245
339	Ga0501079_0006289	3300049741	Bacteria	8906
340	Ga0501079_0028704	3300049741	Bacteria	4270
341	Ga0501079_0108691	3300049741	Bacteria	2153
342	Ga0501080_0001323	3300049742	Bacteria	20645
343	Ga0501080_0008293	3300049742	Bacteria	9412
344	Ga0501081_0009217	3300049743	Bacteria	6428
345	Ga0501081_0049891	3300049743	Bacteria	2883
346	Ga0501083_0006072	3300049744	Bacteria	8559
347	Ga0501083_0010806	3300049744	Bacteria	6420
348	Ga0501083_0018470	3300049744	Bacteria	4859
349	Ga0501083_0028041	3300049744	Bacteria	3882
350	Ga0501263_002242	3300049760	Unclassified	1946
351	Ga0501268_016306	3300049765	Unclassified	1229
352	Ga0501035_0149997	3300049822	Bacteria	2024
353	nmdc:mga05p37_142166_c2	3300050507	Bacteria	2605
354	nmdc:mga06r32_165128_c1	3300050510	Unclassified	2197
355	nmdc:mga08y16_106509_c1	3300050511	Bacteria	2918
356	nmdc:mga08y16_136007_c1	3300050511	Bacteria	2554
357	nmdc:mga08y16_73869_c1	3300050511	Bacteria	3553
358	nmdc:mga0n895_70464_c1	3300050512	Bacteria	3465
359	nmdc:mga0rr50_124726_c1	3300050513	Bacteria	2054
360	Ga0495601_0045866	3300053077	Unclassified	2750
361	Ga0495601_0047422	3300053077	Bacteria	2705
362	Ga0500592_000004	3300053116	Bacteria	128088
363	Ga0500658_0048829	3300053134	Bacteria	1722
364	Ga0500627_0000016	3300053158	Bacteria	125231
365	Ga0501084_0004647	3300054114	Bacteria	11210
366	Ga0501084_0025021	3300054114	Bacteria	4982
367	Ga0501084_0030057	3300054114	Bacteria	4544
368	Ga0501084_0149199	3300054114	Unclassified	1970
369	Ga0501082_0001365	3300060353	Bacteria	21464
370	Ga0501082_0006663	3300060353	Bacteria	9993
371	Ga0501082_0097007	3300060353	Bacteria	2548
372	Ga0501082_0242642	3300060353	Bacteria	1568
373	Ga0530510_0008815	3300061734	Bacteria	7059

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300049686	Ga0501257_001235	Ga0501257_001235_794_1669	279
2	3300049760	Ga0501263_002242	Ga0501263_002242_681_1556	279
3	3300047444	Ga0495675_0234978	Ga0495675_0234978_199_1089	294
4	3300005518	Ga0070699_100041952	Ga0070699_1000419523	324
5	3300005536	Ga0070697_100022217	Ga0070697_1000222173	324
6	3300050513	nmdc:mga0rr50_124726_c1	nmdc:mga0rr50_124726_c1_253_1305	324
7	3300031903	Ga0307407_10015900	Ga0307407_100159002	325
8	3300050511	nmdc:mga08y16_136007_c1	nmdc:mga08y16_136007_c1_1544_2524	326
9	3300042876	Ga0451577_0083808	Ga0451577_0083808_43_1056	333
10	3300005618	Ga0068864_100419182	Ga0068864_1004191821	334
11	3300050511	nmdc:mga08y16_106509_c1	nmdc:mga08y16_106509_c1_18_1034	338
12	3300053116	Ga0500592_000004	Ga0500592_000004_21875_22945	339
13	3300053134	Ga0500658_0048829	Ga0500658_0048829_425_1495	339
14	3300053158	Ga0500627_0000016	Ga0500627_0000016_44715_45785	339
15	3300044712	Ga0453684_0088464	Ga0453684_0088464_1529_2641	341
16	3300044673	Ga0453683_0070897	Ga0453683_0070897_946_2061	342
17	3300045051	Ga0451576_0050861	Ga0451576_0050861_940_2055	342
18	3300009094	Ga0111539_10110709	Ga0111539_101107094	344
19	3300005327	Ga0070658_10379272	Ga0070658_103792721	345
20	3300005336	Ga0070680_100135511	Ga0070680_1001355111	345
21	3300005458	Ga0070681_10034011	Ga0070681_100340114	345
22	3300005458	Ga0070681_10317369	Ga0070681_103173692	345
23	3300005530	Ga0070679_100012503	Ga0070679_1000125034	345
24	3300005530	Ga0070679_100041296	Ga0070679_1000412963	345
25	3300005563	Ga0068855_100322577	Ga0068855_1003225772	345
26	3300005577	Ga0068857_100121025	Ga0068857_1001210252	345
27	3300009094	Ga0111539_10460369	Ga0111539_104603692	345
28	3300013307	Ga0157372_10080868	Ga0157372_100808683	345
29	3300014325	Ga0163163_10132829	Ga0163163_101328292	345
30	3300025917	Ga0207660_10066960	Ga0207660_100669602	345
31	3300025921	Ga0207652_10115212	Ga0207652_101152122	345
32	3300025944	Ga0207661_10081901	Ga0207661_100819012	345
33	3300026116	Ga0207674_10148134	Ga0207674_101481342	345
34	3300035111	Ga0373923_0111543	Ga0373923_0111543_14_1054	345
35	3300035170	Ga0373943_0039572	Ga0373943_0039572_622_1662	345
36	3300035172	Ga0373955_0076580	Ga0373955_0076580_527_1567	345
37	3300048088	Ga0495602_0059540	Ga0495602_0059540_403_1479	345
38	3300048915	Ga0496112_0036760	Ga0496112_0036760_2746_3795	345
39	iso_pu_bacteria	2915768154	2915774859	345
40	3300005444	Ga0070694_100026878	Ga0070694_1000268781	346
41	3300005545	Ga0070695_100114761	Ga0070695_1001147611	346
42	3300005549	Ga0070704_100083041	Ga0070704_1000830412	346
43	3300035691	Ga0373931_0190303	Ga0373931_0190303_47_1156	346
44	3300039437	Ga0436365_0859520	Ga0436365_0859520_93_1163	346
45	3300039453	Ga0436362_0988190	Ga0436362_0988190_297_1367	346
46	3300049579	Ga0501043_0283743	Ga0501043_0283743_150_1256	346
47	3300049581	Ga0501047_0024745	Ga0501047_0024745_1902_3008	346
48	iso_pu_bacteria	2585427649	2586063443	346
49	iso_pu_bacteria	2808606522	2809587400	346
50	3300049581	Ga0501047_0285007	Ga0501047_0285007_267_1343	348
51	3300049583	Ga0501067_0076115	Ga0501067_0076115_538_1614	348
52	3300049584	Ga0501068_0129856	Ga0501068_0129856_104_1219	348
53	3300049590	Ga0501074_0003077	Ga0501074_0003077_8355_9431	348
54	3300049593	Ga0501077_0015310	Ga0501077_0015310_2761_3837	348
55	3300049741	Ga0501079_0006289	Ga0501079_0006289_4576_5691	348
56	3300049742	Ga0501080_0008293	Ga0501080_0008293_7164_8240	348
57	3300049744	Ga0501083_0010806	Ga0501083_0010806_2234_3310	348
58	3300054114	Ga0501084_0025021	Ga0501084_0025021_3412_4527	348
59	3300060353	Ga0501082_0097007	Ga0501082_0097007_389_1465	348
60	iso_pu_bacteria	2936361878	2936366950	348
61	iso_pu_bacteria	2977254563	2977257144	348
62	iso_pu_bacteria	2990275345	2990278039	348
63	3300005438	Ga0070701_10031512	Ga0070701_100315121	349
64	3300005545	Ga0070695_100086431	Ga0070695_1000864312	349
65	3300005549	Ga0070704_100019799	Ga0070704_1000197992	349
66	3300005617	Ga0068859_100092062	Ga0068859_1000920622	349
67	3300005618	Ga0068864_100070391	Ga0068864_1000703913	349
68	3300005841	Ga0068863_100134660	Ga0068863_1001346603	349
69	3300005842	Ga0068858_100140815	Ga0068858_1001408152	349
70	3300005843	Ga0068860_100059716	Ga0068860_1000597162	349
71	3300005844	Ga0068862_100048309	Ga0068862_1000483093	349
72	3300006931	Ga0097620_100092060	Ga0097620_1000920603	349
73	3300009101	Ga0105247_10013718	Ga0105247_100137183	349
74	3300009174	Ga0105241_10054780	Ga0105241_100547802	349
75	3300009545	Ga0105237_10380701	Ga0105237_103807012	349
76	3300014968	Ga0157379_10071752	Ga0157379_100717523	349
77	3300025900	Ga0207710_10001462	Ga0207710_100014622	349
78	3300025961	Ga0207712_10002524	Ga0207712_100025243	349
79	3300026095	Ga0207676_10037049	Ga0207676_100370493	349
80	3300028380	Ga0268265_10028818	Ga0268265_100288183	349
81	3300028381	Ga0268264_10001062	Ga0268264_1000106216	349
82	3300031838	Ga0307518_10017939	Ga0307518_100179393	349
83	3300036712	Ga0316584_0129075	Ga0316584_0129075_131_1186	349
84	3300045051	Ga0451576_0130277	Ga0451576_0130277_1391_2443	349
85	3300049571	Ga0501034_0020100	Ga0501034_0020100_4023_5105	349
86	3300049581	Ga0501047_0131151	Ga0501047_0131151_919_2001	349
87	3300049583	Ga0501067_0000793	Ga0501067_0000793_7353_8435	349
88	3300049586	Ga0501070_0001376	Ga0501070_0001376_12533_13615	349
89	3300049587	Ga0501071_0015647	Ga0501071_0015647_3451_4533	349
90	3300049589	Ga0501073_0004710	Ga0501073_0004710_2015_3097	349
91	3300049590	Ga0501074_0003084	Ga0501074_0003084_2443_3525	349
92	3300049593	Ga0501077_0023633	Ga0501077_0023633_1301_2383	349
93	3300049741	Ga0501079_0108691	Ga0501079_0108691_48_1130	349
94	3300049742	Ga0501080_0001323	Ga0501080_0001323_11447_12529	349
95	3300049744	Ga0501083_0028041	Ga0501083_0028041_752_1834	349
96	3300049822	Ga0501035_0149997	Ga0501035_0149997_93_1175	349
97	3300060353	Ga0501082_0006663	Ga0501082_0006663_3480_4562	349
98	iso_pu_bacteria	2885270888	2885277559	349
99	3300005719	Ga0068861_100198039	Ga0068861_1001980392	350
100	3300025944	Ga0207661_10276469	Ga0207661_102764692	350
101	3300031731	Ga0307405_10012717	Ga0307405_100127171	350
102	3300031852	Ga0307410_10052321	Ga0307410_100523212	350
103	3300031901	Ga0307406_10046254	Ga0307406_100462542	350
104	3300032002	Ga0307416_100183375	Ga0307416_1001833752	350
105	3300032004	Ga0307414_10011262	Ga0307414_100112623	350
106	3300032126	Ga0307415_100010941	Ga0307415_1000109412	350
107	3300035725	Ga0373947_0154417	Ga0373947_0154417_10_1083	350
108	3300039450	Ga0436363_0841347	Ga0436363_0841347_1837_2889	350
109	3300042876	Ga0451577_0004024	Ga0451577_0004024_7478_8536	350
110	3300045976	Ga0466967_0060402	Ga0466967_0060402_2081_3157	350
111	3300048915	Ga0496112_0015432	Ga0496112_0015432_4379_5446	350
112	3300049677	Ga0501247_001686	Ga0501247_001686_918_2006	350
113	3300049765	Ga0501268_016306	Ga0501268_016306_103_1191	350
114	3300054114	Ga0501084_0030057	Ga0501084_0030057_2703_3767	350
115	3300054114	Ga0501084_0149199	Ga0501084_0149199_859_1911	350
116	3300005353	Ga0070669_100000032	Ga0070669_10000003221	351
117	3300005355	Ga0070671_100114450	Ga0070671_1001144503	351
118	3300005365	Ga0070688_100073747	Ga0070688_1000737472	351
119	3300005458	Ga0070681_10096006	Ga0070681_100960063	351
120	3300005530	Ga0070679_100050054	Ga0070679_1000500542	351
121	3300005617	Ga0068859_100373966	Ga0068859_1003739662	351
122	3300005618	Ga0068864_100086673	Ga0068864_1000866733	351
123	3300005841	Ga0068863_100085364	Ga0068863_1000853643	351
124	3300006931	Ga0097620_100373961	Ga0097620_1003739612	351
125	3300009176	Ga0105242_10211288	Ga0105242_102112882	351
126	3300009545	Ga0105237_10265061	Ga0105237_102650612	351
127	3300013104	Ga0157370_10089056	Ga0157370_100890564	351
128	3300013105	Ga0157369_10322457	Ga0157369_103224572	351
129	3300014326	Ga0157380_10502331	Ga0157380_105023311	351
130	3300025912	Ga0207707_10139057	Ga0207707_101390572	351
131	3300025921	Ga0207652_10041313	Ga0207652_100413134	351
132	3300025923	Ga0207681_10000052	Ga0207681_1000005277	351
133	3300025931	Ga0207644_10096878	Ga0207644_100968783	351
134	3300026067	Ga0207678_10024889	Ga0207678_100248892	351
135	3300026088	Ga0207641_10236149	Ga0207641_102361492	351
136	3300026095	Ga0207676_10244631	Ga0207676_102446312	351
137	3300031731	Ga0307405_10309550	Ga0307405_103095501	351
138	3300031901	Ga0307406_10195897	Ga0307406_101958971	351
139	3300032002	Ga0307416_100227908	Ga0307416_1002279082	351
140	3300035398	Ga0316574_0012847	Ga0316574_0012847_2753_3823	351
141	3300035398	Ga0316574_0041771	Ga0316574_0041771_580_1650	351
142	3300044694	Ga0466963_0017413	Ga0466963_0017413_1890_2966	351
143	3300046810	Ga0495660_0023997	Ga0495660_0023997_2014_3174	351
144	3300048915	Ga0496112_0049184	Ga0496112_0049184_764_1831	351
145	3300049588	Ga0501072_0009028	Ga0501072_0009028_4103_5161	351
146	3300049591	Ga0501075_0002787	Ga0501075_0002787_1480_2538	351
147	3300049741	Ga0501079_0028704	Ga0501079_0028704_1830_2888	351
148	3300049743	Ga0501081_0009217	Ga0501081_0009217_3691_4749	351
149	3300049743	Ga0501081_0049891	Ga0501081_0049891_551_1609	351
150	3300060353	Ga0501082_0001365	Ga0501082_0001365_13624_14682	351
151	3300061734	Ga0530510_0008815	Ga0530510_0008815_4798_5856	351
152	iso_pu_bacteria	2643221593	2643976936	351
153	iso_pu_bacteria	2881714928	2881715016	351
154	iso_pu_bacteria	2941489479	2941490172	351
155	iso_pu_bacteria	2995948881	2995951893	351
156	3300005289	Ga0065704_10078156	Ga0065704_100781562	352
157	3300005295	Ga0065707_10169799	Ga0065707_101697991	352
158	3300005437	Ga0070710_10091771	Ga0070710_100917712	352
159	3300005937	Ga0081455_10016631	Ga0081455_100166315	352
160	3300009148	Ga0105243_10211490	Ga0105243_102114902	352
161	3300009553	Ga0105249_10065993	Ga0105249_100659932	352
162	3300013308	Ga0157375_10110976	Ga0157375_101109764	352
163	3300025898	Ga0207692_10058739	Ga0207692_100587392	352
164	3300025935	Ga0207709_10058285	Ga0207709_100582852	352
165	3300030521	Ga0307511_10084513	Ga0307511_100845131	352
166	3300031090	Ga0265760_10001654	Ga0265760_100016543	352
167	3300044712	Ga0453684_0176054	Ga0453684_0176054_38_1111	352
168	3300005436	Ga0070713_100097188	Ga0070713_1000971881	353
169	3300005436	Ga0070713_100159999	Ga0070713_1001599991	353
170	3300005436	Ga0070713_100465238	Ga0070713_1004652381	353
171	3300005437	Ga0070710_10159723	Ga0070710_101597231	353
172	3300005439	Ga0070711_100002559	Ga0070711_1000025596	353
173	3300005439	Ga0070711_100272245	Ga0070711_1002722451	353
174	3300005539	Ga0068853_100187569	Ga0068853_1001875692	353
175	3300005547	Ga0070693_100013169	Ga0070693_1000131694	353
176	3300005563	Ga0068855_100109704	Ga0068855_1001097044	353
177	3300005614	Ga0068856_100024458	Ga0068856_1000244586	353
178	3300006028	Ga0070717_10022578	Ga0070717_100225783	353
179	3300006028	Ga0070717_10444189	Ga0070717_104441891	353
180	3300006173	Ga0070716_100035190	Ga0070716_1000351903	353
181	3300006173	Ga0070716_100069795	Ga0070716_1000697951	353
182	3300006173	Ga0070716_100108406	Ga0070716_1001084062	353
183	3300006871	Ga0075434_100058409	Ga0075434_1000584092	353
184	3300009093	Ga0105240_10123953	Ga0105240_101239533	353
185	3300009098	Ga0105245_10005757	Ga0105245_100057576	353
186	3300009098	Ga0105245_10041262	Ga0105245_100412622	353
187	3300009545	Ga0105237_10473942	Ga0105237_104739422	353
188	3300009551	Ga0105238_10018983	Ga0105238_100189834	353
189	3300009551	Ga0105238_10123880	Ga0105238_101238802	353
190	3300009551	Ga0105238_10385016	Ga0105238_103850161	353
191	3300013105	Ga0157369_10163855	Ga0157369_101638553	353
192	3300013297	Ga0157378_10018762	Ga0157378_100187624	353
193	3300024225	Ga0224572_1008913	Ga0224572_10089131	353
194	3300024227	Ga0228598_1004833	Ga0228598_10048332	353
195	3300025912	Ga0207707_10192376	Ga0207707_101923762	353
196	3300025915	Ga0207693_10061520	Ga0207693_100615202	353
197	3300025916	Ga0207663_10019072	Ga0207663_100190722	353
198	3300025924	Ga0207694_10066708	Ga0207694_100667082	353
199	3300025924	Ga0207694_10226069	Ga0207694_102260692	353
200	3300025927	Ga0207687_10007447	Ga0207687_100074476	353
201	3300025927	Ga0207687_10075583	Ga0207687_100755832	353
202	3300025928	Ga0207700_10001703	Ga0207700_100017039	353
203	3300025929	Ga0207664_10212026	Ga0207664_102120261	353
204	3300025939	Ga0207665_10094721	Ga0207665_100947212	353
205	3300025944	Ga0207661_10123504	Ga0207661_101235041	353
206	3300025949	Ga0207667_10051821	Ga0207667_100518214	353
207	3300026078	Ga0207702_10132606	Ga0207702_101326062	353
208	3300028017	Ga0265356_1000837	Ga0265356_10008373	353
209	3300030760	Ga0265762_1000056	Ga0265762_10000569	353
210	3300030760	Ga0265762_1002134	Ga0265762_10021343	353
211	3300030760	Ga0265762_1003422	Ga0265762_10034223	353
212	3300031090	Ga0265760_10004202	Ga0265760_100042023	353
213	3300031240	Ga0265320_10050685	Ga0265320_100506852	353
214	3300031824	Ga0307413_10018136	Ga0307413_100181362	353
215	3300031852	Ga0307410_10027926	Ga0307410_100279261	353
216	3300032002	Ga0307416_100045881	Ga0307416_1000458812	353
217	3300035083	Ga0373926_0052483	Ga0373926_0052483_194_1291	353
218	3300035111	Ga0373923_0003725	Ga0373923_0003725_999_2096	353
219	3300035170	Ga0373943_0010999	Ga0373943_0010999_1091_2278	353
220	3300035172	Ga0373955_0029666	Ga0373955_0029666_1224_2321	353
221	3300035410	Ga0373924_0000164	Ga0373924_0000164_4792_5976	353
222	3300035692	Ga0373935_0001696	Ga0373935_0001696_8656_9753	353
223	3300035692	Ga0373935_0082918	Ga0373935_0082918_228_1415	353
224	3300035695	Ga0373927_0023081	Ga0373927_0023081_335_1522	353
225	3300035724	Ga0373933_0054652	Ga0373933_0054652_431_1528	353
226	3300035724	Ga0373933_0207039	Ga0373933_0207039_101_1198	353
227	3300035725	Ga0373947_0015462	Ga0373947_0015462_1712_2899	353
228	3300036401	Ga0373937_0002176	Ga0373937_0002176_13639_14766	353
229	3300036401	Ga0373937_0118302	Ga0373937_0118302_874_1971	353
230	3300036401	Ga0373937_0184720	Ga0373937_0184720_791_1858	353
231	3300037068	Ga0373925_0040553	Ga0373925_0040553_140_1237	353
232	3300037068	Ga0373925_0095575	Ga0373925_0095575_919_2106	353
233	3300037068	Ga0373925_0284034	Ga0373925_0284034_130_1314	353
234	3300038725	Ga0400484_20547	Ga0400484_20547_3462_4526	353
235	3300038726	Ga0400490_07947	Ga0400490_07947_2907_3971	353
236	3300042876	Ga0451577_0003577	Ga0451577_0003577_10432_11493	353
237	3300044712	Ga0453684_0006601	Ga0453684_0006601_9315_10376	353
238	3300044842	Ga0466957_0000141	Ga0466957_0000141_8410_9507	353
239	3300045051	Ga0451576_0041841	Ga0451576_0041841_1837_2898	353
240	3300045836	Ga0466958_0112030	Ga0466958_0112030_584_1681	353
241	3300045976	Ga0466967_0170393	Ga0466967_0170393_755_1840	353
242	3300046472	Ga0495580_0065472	Ga0495580_0065472_589_1776	353
243	3300046491	Ga0495584_0163571	Ga0495584_0163571_30_1100	353
244	3300046517	Ga0495630_0052702	Ga0495630_0052702_1484_2581	353
245	3300046531	Ga0495665_0036387	Ga0495665_0036387_627_1724	353
246	3300047317	Ga0495604_0037473	Ga0495604_0037473_1067_2164	353
247	3300048091	Ga0495626_0002904	Ga0495626_0002904_6570_7640	353
248	3300048905	Ga0496102_0020162	Ga0496102_0020162_3115_4212	353
249	3300048907	Ga0496104_0043327	Ga0496104_0043327_2544_3641	353
250	3300048907	Ga0496104_0100329	Ga0496104_0100329_1343_2440	353
251	3300048908	Ga0496105_0004120	Ga0496105_0004120_5862_6959	353
252	3300048912	Ga0496109_0008727	Ga0496109_0008727_1698_2777	353
253	3300048913	Ga0496110_0094580	Ga0496110_0094580_876_1973	353
254	3300048914	Ga0496111_0003148	Ga0496111_0003148_5545_6642	353
255	3300048915	Ga0496112_0005604	Ga0496112_0005604_9490_10587	353
256	3300048915	Ga0496112_0053168	Ga0496112_0053168_979_2127	353
257	3300049571	Ga0501034_0164463	Ga0501034_0164463_871_1935	353
258	3300049581	Ga0501047_0100344	Ga0501047_0100344_279_1346	353
259	3300049744	Ga0501083_0018470	Ga0501083_0018470_1183_2250	353
260	3300050512	nmdc:mga0n895_70464_c1	nmdc:mga0n895_70464_c1_1203_2300	353
261	3300053077	Ga0495601_0045866	Ga0495601_0045866_1319_2416	353
262	3300054114	Ga0501084_0004647	Ga0501084_0004647_8550_9617	353
263	3300060353	Ga0501082_0242642	Ga0501082_0242642_448_1515	353
264	3300003187	JGI25151J46595_10000759	JGI25151J46595_1000075919	354
265	3300003771	Ga0055526_1000006	Ga0055526_1000006246	354
266	3300003773	Ga0055537_1000290	Ga0055537_100029013	354
267	3300003775	Ga0055524_1000424	Ga0055524_100042413	354
268	3300003784	Ga0055534_1000269	Ga0055534_100026913	354
269	3300003790	Ga0055528_1000003	Ga0055528_100000313	354
270	3300005327	Ga0070658_10018975	Ga0070658_100189752	354
271	3300005353	Ga0070669_100013220	Ga0070669_1000132202	354
272	3300005434	Ga0070709_10009895	Ga0070709_100098952	354
273	3300005436	Ga0070713_100037912	Ga0070713_1000379121	354
274	3300005445	Ga0070708_100043881	Ga0070708_1000438813	354
275	3300005467	Ga0070706_100004067	Ga0070706_1000040677	354
276	3300005467	Ga0070706_100005319	Ga0070706_1000053199	354
277	3300005468	Ga0070707_100001003	Ga0070707_10000100310	354
278	3300005468	Ga0070707_100187966	Ga0070707_1001879661	354
279	3300005471	Ga0070698_100013735	Ga0070698_1000137357	354
280	3300005518	Ga0070699_100008951	Ga0070699_1000089513	354
281	3300005536	Ga0070697_100001166	Ga0070697_1000011667	354
282	3300005545	Ga0070695_100001409	Ga0070695_1000014095	354
283	3300005547	Ga0070693_100000798	Ga0070693_10000079812	354
284	3300005548	Ga0070665_100003662	Ga0070665_1000036626	354
285	3300005549	Ga0070704_100032234	Ga0070704_1000322343	354
286	3300006847	Ga0075431_100291767	Ga0075431_1002917672	354
287	3300007265	Ga0099794_10047473	Ga0099794_100474732	354
288	3300009093	Ga0105240_10050927	Ga0105240_100509276	354
289	3300014497	Ga0182008_10014874	Ga0182008_100148743	354
290	3300015689	Ga0183360_10001	Ga0183360_100011365	354
291	3300025245	Ga0207425_1003538	Ga0207425_10035384	354
292	3300025263	Ga0209565_1000001	Ga0209565_10000012410	354
293	3300025273	Ga0209673_1000001	Ga0209673_10000012410	354
294	3300025291	Ga0209675_1000001	Ga0209675_1000001120	354
295	3300025294	Ga0209025_1000005	Ga0209025_1000005881	354
296	3300025295	Ga0209564_1000001	Ga0209564_1000001282	354
297	3300025297	Ga0209758_1006792	Ga0209758_10067925	354
298	3300025299	Ga0209256_1000002	Ga0209256_10000021268	354
299	3300025885	Ga0207653_10002016	Ga0207653_100020163	354
300	3300025906	Ga0207699_10179564	Ga0207699_101795641	354
301	3300025910	Ga0207684_10005460	Ga0207684_100054608	354
302	3300025913	Ga0207695_10061850	Ga0207695_100618501	354
303	3300025922	Ga0207646_10000165	Ga0207646_1000016547	354
304	3300025923	Ga0207681_10045597	Ga0207681_100455973	354
305	3300027671	Ga0209588_1002959	Ga0209588_10029594	354
306	3300028016	Ga0265354_1000043	Ga0265354_100004313	354
307	3300028023	Ga0265357_1002864	Ga0265357_10028642	354
308	3300028379	Ga0268266_10001004	Ga0268266_1000100426	354
309	3300030878	Ga0265770_1000453	Ga0265770_10004534	354
310	3300031090	Ga0265760_10002254	Ga0265760_100022543	354
311	3300031090	Ga0265760_10002779	Ga0265760_100027792	354
312	3300031090	Ga0265760_10003853	Ga0265760_100038533	354
313	3300031239	Ga0265328_10009107	Ga0265328_100091073	354
314	3300031241	Ga0265325_10045384	Ga0265325_100453842	354
315	3300031241	Ga0265325_10055601	Ga0265325_100556012	354
316	3300031251	Ga0265327_10000804	Ga0265327_1000080431	354
317	3300031727	Ga0316576_10216530	Ga0316576_102165301	354
318	3300031901	Ga0307406_10002189	Ga0307406_100021894	354
319	3300033547	Ga0316212_1005751	Ga0316212_10057512	354
320	3300035172	Ga0373955_0192158	Ga0373955_0192158_92_1159	354
321	3300035724	Ga0373933_0000301	Ga0373933_0000301_6944_8011	354
322	3300036401	Ga0373937_0000288	Ga0373937_0000288_6923_7990	354
323	3300036647	Ga0316582_0205127	Ga0316582_0205127_136_1203	354
324	3300036712	Ga0316584_0028276	Ga0316584_0028276_1096_2163	354
325	3300037068	Ga0373925_0313660	Ga0373925_0313660_167_1234	354
326	3300037471	Ga0395905_0001109	Ga0395905_0001109_16093_17193	354
327	3300038725	Ga0400484_38006	Ga0400484_38006_400_1467	354
328	3300039093	Ga0400489_46528	Ga0400489_46528_782_1849	354
329	3300039093	Ga0400489_52763	Ga0400489_52763_9116_10183	354
330	3300041407	Ga0439447_003841	Ga0439447_003841_1353_2438	354
331	3300042876	Ga0451577_0006242	Ga0451577_0006242_7426_8493	354
332	3300042876	Ga0451577_0011061	Ga0451577_0011061_4617_5684	354
333	3300044673	Ga0453683_0001494	Ga0453683_0001494_12852_13934	354
334	3300044673	Ga0453683_0003399	Ga0453683_0003399_3400_4467	354
335	3300044673	Ga0453683_0118992	Ga0453683_0118992_528_1595	354
336	3300044712	Ga0453684_0003074	Ga0453684_0003074_34506_35573	354
337	3300044712	Ga0453684_0006038	Ga0453684_0006038_3343_4410	354
338	3300046463	Ga0495653_0157503	Ga0495653_0157503_116_1183	354
339	3300046472	Ga0495580_0087669	Ga0495580_0087669_123_1190	354
340	3300046511	Ga0495608_0121729	Ga0495608_0121729_275_1342	354
341	3300046529	Ga0495652_0005051	Ga0495652_0005051_1233_2300	354
342	3300046536	Ga0495587_0000157	Ga0495587_0000157_41838_42905	354
343	3300046679	Ga0495623_0004368	Ga0495623_0004368_1775_2842	354
344	3300047317	Ga0495604_0030764	Ga0495604_0030764_1883_2950	354
345	3300047444	Ga0495675_0000271	Ga0495675_0000271_16088_17155	354
346	3300048088	Ga0495602_0000436	Ga0495602_0000436_30653_31720	354
347	3300048912	Ga0496109_0069596	Ga0496109_0069596_402_1499	354
348	3300048918	Ga0496115_0153342	Ga0496115_0153342_316_1383	354
349	3300048924	Ga0496121_0023588	Ga0496121_0023588_3205_4278	354
350	3300049571	Ga0501034_0121261	Ga0501034_0121261_1041_2120	354
351	3300049744	Ga0501083_0006072	Ga0501083_0006072_1124_2212	354
352	3300050507	nmdc:mga05p37_142166_c2	nmdc:mga05p37_142166_c2_727_1800	354
353	3300050510	nmdc:mga06r32_165128_c1	nmdc:mga06r32_165128_c1_378_1457	354
354	3300050511	nmdc:mga08y16_73869_c1	nmdc:mga08y16_73869_c1_216_1301	354
355	3300005330	Ga0070690_100045049	Ga0070690_1000450492	355
356	3300046462	Ga0495651_0011284	Ga0495651_0011284_494_1561	355
357	3300046511	Ga0495608_0016255	Ga0495608_0016255_2212_3279	355
358	3300046516	Ga0495628_0000554	Ga0495628_0000554_5667_6734	355
359	3300046529	Ga0495652_0005628	Ga0495652_0005628_453_1520	355
360	3300046529	Ga0495652_0023066	Ga0495652_0023066_728_1795	355
361	3300046543	Ga0495645_0017273	Ga0495645_0017273_3615_4682	355
362	3300046679	Ga0495623_0026200	Ga0495623_0026200_1288_2355	355
363	3300046680	Ga0495646_0005191	Ga0495646_0005191_4319_5386	355
364	3300046690	Ga0495624_0032408	Ga0495624_0032408_2028_3095	355
365	3300053077	Ga0495601_0047422	Ga0495601_0047422_880_1947	355
366	iso_pu_bacteria	2818991436	2819543369	355
367	3300002737	JGI25162J39368_1000284	JGI25162J39368_100028443	359
368	3300002772	JGI25164J39214_1005003	JGI25164J39214_10050032	359
369	3300003214	JGI25165J46597_1000384	JGI25165J46597_100038443	359
370	3300003751	Ga0055538_1000149	Ga0055538_100014943	359
371	3300003752	Ga0055539_1000199	Ga0055539_10001995	359
372	3300003756	Ga0055533_1000200	Ga0055533_100020043	359
373	3300003759	Ga0055525_1000276	Ga0055525_10002765	359
374	3300003841	Ga0055541_1000130	Ga0055541_100013043	359
375	3300015261	Ga0182006_1007675	Ga0182006_10076753	359
376	3300015265	Ga0182005_1000589	Ga0182005_100058910	359
377	3300025207	Ga0209760_100885	Ga0209760_1008853	359
378	3300025224	Ga0209784_100191	Ga0209784_10019145	359
379	3300025225	Ga0209566_100252	Ga0209566_10025248	359
380	3300025226	Ga0209674_100069	Ga0209674_10006945	359
381	3300025230	Ga0209563_100167	Ga0209563_10016744	359
382	3300025231	Ga0207427_100965	Ga0207427_10096510	359
383	3300025233	Ga0209437_100091	Ga0209437_10009144	359
384	3300025253	Ga0209677_100039	Ga0209677_10003945	359
385	3300025261	Ga0209233_1000115	Ga0209233_100011544	359

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01636

APH

Phosphotransferase enzyme family

77

325

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
3dxp-assembly1.cif.gz_A-2	crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution	0.8535	15	359
3dxp-assembly1.cif.gz_A-2	crystal structure of a putative aminoglycoside phosphotransferase (reut_a1007) from ralstonia eutropha jmp134 at 2.32 a resolution	0.8511	15	359
3att-assembly1.cif.gz_A	crystal structure of rv3168 with atp	0.7447	18	353
6bmm-assembly1.cif.gz_B	structure of human dhhc20 palmitoyltransferase, space group p21	0.7156	304	356
3att-assembly1.cif.gz_A	crystal structure of rv3168 with atp	0.7122	18	353

ID	Description	Score	Start	End	Superfamily
af_Q8K370_265_366_3.30.200.20	Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1	0.9224	16	116	3.30.200.20
af_O69727_9_110_3.30.200.20	Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1	0.9149	15	116	3.30.200.20
af_O69727_9_110_3.30.200.20	Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1	0.9065	15	116	3.30.200.20
af_Q8K370_265_366_3.30.200.20	Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1	0.9055	16	116	3.30.200.20
af_O01590_229_326_3.30.200.20	Alpha Beta;2-Layer Sandwich;Phosphorylase Kinase; domain 1;Phosphorylase Kinase; domain 1	0.897	16	115	3.30.200.20

ID	Description	Score	Start	End	GO Terms
AF-A0A522C465-F1-model_v4	Phosphotransferase family protein	0.988	237	355	GO:0016740
AF-A0A1H3FJZ7-F1-model_v4	Predicted kinase, aminoglycoside phosphotransferase (APT) family	0.9855	1	359	GO:0016301
AF-A0A1H3FJZ7-F1-model_v4	Predicted kinase, aminoglycoside phosphotransferase (APT) family	0.9827	1	359	GO:0016301
AF-A0A1G3DKZ8-F1-model_v4	deleted	0.9821	253	359
AF-A0A5E6V7J1-F1-model_v4	deleted	0.9807	1	359

Feature Viewer

pLDDT	pTM	Quality
92.49	0.91	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F430227

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01636

APH

Phosphotransferase enzyme family

77

325

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map