F430198

General Info

Members Datasets Scaffolds Average Seq Length
385 201 770 137

Family's Representative Sequence

Representative Sequence 3300013306|Ga0163162_10756468|Ga0163162_107564682
Length 153
Sequence MISSEDRRLALIRRIADMIPTGVLETVLYAKDLAAAEAFYRDALGMEPFTKMAGRHLFYRCGDQVLLIFNPDATKVAPAPGALPVPPHGMDGEGHVCFRASAAEIDAWRASLESRGTAIEADFEWPGGGRSIYFRDPAGNCLEFAEPRIWKLA

Samples

Sample ID Description Type Environment
1 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
17 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
24 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
25 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
26 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
27 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
28 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
31 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
32 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
33 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
34 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
35 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
36 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
37 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
38 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
43 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
44 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
45 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
46 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
47 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
48 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
49 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
50 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
51 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
52 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
53 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
54 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
55 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
56 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
72 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
76 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
77 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
78 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
102 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
103 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
104 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
108 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
109 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
110 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
111 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
112 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
113 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
114 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
115 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
116 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
117 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
118 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
119 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
120 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
121 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
122 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
123 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
124 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
125 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
126 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
127 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
128 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
129 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
130 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
131 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
132 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
135 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
136 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
137 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
138 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
139 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
140 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
141 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
142 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
143 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
144 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
145 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
146 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
147 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
148 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
149 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
165 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
166 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
167 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
168 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
169 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
170 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
171 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
172 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
173 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
174 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
175 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
176 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
180 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
186 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
187 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
188 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
191 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
192 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
195 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
196 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
197 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
198 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
199 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
200 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.75
Nodule 0
Rhizoplane 6.75
Rhizosphere 86.23
Stem 0
Stem Tuber 0
Unclassified 2.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0163162_10756468 3300013306 Bacteria 1091
2 JGI25404J52841_10021865 3300003659 Bacteria 1384
3 JGI25405J52794_10072464 3300003911 Bacteria 753
4 Ga0068869_100531991 3300005334 Bacteria 985
5 Ga0070680_100003040 3300005336 Bacteria 12455
6 Ga0070680_100139428 3300005336 Bacteria 2033
7 Ga0070682_101082418 3300005337 Bacteria 670
8 Ga0070691_10006174 3300005341 Bacteria 5467
9 Ga0070691_10014693 3300005341 Bacteria 3593
10 Ga0070687_100594850 3300005343 Bacteria 759
11 Ga0070692_10336497 3300005345 Bacteria 933
12 Ga0070668_100175740 3300005347 Bacteria 1746
13 Ga0070668_100220394 3300005347 Bacteria 1564
14 Ga0070688_100379141 3300005365 Bacteria 1042
15 Ga0070667_101696228 3300005367 Unclassified 594
16 Ga0070703_10000838 3300005406 Bacteria 9955
17 Ga0070703_10492537 3300005406 Bacteria 550
18 Ga0070701_10001297 3300005438 Bacteria 9190
19 Ga0070705_100001618 3300005440 Bacteria 11800
20 Ga0070700_100022624 3300005441 Bacteria 3669
21 Ga0070700_100169467 3300005441 Bacteria 1511
22 Ga0070694_100003484 3300005444 Bacteria 9421
23 Ga0070694_100109618 3300005444 Bacteria 1965
24 Ga0070663_100046343 3300005455 Bacteria 3076
25 Ga0070663_100158309 3300005455 Bacteria 1742
26 Ga0070663_100551781 3300005455 Bacteria 963
27 Ga0070678_100609852 3300005456 Bacteria 975
28 Ga0070681_10167299 3300005458 Bacteria 2121
29 Ga0068867_100076514 3300005459 Bacteria 2513
30 Ga0068867_100413978 3300005459 Bacteria 1140
31 Ga0070685_10725100 3300005466 Bacteria 727
32 Ga0070706_100040957 3300005467 Bacteria 4277
33 Ga0070707_100200547 3300005468 Bacteria 1945
34 Ga0070698_100325774 3300005471 Bacteria 1467
35 Ga0070698_100544467 3300005471 Bacteria 1100
36 Ga0070699_100002270 3300005518 Bacteria 17292
37 Ga0070679_100105973 3300005530 Bacteria 2797
38 Ga0070697_100680561 3300005536 Bacteria 907
39 Ga0068853_100640051 3300005539 Bacteria 1011
40 Ga0068853_101707990 3300005539 Bacteria 610
41 Ga0070695_100002169 3300005545 Bacteria 11246
42 Ga0070696_100000030 3300005546 Bacteria 65862
43 Ga0070693_100082526 3300005547 Bacteria 1919
44 Ga0070693_100198200 3300005547 Bacteria 1302
45 Ga0070665_100475749 3300005548 Bacteria 1260
46 Ga0070704_100000306 3300005549 Bacteria 21766
47 Ga0068857_100005351 3300005577 Bacteria 10939
48 Ga0068854_100659152 3300005578 Bacteria 899
49 Ga0070702_100217735 3300005615 Bacteria 1275
50 Ga0068859_100005813 3300005617 Bacteria 12530
51 Ga0068859_100745810 3300005617 Bacteria 1068
52 Ga0068859_101465683 3300005617 Bacteria 753
53 Ga0068864_100073170 3300005618 Bacteria 2988
54 Ga0068864_100374503 3300005618 Bacteria 1348
55 Ga0068861_100316966 3300005719 Bacteria 1357
56 Ga0068861_101113860 3300005719 Bacteria 759
57 Ga0068870_10114614 3300005840 Bacteria 1544
58 Ga0068863_100550596 3300005841 Bacteria 1139
59 Ga0068858_100194749 3300005842 Bacteria 1915
60 Ga0068858_100339771 3300005842 Bacteria 1437
61 Ga0068858_100352321 3300005842 Bacteria 1410
62 Ga0068860_100010248 3300005843 Bacteria 9277
63 Ga0068862_100012821 3300005844 Bacteria 6933
64 Ga0068862_100043481 3300005844 Bacteria 3830
65 Ga0068862_100955878 3300005844 Bacteria 845
66 Ga0081455_10000017 3300005937 Bacteria 174550
67 Ga0081540_1000059 3300005983 Bacteria 120226
68 Ga0081540_1043871 3300005983 Bacteria 2288
69 Ga0081539_10029678 3300005985 Bacteria 3410
70 Ga0075365_10075268 3300006038 Bacteria 2278
71 Ga0075365_10095351 3300006038 Bacteria 2032
72 Ga0075368_10036145 3300006042 Bacteria 1929
73 Ga0075368_10144119 3300006042 Bacteria 994
74 Ga0075363_100068636 3300006048 Bacteria 1922
75 Ga0075364_10314326 3300006051 Bacteria 1066
76 Ga0075367_10001270 3300006178 Bacteria 10658
77 Ga0075367_10005605 3300006178 Bacteria 6256
78 Ga0075370_10418465 3300006353 Unclassified 805
79 Ga0075428_100006310 3300006844 Bacteria 13181
80 Ga0075428_100121100 3300006844 Bacteria 2849
81 Ga0075428_100134925 3300006844 Bacteria 2684
82 Ga0075428_100148396 3300006844 Bacteria 2548
83 Ga0075428_100257988 3300006844 Bacteria 1878
84 Ga0075428_100420932 3300006844 Bacteria 1431
85 Ga0075428_100427590 3300006844 Bacteria 1419
86 Ga0075428_100757955 3300006844 Bacteria 1033
87 Ga0075428_101292212 3300006844 Bacteria 767
88 Ga0075430_100053719 3300006846 Bacteria 3392
89 Ga0075430_100063113 3300006846 Bacteria 3112
90 Ga0075430_100071673 3300006846 Bacteria 2906
91 Ga0075430_100073637 3300006846 Bacteria 2864
92 Ga0075430_100607545 3300006846 Bacteria 902
93 Ga0075431_100000419 3300006847 Bacteria 34595
94 Ga0075431_100001293 3300006847 Bacteria 22854
95 Ga0075431_100002086 3300006847 Bacteria 19086
96 Ga0075431_100045356 3300006847 Bacteria 4532
97 Ga0075431_100051733 3300006847 Bacteria 4235
98 Ga0075431_100113609 3300006847 Bacteria 2795
99 Ga0075431_100165764 3300006847 Bacteria 2271
100 Ga0075433_10002019 3300006852 Bacteria 15301
101 Ga0075433_10353753 3300006852 Bacteria 1298
102 Ga0075433_10766737 3300006852 Bacteria 844
103 Ga0075434_100002448 3300006871 Bacteria 16339
104 Ga0075434_100049444 3300006871 Bacteria 4175
105 Ga0075429_100088110 3300006880 Bacteria 2705
106 Ga0075429_100101860 3300006880 Bacteria 2507
107 Ga0075429_100171477 3300006880 Bacteria 1900
108 Ga0075429_100227110 3300006880 Bacteria 1635
109 Ga0075429_100594172 3300006880 Bacteria 970
110 Ga0075429_100684975 3300006880 Bacteria 898
111 Ga0068865_100604904 3300006881 Bacteria 927
112 Ga0075436_100171053 3300006914 Bacteria 1534
113 Ga0097620_100005813 3300006931 Bacteria 12530
114 Ga0097620_100745879 3300006931 Bacteria 1068
115 Ga0097620_101465528 3300006931 Bacteria 753
116 Ga0075435_100047066 3300007076 Bacteria 3462
117 Ga0111539_10085517 3300009094 Bacteria 3706
118 Ga0111539_10566538 3300009094 Bacteria 1323
119 Ga0111539_10657330 3300009094 Bacteria 1220
120 Ga0111539_10701624 3300009094 Bacteria 1178
121 Ga0111539_11005800 3300009094 Bacteria 969
122 Ga0105247_11367072 3300009101 Unclassified 572
123 Ga0114129_10047596 3300009147 Bacteria 6025
124 Ga0114129_10103244 3300009147 Bacteria 3942
125 Ga0114129_10213326 3300009147 Bacteria 2609
126 Ga0114129_10320934 3300009147 Bacteria 2059
127 Ga0114129_10578523 3300009147 Bacteria 1457
128 Ga0114129_10849682 3300009147 Bacteria 1160
129 Ga0114129_11276699 3300009147 Bacteria 911
130 Ga0114129_12547351 3300009147 Unclassified 611
131 Ga0105243_10031029 3300009148 Bacteria 4120
132 Ga0105243_10418022 3300009148 Bacteria 1250
133 Ga0105242_11566188 3300009176 Bacteria 692
134 Ga0105249_10021919 3300009553 Bacteria 5722
135 Ga0105239_10591423 3300010375 Bacteria 1265
136 Ga0105239_12186079 3300010375 Bacteria 643
137 Ga0157378_10744257 3300013297 Bacteria 1003
138 Ga0163162_10677558 3300013306 Bacteria 1154
139 Ga0157375_12875034 3300013308 Bacteria 575
140 Ga0163163_12569027 3300014325 Bacteria 567
141 Ga0157380_10067047 3300014326 Bacteria 2889
142 Ga0157380_10347539 3300014326 Bacteria 1386
143 Ga0157380_10456285 3300014326 Bacteria 1229
144 Ga0157380_11842878 3300014326 Bacteria 665
145 Ga0157379_10539549 3300014968 Bacteria 1084
146 Ga0163161_10500281 3300017792 Bacteria 990
147 Ga0207653_10014930 3300025885 Bacteria 2438
148 Ga0207642_10598389 3300025899 Bacteria 686
149 Ga0207643_10314614 3300025908 Bacteria 976
150 Ga0207684_10167930 3300025910 Bacteria 1891
151 Ga0207707_10094355 3300025912 Bacteria 2614
152 Ga0207660_10002180 3300025917 Bacteria 12967
153 Ga0207660_10302879 3300025917 Bacteria 1273
154 Ga0207662_10439409 3300025918 Bacteria 890
155 Ga0207662_10641571 3300025918 Bacteria 741
156 Ga0207649_11364181 3300025920 Bacteria 561
157 Ga0207652_10189162 3300025921 Bacteria 1851
158 Ga0207646_10894515 3300025922 Bacteria 788
159 Ga0207709_10378566 3300025935 Bacteria 1076
160 Ga0207712_10004152 3300025961 Bacteria 9148
161 Ga0207712_10329075 3300025961 Bacteria 1263
162 Ga0207668_10061616 3300025972 Bacteria 2639
163 Ga0207668_10072919 3300025972 Bacteria 2459
164 Ga0207668_10197321 3300025972 Bacteria 1600
165 Ga0207640_10580654 3300025981 Bacteria 946
166 Ga0207703_10191374 3300026035 Bacteria 1812
167 Ga0207703_10237218 3300026035 Bacteria 1638
168 Ga0207703_10549688 3300026035 Bacteria 1089
169 Ga0207639_10224030 3300026041 Bacteria 1626
170 Ga0207678_10036181 3300026067 Bacteria 4298
171 Ga0207678_10156571 3300026067 Bacteria 1945
172 Ga0207678_10332058 3300026067 Bacteria 1309
173 Ga0207678_10446632 3300026067 Bacteria 1123
174 Ga0207678_10549315 3300026067 Bacteria 1010
175 Ga0207678_11481551 3300026067 Bacteria 599
176 Ga0207708_10037770 3300026075 Bacteria 3679
177 Ga0207708_11048494 3300026075 Bacteria 710
178 Ga0207648_10384354 3300026089 Bacteria 1270
179 Ga0207648_10588048 3300026089 Bacteria 1025
180 Ga0207676_10073289 3300026095 Bacteria 2755
181 Ga0207676_10597639 3300026095 Bacteria 1059
182 Ga0207676_10750213 3300026095 Bacteria 949
183 Ga0207674_10009542 3300026116 Bacteria 11072
184 Ga0207674_10162020 3300026116 Bacteria 2191
185 Ga0207675_100211610 3300026118 Bacteria 1865
186 Ga0207675_100296725 3300026118 Bacteria 1573
187 Ga0207675_100317813 3300026118 Bacteria 1520
188 Ga0207683_10418838 3300026121 Bacteria 1233
189 Ga0209970_1014700 3300027614 Bacteria 1300
190 Ga0209813_10007759 3300027866 Bacteria 2684
191 Ga0209813_10297635 3300027866 Unclassified 626
192 Ga0207428_10217629 3300027907 Bacteria 1433
193 Ga0207428_10452960 3300027907 Bacteria 935
194 Ga0268266_10634180 3300028379 Bacteria 1028
195 Ga0268265_10002760 3300028380 Bacteria 12965
196 Ga0268265_10752163 3300028380 Bacteria 946
197 Ga0268265_10832643 3300028380 Bacteria 902
198 Ga0268264_10002861 3300028381 Bacteria 15032
199 Ga0265339_10085485 3300031249 Bacteria 1661
200 Ga0307408_100237778 3300031548 Bacteria 1495
201 Ga0307405_10575899 3300031731 Bacteria 915
202 Ga0307406_10250507 3300031901 Bacteria 1334
203 Ga0307416_100934195 3300032002 Bacteria 969
204 Ga0373950_0017137 3300034818 Bacteria 1246
205 Ga0373958_0044605 3300034819 Bacteria 918
206 Ga0373949_0024468 3300035090 Bacteria 1404
207 Ga0373939_0024483 3300035114 Bacteria 1682
208 Ga0373953_0017683 3300035117 Bacteria 2626
209 Ga0373954_0290781 3300035118 Bacteria 806
210 Ga0373956_0048589 3300035119 Bacteria 1901
211 Ga0373942_0145871 3300035207 Bacteria 757
212 Ga0373961_0009577 3300035241 Bacteria 2372
213 Ga0373961_0026517 3300035241 Bacteria 1584
214 Ga0373962_0020519 3300035242 Bacteria 1736
215 Ga0373962_0022732 3300035242 Bacteria 1665
216 Ga0316574_0046259 3300035398 Bacteria 2698
217 Ga0373924_0161653 3300035410 Bacteria 982
218 Ga0373931_0005459 3300035691 Bacteria 5884
219 Ga0373927_0149766 3300035695 Bacteria 1528
220 Ga0373925_1055775 3300037068 Bacteria 669
221 Ga0495638_0205873 3300046460 Bacteria 1108
222 Ga0495584_0063798 3300046491 Bacteria 1852
223 Ga0495587_0236689 3300046536 Bacteria 1028
224 Ga0495625_0162194 3300046660 Bacteria 1497
225 Ga0495657_0203815 3300046675 Bacteria 1205
226 Ga0495658_0376885 3300046683 Bacteria 903
227 Ga0495675_0596373 3300047444 Bacteria 627
228 Ga0495602_0659647 3300048088 Bacteria 714
229 Ga0496100_0462157 3300048903 Bacteria 974
230 Ga0496100_0464319 3300048903 Bacteria 972
231 Ga0496101_0295798 3300048904 Bacteria 1267
232 Ga0496102_0011931 3300048905 Bacteria 7504
233 Ga0496103_0035732 3300048906 Bacteria 3042
234 Ga0496103_0063423 3300048906 Bacteria 2302
235 Ga0496104_0234965 3300048907 Bacteria 1745
236 Ga0496105_0054587 3300048908 Bacteria 3299
237 Ga0496106_0000219 3300048909 Bacteria 39803
238 Ga0496106_0394342 3300048909 Bacteria 1112
239 Ga0496106_0625196 3300048909 Bacteria 861
240 Ga0496107_0070769 3300048910 Bacteria 2533
241 Ga0496108_0157595 3300048911 Bacteria 1961
242 Ga0496108_0160319 3300048911 Bacteria 1944
243 Ga0496108_0208328 3300048911 Bacteria 1697
244 Ga0496109_0123549 3300048912 Bacteria 2413
245 Ga0496109_0254908 3300048912 Bacteria 1652
246 Ga0496109_0847039 3300048912 Bacteria 852
247 Ga0496110_0352122 3300048913 Bacteria 1341
248 Ga0496110_0466971 3300048913 Bacteria 1150
249 Ga0496110_1681247 3300048913 Bacteria 545
250 Ga0496111_1187874 3300048914 Bacteria 541
251 Ga0496112_0114913 3300048915 Bacteria 2662
252 Ga0496112_0192565 3300048915 Bacteria 2000
253 Ga0496112_0749330 3300048915 Bacteria 903
254 Ga0496115_0055302 3300048918 Bacteria 3188
255 Ga0496124_0067345 3300048927 Bacteria 2980
256 Ga0501033_0158473 3300049570 Unclassified 1630
257 Ga0501034_0017731 3300049571 Bacteria 7302
258 Ga0501036_0085840 3300049572 Unclassified 2661
259 Ga0501036_0849215 3300049572 Bacteria 751
260 Ga0501037_0203387 3300049573 Bacteria 1399
261 Ga0501037_0409469 3300049573 Bacteria 929
262 Ga0501038_0017953 3300049574 Bacteria 6391
263 Ga0501038_0050331 3300049574 Bacteria 3600
264 Ga0501038_0655085 3300049574 Unclassified 790
265 Ga0501038_0658077 3300049574 Bacteria 788
266 Ga0501039_0020081 3300049575 Bacteria 5122
267 Ga0501039_0122801 3300049575 Bacteria 2036
268 Ga0501039_0791920 3300049575 Bacteria 740
269 Ga0501040_0006364 3300049576 Bacteria 7668
270 Ga0501040_0205799 3300049576 Bacteria 1398
271 Ga0501041_0000262 3300049577 Bacteria 24854
272 Ga0501041_0441735 3300049577 Bacteria 826
273 Ga0501042_0009653 3300049578 Bacteria 6443
274 Ga0501042_0861777 3300049578 Bacteria 659
275 Ga0501043_0557273 3300049579 Bacteria 851
276 Ga0501043_1244057 3300049579 Bacteria 521
277 Ga0501046_0000033 3300049580 Bacteria 174675
278 Ga0501046_0101994 3300049580 Bacteria 2200
279 Ga0501046_0509638 3300049580 Bacteria 861
280 Ga0501047_0025401 3300049581 Bacteria 5695
281 Ga0501047_0029403 3300049581 Bacteria 5299
282 Ga0501047_0903224 3300049581 Bacteria 697
283 Ga0501048_0000263 3300049582 Bacteria 35151
284 Ga0501067_0029014 3300049583 Bacteria 3067
285 Ga0501069_0500416 3300049585 Bacteria 725
286 Ga0501070_0528193 3300049586 Bacteria 946
287 Ga0501071_0042269 3300049587 Bacteria 3265
288 Ga0501071_1161158 3300049587 Bacteria 597
289 Ga0501072_0033114 3300049588 Bacteria 4049
290 Ga0501072_0356206 3300049588 Bacteria 1162
291 Ga0501074_0071951 3300049590 Bacteria 2485
292 Ga0501074_0117202 3300049590 Bacteria 1905
293 Ga0501075_0000375 3300049591 Bacteria 25719
294 Ga0501075_0179858 3300049591 Bacteria 1614
295 Ga0501076_0062416 3300049592 Bacteria 2967
296 Ga0501077_0000835 3300049593 Bacteria 18638
297 Ga0501077_0022855 3300049593 Bacteria 3963
298 Ga0501077_0038049 3300049593 Bacteria 3063
299 Ga0501077_0336404 3300049593 Bacteria 963
300 Ga0501077_0465004 3300049593 Bacteria 810
301 Ga0501079_0020926 3300049741 Bacteria 5002
302 Ga0501079_0172524 3300049741 Bacteria 1686
303 Ga0501079_0263192 3300049741 Bacteria 1348
304 Ga0501079_0572761 3300049741 Bacteria 888
305 Ga0501080_0017327 3300049742 Bacteria 6659
306 Ga0501080_0113816 3300049742 Bacteria 2508
307 Ga0501081_0009745 3300049743 Bacteria 6262
308 Ga0501081_0054187 3300049743 Bacteria 2771
309 Ga0501081_0375779 3300049743 Bacteria 1049
310 Ga0501083_0031349 3300049744 Bacteria 3649
311 Ga0501083_0376602 3300049744 Bacteria 923
312 Ga0501083_0662754 3300049744 Unclassified 679
313 Ga0501035_0220657 3300049822 Bacteria 1619
314 Ga0501035_0661388 3300049822 Bacteria 846
315 Ga0501035_1432643 3300049822 Bacteria 529
316 Ga0501044_1179244 3300049823 Bacteria 634
317 Ga0501044_1435507 3300049823 Unclassified 555
318 Ga0501045_0002436 3300049824 Bacteria 12648
319 Ga0501045_0102500 3300049824 Bacteria 2119
320 Ga0501045_0366544 3300049824 Bacteria 1072
321 Ga0501045_0555400 3300049824 Bacteria 851
322 Ga0501045_0721615 3300049824 Bacteria 735
323 nmdc:mga03683_210513_c1 3300050489 Bacteria 894
324 nmdc:mga03n38_631102_c1 3300050490 Unclassified 613
325 nmdc:mga03n38_82978_c1 3300050490 Bacteria 1510
326 nmdc:mga0yw44_1249342_c1 3300050492 Bacteria 501
327 nmdc:mga0yw44_78458_c1 3300050492 Bacteria 2065
328 nmdc:mga06z11_164907_c1 3300050494 Bacteria 1269
329 nmdc:mga06z11_932_c1 3300050494 Bacteria 10624
330 nmdc:mga04h51_17519_c1 3300050495 Bacteria 2096
331 nmdc:mga04h51_40947_c1 3300050495 Bacteria 1512
332 nmdc:mga07m45_118170_c1 3300050496 Bacteria 1530
333 nmdc:mga05p37_1102853_c1 3300050507 Bacteria 831
334 nmdc:mga05p37_216557_c1 3300050507 Bacteria 2313
335 nmdc:mga05p37_270415_c1 3300050507 Bacteria 2031
336 nmdc:mga05p37_289249_c1 3300050507 Bacteria 1951
337 nmdc:mga05p37_320367_c1 3300050507 Bacteria 1835
338 nmdc:mga05p37_326722_c1 3300050507 Bacteria 1813
339 nmdc:mga05p37_417945_c1 3300050507 Bacteria 1561
340 nmdc:mga09592_102421_c1 3300050508 Bacteria 2453
341 nmdc:mga09592_1068258_c1 3300050508 Bacteria 672
342 nmdc:mga09592_19397_c1 3300050508 Bacteria 5583
343 nmdc:mga09592_441965_c1 3300050508 Bacteria 1122
344 nmdc:mga09592_53115_c1 3300050508 Bacteria 3421
345 nmdc:mga09592_654018_c1 3300050508 Bacteria 897
346 nmdc:mga0qj67_113580_c1 3300050509 Bacteria 2187
347 nmdc:mga0qj67_13338_c1 3300050509 Bacteria 6202
348 nmdc:mga0qj67_37200_c1 3300050509 Bacteria 3812
349 nmdc:mga0qj67_42421_c1 3300050509 Bacteria 3581
350 nmdc:mga0qj67_453374_c1 3300050509 Bacteria 1033
351 nmdc:mga06r32_11712_c1 3300050510 Bacteria 7894
352 nmdc:mga06r32_129617_c1 3300050510 Bacteria 2493
353 nmdc:mga06r32_18811_c1 3300050510 Bacteria 6330
354 nmdc:mga06r32_201_c1 3300050510 Bacteria 26944
355 nmdc:mga06r32_36968_c1 3300050510 Bacteria 4619
356 nmdc:mga06r32_578305_c1 3300050510 Bacteria 1096
357 nmdc:mga06r32_769493_c1 3300050510 Bacteria 925
358 nmdc:mga08y16_138347_c1 3300050511 Bacteria 2532
359 nmdc:mga08y16_156060_c1 3300050511 Bacteria 2372
360 nmdc:mga08y16_217617_c1 3300050511 Bacteria 1978
361 nmdc:mga0n895_47419_c1 3300050512 Bacteria 4201
362 nmdc:mga0n895_544742_c1 3300050512 Bacteria 1166
363 nmdc:mga0n895_54613_c1 3300050512 Bacteria 3930
364 nmdc:mga0rr50_235810_c1 3300050513 Bacteria 1515
365 nmdc:mga0rr50_39758_c1 3300050513 Bacteria 3414
366 nmdc:mga08x19_153944_c1 3300050514 Bacteria 1558
367 nmdc:mga0a205_1678_c1 3300050515 Bacteria 19104
368 nmdc:mga0a205_330401_c1 3300050515 Bacteria 1394
369 Ga0500556_0000082 3300053104 Bacteria 89905
370 Ga0500562_020645 3300053108 Bacteria 1710
371 Ga0500595_040662 3300053119 Bacteria 1498
372 Ga0500616_0005573 3300053153 Bacteria 8513
373 Ga0500645_024191 3300053730 Bacteria 1858
374 Ga0501084_0002145 3300054114 Bacteria 15774
375 Ga0501084_0010432 3300054114 Bacteria 7682
376 Ga0501084_0349089 3300054114 Bacteria 1250
377 Ga0501082_0003761 3300060353 Bacteria 13262
378 Ga0501082_0041818 3300060353 Bacteria 3952
379 Ga0501082_0081925 3300060353 Bacteria 2784
380 Ga0501082_0084683 3300060353 Bacteria 2734
381 Ga0501082_0265084 3300060353 Bacteria 1495
382 Ga0501082_0273710 3300060353 Bacteria 1470
383 Ga0501082_0659661 3300060353 Bacteria 916
384 Ga0501082_1860335 3300060353 Bacteria 525
385 Ga0530510_0176814 3300061734 Bacteria 1582
386 Ga0163162_10756468
387 JGI25404J52841_10021865
388 JGI25405J52794_10072464
389 Ga0068869_100531991
390 Ga0070680_100003040
391 Ga0070680_100139428
392 Ga0070682_101082418
393 Ga0070691_10006174
394 Ga0070691_10014693
395 Ga0070687_100594850
396 Ga0070692_10336497
397 Ga0070668_100175740
398 Ga0070668_100220394
399 Ga0070688_100379141
400 Ga0070667_101696228
401 Ga0070703_10000838
402 Ga0070703_10492537
403 Ga0070701_10001297
404 Ga0070705_100001618
405 Ga0070700_100022624
406 Ga0070700_100169467
407 Ga0070694_100003484
408 Ga0070694_100109618
409 Ga0070663_100046343
410 Ga0070663_100158309
411 Ga0070663_100551781
412 Ga0070678_100609852
413 Ga0070681_10167299
414 Ga0068867_100076514
415 Ga0068867_100413978
416 Ga0070685_10725100
417 Ga0070706_100040957
418 Ga0070707_100200547
419 Ga0070698_100325774
420 Ga0070698_100544467
421 Ga0070699_100002270
422 Ga0070679_100105973
423 Ga0070697_100680561
424 Ga0068853_100640051
425 Ga0068853_101707990
426 Ga0070695_100002169
427 Ga0070696_100000030
428 Ga0070693_100082526
429 Ga0070693_100198200
430 Ga0070665_100475749
431 Ga0070704_100000306
432 Ga0068857_100005351
433 Ga0068854_100659152
434 Ga0070702_100217735
435 Ga0068859_100005813
436 Ga0068859_100745810
437 Ga0068859_101465683
438 Ga0068864_100073170
439 Ga0068864_100374503
440 Ga0068861_100316966
441 Ga0068861_101113860
442 Ga0068870_10114614
443 Ga0068863_100550596
444 Ga0068858_100194749
445 Ga0068858_100339771
446 Ga0068858_100352321
447 Ga0068860_100010248
448 Ga0068862_100012821
449 Ga0068862_100043481
450 Ga0068862_100955878
451 Ga0081455_10000017
452 Ga0081540_1000059
453 Ga0081540_1043871
454 Ga0081539_10029678
455 Ga0075365_10075268
456 Ga0075365_10095351
457 Ga0075368_10036145
458 Ga0075368_10144119
459 Ga0075363_100068636
460 Ga0075364_10314326
461 Ga0075367_10001270
462 Ga0075367_10005605
463 Ga0075370_10418465
464 Ga0075428_100006310
465 Ga0075428_100121100
466 Ga0075428_100134925
467 Ga0075428_100148396
468 Ga0075428_100257988
469 Ga0075428_100420932
470 Ga0075428_100427590
471 Ga0075428_100757955
472 Ga0075428_101292212
473 Ga0075430_100053719
474 Ga0075430_100063113
475 Ga0075430_100071673
476 Ga0075430_100073637
477 Ga0075430_100607545
478 Ga0075431_100000419
479 Ga0075431_100001293
480 Ga0075431_100002086
481 Ga0075431_100045356
482 Ga0075431_100051733
483 Ga0075431_100113609
484 Ga0075431_100165764
485 Ga0075433_10002019
486 Ga0075433_10353753
487 Ga0075433_10766737
488 Ga0075434_100002448
489 Ga0075434_100049444
490 Ga0075429_100088110
491 Ga0075429_100101860
492 Ga0075429_100171477
493 Ga0075429_100227110
494 Ga0075429_100594172
495 Ga0075429_100684975
496 Ga0068865_100604904
497 Ga0075436_100171053
498 Ga0097620_100005813
499 Ga0097620_100745879
500 Ga0097620_101465528
501 Ga0075435_100047066
502 Ga0111539_10085517
503 Ga0111539_10566538
504 Ga0111539_10657330
505 Ga0111539_10701624
506 Ga0111539_11005800
507 Ga0105247_11367072
508 Ga0114129_10047596
509 Ga0114129_10103244
510 Ga0114129_10213326
511 Ga0114129_10320934
512 Ga0114129_10578523
513 Ga0114129_10849682
514 Ga0114129_11276699
515 Ga0114129_12547351
516 Ga0105243_10031029
517 Ga0105243_10418022
518 Ga0105242_11566188
519 Ga0105249_10021919
520 Ga0105239_10591423
521 Ga0105239_12186079
522 Ga0157378_10744257
523 Ga0163162_10677558
524 Ga0157375_12875034
525 Ga0163163_12569027
526 Ga0157380_10067047
527 Ga0157380_10347539
528 Ga0157380_10456285
529 Ga0157380_11842878
530 Ga0157379_10539549
531 Ga0163161_10500281
532 Ga0207653_10014930
533 Ga0207642_10598389
534 Ga0207643_10314614
535 Ga0207684_10167930
536 Ga0207707_10094355
537 Ga0207660_10002180
538 Ga0207660_10302879
539 Ga0207662_10439409
540 Ga0207662_10641571
541 Ga0207649_11364181
542 Ga0207652_10189162
543 Ga0207646_10894515
544 Ga0207709_10378566
545 Ga0207712_10004152
546 Ga0207712_10329075
547 Ga0207668_10061616
548 Ga0207668_10072919
549 Ga0207668_10197321
550 Ga0207640_10580654
551 Ga0207703_10191374
552 Ga0207703_10237218
553 Ga0207703_10549688
554 Ga0207639_10224030
555 Ga0207678_10036181
556 Ga0207678_10156571
557 Ga0207678_10332058
558 Ga0207678_10446632
559 Ga0207678_10549315
560 Ga0207678_11481551
561 Ga0207708_10037770
562 Ga0207708_11048494
563 Ga0207648_10384354
564 Ga0207648_10588048
565 Ga0207676_10073289
566 Ga0207676_10597639
567 Ga0207676_10750213
568 Ga0207674_10009542
569 Ga0207674_10162020
570 Ga0207675_100211610
571 Ga0207675_100296725
572 Ga0207675_100317813
573 Ga0207683_10418838
574 Ga0209970_1014700
575 Ga0209813_10007759
576 Ga0209813_10297635
577 Ga0207428_10217629
578 Ga0207428_10452960
579 Ga0268266_10634180
580 Ga0268265_10002760
581 Ga0268265_10752163
582 Ga0268265_10832643
583 Ga0268264_10002861
584 Ga0265339_10085485
585 Ga0307408_100237778
586 Ga0307405_10575899
587 Ga0307406_10250507
588 Ga0307416_100934195
589 Ga0373950_0017137
590 Ga0373958_0044605
591 Ga0373949_0024468
592 Ga0373939_0024483
593 Ga0373953_0017683
594 Ga0373954_0290781
595 Ga0373956_0048589
596 Ga0373942_0145871
597 Ga0373961_0009577
598 Ga0373961_0026517
599 Ga0373962_0020519
600 Ga0373962_0022732
601 Ga0316574_0046259
602 Ga0373924_0161653
603 Ga0373931_0005459
604 Ga0373927_0149766
605 Ga0373925_1055775
606 Ga0495638_0205873
607 Ga0495584_0063798
608 Ga0495587_0236689
609 Ga0495625_0162194
610 Ga0495657_0203815
611 Ga0495658_0376885
612 Ga0495675_0596373
613 Ga0495602_0659647
614 Ga0496100_0462157
615 Ga0496100_0464319
616 Ga0496101_0295798
617 Ga0496102_0011931
618 Ga0496103_0035732
619 Ga0496103_0063423
620 Ga0496104_0234965
621 Ga0496105_0054587
622 Ga0496106_0000219
623 Ga0496106_0394342
624 Ga0496106_0625196
625 Ga0496107_0070769
626 Ga0496108_0157595
627 Ga0496108_0160319
628 Ga0496108_0208328
629 Ga0496109_0123549
630 Ga0496109_0254908
631 Ga0496109_0847039
632 Ga0496110_0352122
633 Ga0496110_0466971
634 Ga0496110_1681247
635 Ga0496111_1187874
636 Ga0496112_0114913
637 Ga0496112_0192565
638 Ga0496112_0749330
639 Ga0496115_0055302
640 Ga0496124_0067345
641 Ga0501033_0158473
642 Ga0501034_0017731
643 Ga0501036_0085840
644 Ga0501036_0849215
645 Ga0501037_0203387
646 Ga0501037_0409469
647 Ga0501038_0017953
648 Ga0501038_0050331
649 Ga0501038_0655085
650 Ga0501038_0658077
651 Ga0501039_0020081
652 Ga0501039_0122801
653 Ga0501039_0791920
654 Ga0501040_0006364
655 Ga0501040_0205799
656 Ga0501041_0000262
657 Ga0501041_0441735
658 Ga0501042_0009653
659 Ga0501042_0861777
660 Ga0501043_0557273
661 Ga0501043_1244057
662 Ga0501046_0000033
663 Ga0501046_0101994
664 Ga0501046_0509638
665 Ga0501047_0025401
666 Ga0501047_0029403
667 Ga0501047_0903224
668 Ga0501048_0000263
669 Ga0501067_0029014
670 Ga0501069_0500416
671 Ga0501070_0528193
672 Ga0501071_0042269
673 Ga0501071_1161158
674 Ga0501072_0033114
675 Ga0501072_0356206
676 Ga0501074_0071951
677 Ga0501074_0117202
678 Ga0501075_0000375
679 Ga0501075_0179858
680 Ga0501076_0062416
681 Ga0501077_0000835
682 Ga0501077_0022855
683 Ga0501077_0038049
684 Ga0501077_0336404
685 Ga0501077_0465004
686 Ga0501079_0020926
687 Ga0501079_0172524
688 Ga0501079_0263192
689 Ga0501079_0572761
690 Ga0501080_0017327
691 Ga0501080_0113816
692 Ga0501081_0009745
693 Ga0501081_0054187
694 Ga0501081_0375779
695 Ga0501083_0031349
696 Ga0501083_0376602
697 Ga0501083_0662754
698 Ga0501035_0220657
699 Ga0501035_0661388
700 Ga0501035_1432643
701 Ga0501044_1179244
702 Ga0501044_1435507
703 Ga0501045_0002436
704 Ga0501045_0102500
705 Ga0501045_0366544
706 Ga0501045_0555400
707 Ga0501045_0721615
708 nmdc:mga03683_210513_c1
709 nmdc:mga03n38_631102_c1
710 nmdc:mga03n38_82978_c1
711 nmdc:mga0yw44_1249342_c1
712 nmdc:mga0yw44_78458_c1
713 nmdc:mga06z11_164907_c1
714 nmdc:mga06z11_932_c1
715 nmdc:mga04h51_17519_c1
716 nmdc:mga04h51_40947_c1
717 nmdc:mga07m45_118170_c1
718 nmdc:mga05p37_1102853_c1
719 nmdc:mga05p37_216557_c1
720 nmdc:mga05p37_270415_c1
721 nmdc:mga05p37_289249_c1
722 nmdc:mga05p37_320367_c1
723 nmdc:mga05p37_326722_c1
724 nmdc:mga05p37_417945_c1
725 nmdc:mga09592_102421_c1
726 nmdc:mga09592_1068258_c1
727 nmdc:mga09592_19397_c1
728 nmdc:mga09592_441965_c1
729 nmdc:mga09592_53115_c1
730 nmdc:mga09592_654018_c1
731 nmdc:mga0qj67_113580_c1
732 nmdc:mga0qj67_13338_c1
733 nmdc:mga0qj67_37200_c1
734 nmdc:mga0qj67_42421_c1
735 nmdc:mga0qj67_453374_c1
736 nmdc:mga06r32_11712_c1
737 nmdc:mga06r32_129617_c1
738 nmdc:mga06r32_18811_c1
739 nmdc:mga06r32_201_c1
740 nmdc:mga06r32_36968_c1
741 nmdc:mga06r32_578305_c1
742 nmdc:mga06r32_769493_c1
743 nmdc:mga08y16_138347_c1
744 nmdc:mga08y16_156060_c1
745 nmdc:mga08y16_217617_c1
746 nmdc:mga0n895_47419_c1
747 nmdc:mga0n895_544742_c1
748 nmdc:mga0n895_54613_c1
749 nmdc:mga0rr50_235810_c1
750 nmdc:mga0rr50_39758_c1
751 nmdc:mga08x19_153944_c1
752 nmdc:mga0a205_1678_c1
753 nmdc:mga0a205_330401_c1
754 Ga0500556_0000082
755 Ga0500562_020645
756 Ga0500595_040662
757 Ga0500616_0005573
758 Ga0500645_024191
759 Ga0501084_0002145
760 Ga0501084_0010432
761 Ga0501084_0349089
762 Ga0501082_0003761
763 Ga0501082_0041818
764 Ga0501082_0081925
765 Ga0501082_0084683
766 Ga0501082_0265084
767 Ga0501082_0273710
768 Ga0501082_0659661
769 Ga0501082_1860335
770 Ga0530510_0176814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

22

144

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3r4q-assembly2.cif.gz_D crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.899 3 135
3r4q-assembly3.cif.gz_E-2 crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.888 3 136
3r4q-assembly2.cif.gz_D crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.8798 3 135
3r4q-assembly3.cif.gz_E-2 crystal structure of lactoylglutathione lyase from agrobacterium tumefaciens 0.8753 3 136
3ghj-assembly1.cif.gz_A-2 crystal structure from the mobile metagenome of halifax harbour sewage outfall: integron cassette protein hfx_cass4 0.8519 5 129
ID Description Score Start End Superfamily
3r4qE01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9124 7 136 3.10.180.10
3r4qE01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9056 7 136 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8597 5 129 3.10.180.10
3ghjA00 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.832 5 129 3.10.180.10
2pjsB01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8306 80 129 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A3S2DV78-F1-model_v4 deleted 0.9757 10 135
AF-A0A530BP97-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9742 23 135 GO:0051213
AF-A0A526QFG0-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9692 29 135 GO:0051213
AF-A0A530BP97-F1-model_v4 Glyoxalase/bleomycin resistance/extradiol dioxygenase family protein 0.9576 23 135 GO:0051213
AF-C3MEJ0-F1-model_v4 Predicted glyoxalase/bleomycin resistance protein/dioxygenase 0.9521 5 136

Map