F430154

General Info

Members Datasets Scaffolds Average Seq Length
385 175 385 249

Family's Representative Sequence

Representative Sequence 3300005937|Ga0081455_10057610|Ga0081455_100576103
Length 295
Sequence MGSLIDRYRDRLPVGESTPVVSLGEGGTPLLHAPRLSERLGVELYVKWEGANPTGSFKDRGMTLAISRALEDGVSAVVCASTGNTAASASAYGARVVEASWHGYAAQKNIAAQLASHDWILALDADESLSEALEAEIWQIKKSGPQHDGFTVPRLAQYLGRWILHSGWHPDRKVRLFNKHKAKWVGEFVHESVTVNGSVGHLNSNLLHFTCNSLSEHLRTMDSYTTLAAQEIAAREQSVSFAKLLFDPPWTFFRTYVLKLGFLDGVEGLAIAYMAALYNFVKYSKARLMSPGRKR

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
3 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
6 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
21 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
22 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
23 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
32 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
33 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
34 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
35 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
38 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
39 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
40 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
41 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
42 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
43 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
44 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
45 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
48 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
50 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
51 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
52 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
53 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
54 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
55 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
56 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
57 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
66 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
67 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
68 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
69 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
70 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
71 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
72 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
73 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
74 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
75 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
76 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
77 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
122 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
123 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
124 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
125 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
126 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
127 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
128 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
129 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
130 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
131 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
132 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
133 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
134 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
135 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
136 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
137 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
140 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
141 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
142 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
143 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
144 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
145 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
146 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
147 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
148 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
149 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
157 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
158 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
159 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
162 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
163 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
164 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
165 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
166 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
167 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
168 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
169 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
172 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
173 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
174 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
175 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 1.04
Rhizosphere 90.39
Stem 0
Stem Tuber 0
Unclassified 8.31

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100047987 3300005329 Unclassified 3947
2 Ga0070683_100095672 3300005329 Bacteria 2793
3 Ga0070690_100270639 3300005330 Unclassified 1208
4 Ga0068869_100043994 3300005334 Unclassified 3210
5 Ga0070680_100007516 3300005336 Bacteria 8311
6 Ga0070680_100047647 3300005336 Bacteria 3490
7 Ga0068868_100003605 3300005338 Bacteria 10789
8 Ga0068868_100051415 3300005338 Unclassified 3241
9 Ga0070660_100033302 3300005339 Bacteria 3884
10 Ga0070689_100129953 3300005340 Bacteria 2019
11 Ga0070691_10000214 3300005341 Bacteria 19567
12 Ga0070661_100617295 3300005344 Unclassified 878
13 Ga0070671_100045767 3300005355 Unclassified 3638
14 Ga0070674_100158306 3300005356 Unclassified 1716
15 Ga0070674_100404608 3300005356 Unclassified 1116
16 Ga0070673_100228307 3300005364 Unclassified 1614
17 Ga0070673_100529977 3300005364 Bacteria 1068
18 Ga0070714_100161854 3300005435 Unclassified 2025
19 Ga0070713_100564563 3300005436 Bacteria 1079
20 Ga0070705_100406800 3300005440 Bacteria 1009
21 Ga0070678_100081934 3300005456 Bacteria 2448
22 Ga0070662_100050339 3300005457 Bacteria 3005
23 Ga0070662_100506014 3300005457 Unclassified 1008
24 Ga0070681_10007075 3300005458 Bacteria 10923
25 Ga0070681_10033805 3300005458 Bacteria 5133
26 Ga0070681_10181643 3300005458 Unclassified 2025
27 Ga0070681_10199593 3300005458 Bacteria 1919
28 Ga0070681_10586107 3300005458 Bacteria 1029
29 Ga0068867_100014186 3300005459 Bacteria 5645
30 Ga0068867_100361013 3300005459 Bacteria 1215
31 Ga0068867_100366746 3300005459 Unclassified 1206
32 Ga0070706_100441439 3300005467 Unclassified 1211
33 Ga0070679_100002027 3300005530 Bacteria 18177
34 Ga0070679_100146473 3300005530 Bacteria 2339
35 Ga0070684_100003345 3300005535 Bacteria 12009
36 Ga0070684_100025876 3300005535 Bacteria 4937
37 Ga0070684_100054675 3300005535 Bacteria 3478
38 Ga0070684_100110385 3300005535 Bacteria 2466
39 Ga0068853_100017994 3300005539 Bacteria 5841
40 Ga0068853_100098455 3300005539 Bacteria 2582
41 Ga0068853_100177348 3300005539 Bacteria 1931
42 Ga0068853_100833904 3300005539 Bacteria 884
43 Ga0070696_100001276 3300005546 Bacteria 16390
44 Ga0070693_100146502 3300005547 Bacteria 1492
45 Ga0070665_100041563 3300005548 Bacteria 4622
46 Ga0068855_100005374 3300005563 Bacteria 15623
47 Ga0068855_100093751 3300005563 Unclassified 3462
48 Ga0068855_100110747 3300005563 Bacteria 3151
49 Ga0068855_100122251 3300005563 Bacteria 2979
50 Ga0068855_100380085 3300005563 Unclassified 1551
51 Ga0070664_100110554 3300005564 Bacteria 2398
52 Ga0070664_100219002 3300005564 Bacteria 1703
53 Ga0068857_100006119 3300005577 Bacteria 10279
54 Ga0068857_100006731 3300005577 Bacteria 9880
55 Ga0068854_100064478 3300005578 Unclassified 2662
56 Ga0068854_100291561 3300005578 Bacteria 1317
57 Ga0068856_100005254 3300005614 Bacteria 12770
58 Ga0068856_100024477 3300005614 Bacteria 5879
59 Ga0068856_100026490 3300005614 Bacteria 5653
60 Ga0068856_100028736 3300005614 Bacteria 5432
61 Ga0068856_100114555 3300005614 Unclassified 2695
62 Ga0068856_100203063 3300005614 Bacteria 1997
63 Ga0068856_100334238 3300005614 Bacteria 1533
64 Ga0070702_100415915 3300005615 Bacteria 966
65 Ga0068852_100026711 3300005616 Bacteria 4698
66 Ga0068852_100066849 3300005616 Bacteria 3141
67 Ga0068852_100075836 3300005616 Unclassified 2967
68 Ga0068852_100700297 3300005616 Bacteria 1023
69 Ga0068852_100750065 3300005616 Bacteria 988
70 Ga0068859_100256923 3300005617 Archaea 1838
71 Ga0068859_100365984 3300005617 Bacteria 1537
72 Ga0068859_101001372 3300005617 Unclassified 918
73 Ga0068864_100704464 3300005618 Bacteria 987
74 Ga0068864_100773201 3300005618 Unclassified 942
75 Ga0068866_10102735 3300005718 Bacteria 1580
76 Ga0068851_10197585 3300005834 Unclassified 1121
77 Ga0068863_100024248 3300005841 Bacteria 5786
78 Ga0068863_100175623 3300005841 Bacteria 2056
79 Ga0068858_100052067 3300005842 Bacteria 3788
80 Ga0068858_100372585 3300005842 Unclassified 1369
81 Ga0068858_100694010 3300005842 Unclassified 990
82 Ga0081455_10057610 3300005937 Bacteria 3292
83 Ga0070717_10318169 3300006028 Bacteria 1386
84 Ga0070712_100263460 3300006175 Bacteria 1382
85 Ga0097621_100093062 3300006237 Unclassified 2525
86 Ga0097621_100093517 3300006237 Unclassified 2520
87 Ga0097621_100203754 3300006237 Bacteria 1719
88 Ga0068871_100141642 3300006358 Bacteria 2045
89 Ga0068871_100162461 3300006358 Unclassified 1911
90 Ga0068871_100305582 3300006358 Bacteria 1397
91 Ga0068871_100311085 3300006358 Unclassified 1385
92 Ga0075430_100078032 3300006846 Bacteria 2776
93 Ga0075431_100587038 3300006847 Bacteria 1099
94 Ga0068865_100355508 3300006881 Unclassified 1188
95 Ga0097620_100256907 3300006931 Archaea 1838
96 Ga0097620_100365955 3300006931 Bacteria 1537
97 Ga0097620_101001280 3300006931 Unclassified 918
98 Ga0105240_10000274 3300009093 Bacteria 102157
99 Ga0105240_10005632 3300009093 Bacteria 18594
100 Ga0105240_10005942 3300009093 Bacteria 18084
101 Ga0105240_10069474 3300009093 Unclassified 4360
102 Ga0105240_10182809 3300009093 Bacteria 2473
103 Ga0105240_10760934 3300009093 Bacteria 1052
104 Ga0105240_11034097 3300009093 Bacteria 877
105 Ga0105245_10002804 3300009098 Bacteria 15684
106 Ga0105245_10045473 3300009098 Unclassified 3921
107 Ga0105245_10058861 3300009098 Bacteria 3459
108 Ga0105245_10158829 3300009098 Unclassified 2144
109 Ga0105245_10718891 3300009098 Unclassified 1033
110 Ga0105245_10756967 3300009098 Unclassified 1007
111 Ga0114129_10240463 3300009147 Bacteria 2434
112 Ga0114129_10735203 3300009147 Bacteria 1265
113 Ga0105243_10041103 3300009148 Bacteria 3615
114 Ga0105243_10340790 3300009148 Bacteria 1373
115 Ga0105241_10032412 3300009174 Bacteria 3917
116 Ga0105241_10129777 3300009174 Unclassified 2039
117 Ga0105241_10151858 3300009174 Bacteria 1895
118 Ga0105241_10246362 3300009174 Unclassified 1513
119 Ga0105241_10351540 3300009174 Bacteria 1280
120 Ga0105241_10545104 3300009174 Bacteria 1041
121 Ga0105242_10007383 3300009176 Bacteria 8463
122 Ga0105242_10015770 3300009176 Bacteria 5870
123 Ga0105242_10087779 3300009176 Unclassified 2611
124 Ga0105242_10186646 3300009176 Unclassified 1833
125 Ga0105248_10015594 3300009177 Bacteria 8376
126 Ga0105248_10267260 3300009177 Bacteria 1925
127 Ga0105248_10301012 3300009177 Unclassified 1806
128 Ga0105248_10788190 3300009177 Unclassified 1073
129 Ga0105237_10003496 3300009545 Bacteria 18642
130 Ga0105237_10010718 3300009545 Bacteria 9725
131 Ga0105237_10035245 3300009545 Bacteria 5064
132 Ga0105237_10215948 3300009545 Bacteria 1918
133 Ga0105238_10015766 3300009551 Bacteria 7651
134 Ga0105238_10053939 3300009551 Unclassified 4039
135 Ga0105238_10063316 3300009551 Unclassified 3698
136 Ga0105238_10089437 3300009551 Unclassified 3066
137 Ga0105249_10052490 3300009553 Bacteria 3723
138 Ga0105249_10146463 3300009553 Unclassified 2270
139 Ga0105249_10764441 3300009553 Unclassified 1029
140 Ga0105239_10003499 3300010375 Bacteria 19222
141 Ga0105239_10008368 3300010375 Bacteria 11785
142 Ga0105239_10010268 3300010375 Bacteria 10487
143 Ga0105239_10010471 3300010375 Bacteria 10368
144 Ga0105239_10029514 3300010375 Bacteria 6029
145 Ga0105246_10027327 3300011119 Unclassified 3737
146 Ga0105246_10276501 3300011119 Unclassified 1345
147 Ga0157373_10174937 3300013100 Bacteria 1511
148 Ga0157373_10301711 3300013100 Unclassified 1137
149 Ga0157371_10212980 3300013102 Unclassified 1387
150 Ga0157370_10004678 3300013104 Bacteria 15611
151 Ga0157370_10005275 3300013104 Bacteria 14520
152 Ga0157370_10019878 3300013104 Bacteria 6718
153 Ga0157370_10056645 3300013104 Bacteria 3730
154 Ga0157370_10086286 3300013104 Bacteria 2949
155 Ga0157370_10411429 3300013104 Bacteria 1244
156 Ga0157369_10000661 3300013105 Bacteria 44651
157 Ga0157369_10027320 3300013105 Bacteria 6327
158 Ga0157369_10320831 3300013105 Unclassified 1610
159 Ga0157374_10006350 3300013296 Bacteria 10029
160 Ga0157374_10105378 3300013296 Bacteria 2708
161 Ga0157374_10227857 3300013296 Bacteria 1830
162 Ga0157374_10468162 3300013296 Unclassified 1263
163 Ga0157378_10015930 3300013297 Bacteria 6584
164 Ga0157378_10021049 3300013297 Bacteria 5737
165 Ga0157378_10102872 3300013297 Unclassified 2609
166 Ga0157378_10309606 3300013297 Unclassified 1531
167 Ga0163162_10022715 3300013306 Bacteria 6185
168 Ga0163162_10771011 3300013306 Unclassified 1080
169 Ga0157372_10034818 3300013307 Bacteria 5540
170 Ga0157372_10126399 3300013307 Bacteria 2940
171 Ga0157372_10202512 3300013307 Bacteria 2299
172 Ga0157372_10223309 3300013307 Bacteria 2184
173 Ga0157372_10254212 3300013307 Bacteria 2040
174 Ga0157375_10011014 3300013308 Bacteria 7974
175 Ga0157375_10864127 3300013308 Unclassified 1050
176 Ga0163163_10001925 3300014325 Bacteria 17584
177 Ga0163163_10031249 3300014325 Bacteria 5139
178 Ga0163163_10186753 3300014325 Bacteria 2120
179 Ga0163163_10302180 3300014325 Bacteria 1653
180 Ga0163163_10322715 3300014325 Unclassified 1598
181 Ga0157379_10038884 3300014968 Unclassified 4244
182 Ga0157379_10457660 3300014968 Unclassified 1179
183 Ga0157376_10107685 3300014969 Unclassified 2447
184 Ga0157376_11119016 3300014969 Unclassified 814
185 Ga0213873_10023561 3300021358 Unclassified 1468
186 Ga0213872_10000704 3300021361 Bacteria 25147
187 Ga0213876_10005804 3300021384 Bacteria 6759
188 Ga0213875_10000004 3300021388 Bacteria 703388
189 Ga0213875_10001440 3300021388 Bacteria 15426
190 Ga0213875_10017993 3300021388 Unclassified 3410
191 Ga0213875_10026019 3300021388 Bacteria 2786
192 Ga0213875_10070290 3300021388 Bacteria 1634
193 Ga0213871_10023254 3300021441 Bacteria 1559
194 Ga0207654_10039781 3300025911 Unclassified 2647
195 Ga0207654_10073575 3300025911 Bacteria 2037
196 Ga0207654_10117088 3300025911 Bacteria 1667
197 Ga0207654_10196148 3300025911 Unclassified 1326
198 Ga0207707_10005556 3300025912 Bacteria 11028
199 Ga0207707_10010116 3300025912 Bacteria 8186
200 Ga0207707_10012333 3300025912 Bacteria 7427
201 Ga0207707_10151287 3300025912 Unclassified 2029
202 Ga0207707_10163387 3300025912 Unclassified 1946
203 Ga0207695_10003415 3300025913 Bacteria 22413
204 Ga0207695_10003446 3300025913 Bacteria 22305
205 Ga0207695_10004563 3300025913 Bacteria 18831
206 Ga0207695_10006718 3300025913 Bacteria 14848
207 Ga0207695_10010994 3300025913 Bacteria 10997
208 Ga0207695_10173230 3300025913 Bacteria 2082
209 Ga0207695_10316738 3300025913 Unclassified 1450
210 Ga0207695_10451278 3300025913 Bacteria 1169
211 Ga0207695_10702217 3300025913 Bacteria 892
212 Ga0207671_10004753 3300025914 Bacteria 12822
213 Ga0207671_10017624 3300025914 Bacteria 5499
214 Ga0207671_10030931 3300025914 Bacteria 3991
215 Ga0207671_10126369 3300025914 Bacteria 1959
216 Ga0207671_10132200 3300025914 Bacteria 1916
217 Ga0207693_10258044 3300025915 Bacteria 1367
218 Ga0207660_10002592 3300025917 Bacteria 11852
219 Ga0207657_10007790 3300025919 Bacteria 10933
220 Ga0207657_10035428 3300025919 Bacteria 4476
221 Ga0207657_10059844 3300025919 Bacteria 3270
222 Ga0207657_10072376 3300025919 Unclassified 2916
223 Ga0207652_10005092 3300025921 Bacteria 10666
224 Ga0207652_10255402 3300025921 Unclassified 1581
225 Ga0207652_10432808 3300025921 Bacteria 1186
226 Ga0207694_10019682 3300025924 Bacteria 5106
227 Ga0207694_10044592 3300025924 Bacteria 3424
228 Ga0207694_10107322 3300025924 Bacteria 2218
229 Ga0207687_10009609 3300025927 Bacteria 6322
230 Ga0207687_10130477 3300025927 Unclassified 1893
231 Ga0207687_10551852 3300025927 Unclassified 967
232 Ga0207700_10334995 3300025928 Bacteria 1314
233 Ga0207644_10051709 3300025931 Bacteria 2950
234 Ga0207690_10271095 3300025932 Unclassified 1318
235 Ga0207706_10051574 3300025933 Bacteria 3632
236 Ga0207706_10611222 3300025933 Unclassified 936
237 Ga0207686_10013836 3300025934 Bacteria 4475
238 Ga0207686_10023205 3300025934 Bacteria 3581
239 Ga0207686_10043848 3300025934 Unclassified 2743
240 Ga0207686_10061874 3300025934 Unclassified 2375
241 Ga0207709_10279346 3300025935 Bacteria 1233
242 Ga0207670_10185060 3300025936 Unclassified 1571
243 Ga0207670_10231945 3300025936 Bacteria 1418
244 Ga0207704_10008779 3300025938 Bacteria 4851
245 Ga0207691_10327294 3300025940 Bacteria 1313
246 Ga0207711_10022970 3300025941 Bacteria 5221
247 Ga0207711_10218757 3300025941 Unclassified 1741
248 Ga0207689_10056729 3300025942 Unclassified 3223
249 Ga0207689_10117293 3300025942 Unclassified 2189
250 Ga0207661_10003068 3300025944 Bacteria 11563
251 Ga0207661_10004310 3300025944 Bacteria 9958
252 Ga0207661_10123234 3300025944 Unclassified 2210
253 Ga0207661_10239166 3300025944 Bacteria 1610
254 Ga0207661_10483619 3300025944 Bacteria 1130
255 Ga0207679_10087605 3300025945 Bacteria 2398
256 Ga0207679_10388886 3300025945 Unclassified 1224
257 Ga0207667_10003885 3300025949 Bacteria 18377
258 Ga0207667_10016828 3300025949 Bacteria 8249
259 Ga0207667_10021050 3300025949 Bacteria 7233
260 Ga0207667_10034218 3300025949 Bacteria 5458
261 Ga0207667_10064025 3300025949 Bacteria 3840
262 Ga0207667_10508497 3300025949 Unclassified 1221
263 Ga0207651_10007331 3300025960 Bacteria 5866
264 Ga0207651_10312962 3300025960 Bacteria 1310
265 Ga0207712_10088649 3300025961 Unclassified 2272
266 Ga0207640_10045071 3300025981 Unclassified 2830
267 Ga0207658_10093635 3300025986 Bacteria 2336
268 Ga0207677_10063629 3300026023 Unclassified 2565
269 Ga0207703_10013164 3300026035 Bacteria 6445
270 Ga0207703_10093503 3300026035 Bacteria 2532
271 Ga0207703_10295029 3300026035 Bacteria 1477
272 Ga0207703_10819205 3300026035 Unclassified 889
273 Ga0207639_10153124 3300026041 Bacteria 1934
274 Ga0207639_10171929 3300026041 Unclassified 1836
275 Ga0207639_10429638 3300026041 Unclassified 1196
276 Ga0207678_10019028 3300026067 Bacteria 6032
277 Ga0207702_10007992 3300026078 Bacteria 8962
278 Ga0207702_10012259 3300026078 Bacteria 7135
279 Ga0207702_10017551 3300026078 Bacteria 5920
280 Ga0207702_10230248 3300026078 Bacteria 1731
281 Ga0207702_10405411 3300026078 Bacteria 1316
282 Ga0207641_10016731 3300026088 Bacteria 6006
283 Ga0207641_10034011 3300026088 Unclassified 4237
284 Ga0207648_10027337 3300026089 Bacteria 5065
285 Ga0207648_10171367 3300026089 Bacteria 1919
286 Ga0207648_10176136 3300026089 Bacteria 1892
287 Ga0207674_10000915 3300026116 Bacteria 38455
288 Ga0207674_10003947 3300026116 Bacteria 18047
289 Ga0207674_10005826 3300026116 Bacteria 14616
290 Ga0207675_100129571 3300026118 Unclassified 2392
291 Ga0207683_10225673 3300026121 Bacteria 1708
292 Ga0207683_10597666 3300026121 Unclassified 1021
293 Ga0207698_10024026 3300026142 Bacteria 4270
294 Ga0207698_10216808 3300026142 Bacteria 1726
295 Ga0207698_10574125 3300026142 Bacteria 1108
296 Ga0268266_10022435 3300028379 Bacteria 5380
297 Ga0268264_10012982 3300028381 Bacteria 6849
298 Ga0265319_1117750 3300028563 Unclassified 829
299 Ga0265338_10033347 3300028800 Bacteria 4999
300 Ga0265328_10065157 3300031239 Unclassified 1338
301 Ga0265320_10049498 3300031240 Unclassified 2045
302 Ga0265325_10145637 3300031241 Bacteria 1124
303 Ga0265340_10061877 3300031247 Unclassified 1789
304 Ga0265331_10023979 3300031250 Bacteria 3092
305 Ga0265316_10155125 3300031344 Unclassified 1713
306 Ga0265316_10299627 3300031344 Bacteria 1171
307 Ga0265313_10018023 3300031595 Bacteria 3982
308 Ga0307414_10876280 3300032004 Unclassified 822
309 Ga0373953_0026420 3300035117 Unclassified 2224
310 Ga0373955_0012758 3300035172 Bacteria 4048
311 Ga0373931_0139462 3300035691 Unclassified 1403
312 Ga0373935_0093105 3300035692 Unclassified 1976
313 Ga0373927_0002927 3300035695 Bacteria 12410
314 Ga0373933_0054632 3300035724 Bacteria 2394
315 Ga0373947_0012439 3300035725 Unclassified 4876
316 Ga0373937_0008070 3300036401 Bacteria 9135
317 Ga0373925_0000718 3300037068 Bacteria 30791
318 Ga0373925_0329003 3300037068 Unclassified 1238
319 Ga0395899_0201879 3300037312 Bacteria 1386
320 Ga0436364_0154432 3300037853 Bacteria 4740
321 Ga0436364_0290533 3300037853 Bacteria 5607
322 Ga0436364_0571917 3300037853 Bacteria 5120
323 Ga0436364_0586366 3300037853 Bacteria 11130
324 Ga0436364_0590659 3300037853 Bacteria 7718
325 Ga0436364_0653997 3300037853 Bacteria 10947
326 Ga0436364_0685938 3300037853 Unclassified 4966
327 Ga0436364_0748068 3300037853 Bacteria 528910
328 Ga0436364_0910171 3300037853 Unclassified 1279
329 Ga0436364_0928289 3300037853 Bacteria 3651
330 Ga0436364_0980386 3300037853 Bacteria 12527
331 Ga0436364_1202601 3300037853 Bacteria 2953
332 Ga0436364_1528714 3300037853 Bacteria 88642
333 Ga0436365_0958697 3300039437 Bacteria 5536
334 Ga0436365_1031452 3300039437 Bacteria 6167
335 Ga0436365_1260596 3300039437 Unclassified 1585
336 Ga0436365_1599095 3300039437 Bacteria 3488
337 Ga0436365_1663992 3300039437 Bacteria 1815
338 Ga0436365_1678616 3300039437 Unclassified 3165
339 Ga0436365_1765511 3300039437 Unclassified 1352
340 Ga0436360_0186791 3300039438 Bacteria 7010
341 Ga0436361_0786779 3300039447 Bacteria 144856
342 Ga0436361_0798686 3300039447 Bacteria 4080
343 Ga0436363_0109567 3300039450 Bacteria 1642
344 Ga0436363_0728437 3300039450 Unclassified 1502
345 Ga0436363_0797391 3300039450 Bacteria 5044
346 Ga0436363_0991515 3300039450 Bacteria 1115
347 Ga0436363_1446836 3300039450 Bacteria 2550
348 Ga0436363_1575260 3300039450 Bacteria 4506
349 Ga0436362_0204560 3300039453 Bacteria 1464
350 Ga0436362_1249848 3300039453 Bacteria 2566
351 Ga0451577_0432764 3300042876 Bacteria 1195
352 Ga0453684_0342742 3300044712 Bacteria 1687
353 Ga0453684_0395022 3300044712 Unclassified 1550
354 Ga0466967_0222018 3300045976 Bacteria 1796
355 Ga0495580_0028873 3300046472 Bacteria 4030
356 Ga0495628_0259705 3300046516 Unclassified 1295
357 Ga0495652_0118793 3300046529 Bacteria 2112
358 Ga0495587_0001238 3300046536 Bacteria 16943
359 Ga0495667_0125046 3300046559 Bacteria 1660
360 Ga0495599_0010834 3300046678 Bacteria 5588
361 Ga0495674_0194710 3300047319 Bacteria 1684
362 Ga0495602_0011586 3300048088 Bacteria 9112
363 Ga0496104_0246765 3300048907 Bacteria 1698
364 Ga0496113_0102998 3300048916 Bacteria 2214
365 Ga0496115_0068844 3300048918 Unclassified 2866
366 Ga0496115_0101174 3300048918 Bacteria 2363
367 Ga0501034_0259182 3300049571 Bacteria 1682
368 Ga0501040_0161717 3300049576 Unclassified 1583
369 Ga0501043_0020096 3300049579 Bacteria 5242
370 Ga0501047_0001793 3300049581 Bacteria 20780
371 Ga0501048_0162690 3300049582 Unclassified 1580
372 Ga0501070_0017566 3300049586 Bacteria 6004
373 Ga0501073_0053030 3300049589 Unclassified 2839
374 Ga0501247_005958 3300049677 Bacteria 1370
375 Ga0501249_047613 3300049679 Unclassified 981
376 Ga0501035_0005640 3300049822 Bacteria 11819
377 Ga0501044_0000665 3300049823 Bacteria 41466
378 Ga0501044_0056877 3300049823 Unclassified 4015
379 nmdc:mga05p37_301630_c1 3300050507 Bacteria 1903
380 nmdc:mga06r32_109803_c1 3300050510 Bacteria 2713
381 nmdc:mga06r32_579968_c1 3300050510 Bacteria 1094
382 nmdc:mga0n895_186969_c1 3300050512 Bacteria 2102
383 nmdc:mga08x19_178584_c1 3300050514 Unclassified 1448
384 Ga0495601_0061066 3300053077 Unclassified 2393
385 Ga0500616_0128561 3300053153 Bacteria 1200

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005937 Ga0081455_10057610 Ga0081455_100576103 243
2 3300005458 Ga0070681_10033805 Ga0070681_100338055 245
3 3300005530 Ga0070679_100146473 Ga0070679_1001464732 245
4 3300014968 Ga0157379_10457660 Ga0157379_104576602 245
5 3300025912 Ga0207707_10010116 Ga0207707_100101168 245
6 3300028563 Ga0265319_1117750 Ga0265319_11177501 245
7 3300028800 Ga0265338_10033347 Ga0265338_100333472 245
8 3300031239 Ga0265328_10065157 Ga0265328_100651572 245
9 3300031240 Ga0265320_10049498 Ga0265320_100494983 245
10 3300031247 Ga0265340_10061877 Ga0265340_100618772 245
11 3300031250 Ga0265331_10023979 Ga0265331_100239794 245
12 3300031344 Ga0265316_10155125 Ga0265316_101551252 245
13 3300035724 Ga0373933_0054632 Ga0373933_0054632_1082_1819 245
14 3300036401 Ga0373937_0008070 Ga0373937_0008070_2278_3015 245
15 3300044712 Ga0453684_0395022 Ga0453684_0395022_104_841 245
16 3300046472 Ga0495580_0028873 Ga0495580_0028873_2622_3359 245
17 3300049576 Ga0501040_0161717 Ga0501040_0161717_145_882 245
18 3300049582 Ga0501048_0162690 Ga0501048_0162690_651_1388 245
19 3300050512 nmdc:mga0n895_186969_c1 nmdc:mga0n895_186969_c1_1283_2020 245
20 3300005467 Ga0070706_100441439 Ga0070706_1004414392 246
21 3300005440 Ga0070705_100406800 Ga0070705_1004068001 247
22 3300005546 Ga0070696_100001276 Ga0070696_1000012766 247
23 3300006028 Ga0070717_10318169 Ga0070717_103181692 247
24 3300006846 Ga0075430_100078032 Ga0075430_1000780322 247
25 3300006847 Ga0075431_100587038 Ga0075431_1005870381 247
26 3300009093 Ga0105240_10000274 Ga0105240_1000027438 247
27 3300009098 Ga0105245_10718891 Ga0105245_107188911 247
28 3300009177 Ga0105248_10788190 Ga0105248_107881902 247
29 3300025913 Ga0207695_10006718 Ga0207695_100067187 247
30 3300025914 Ga0207671_10126369 Ga0207671_101263692 247
31 3300025960 Ga0207651_10007331 Ga0207651_100073315 247
32 3300031344 Ga0265316_10299627 Ga0265316_102996271 247
33 3300035692 Ga0373935_0093105 Ga0373935_0093105_1064_1807 247
34 3300035695 Ga0373927_0002927 Ga0373927_0002927_77_820 247
35 3300035725 Ga0373947_0012439 Ga0373947_0012439_3985_4728 247
36 3300037068 Ga0373925_0000718 Ga0373925_0000718_9133_9876 247
37 3300037068 Ga0373925_0329003 Ga0373925_0329003_479_1222 247
38 3300050510 nmdc:mga06r32_109803_c1 nmdc:mga06r32_109803_c1_920_1663 247
39 3300050510 nmdc:mga06r32_579968_c1 nmdc:mga06r32_579968_c1_299_1045 247
40 3300005329 Ga0070683_100047987 Ga0070683_1000479873 248
41 3300005329 Ga0070683_100095672 Ga0070683_1000956722 248
42 3300005330 Ga0070690_100270639 Ga0070690_1002706392 248
43 3300005334 Ga0068869_100043994 Ga0068869_1000439942 248
44 3300005336 Ga0070680_100007516 Ga0070680_1000075165 248
45 3300005336 Ga0070680_100047647 Ga0070680_1000476474 248
46 3300005338 Ga0068868_100003605 Ga0068868_1000036055 248
47 3300005338 Ga0068868_100051415 Ga0068868_1000514152 248
48 3300005339 Ga0070660_100033302 Ga0070660_1000333025 248
49 3300005340 Ga0070689_100129953 Ga0070689_1001299532 248
50 3300005341 Ga0070691_10000214 Ga0070691_1000021414 248
51 3300005344 Ga0070661_100617295 Ga0070661_1006172951 248
52 3300005355 Ga0070671_100045767 Ga0070671_1000457672 248
53 3300005356 Ga0070674_100158306 Ga0070674_1001583062 248
54 3300005356 Ga0070674_100404608 Ga0070674_1004046082 248
55 3300005364 Ga0070673_100228307 Ga0070673_1002283072 248
56 3300005364 Ga0070673_100529977 Ga0070673_1005299772 248
57 3300005435 Ga0070714_100161854 Ga0070714_1001618542 248
58 3300005436 Ga0070713_100564563 Ga0070713_1005645632 248
59 3300005456 Ga0070678_100081934 Ga0070678_1000819343 248
60 3300005457 Ga0070662_100050339 Ga0070662_1000503392 248
61 3300005457 Ga0070662_100506014 Ga0070662_1005060142 248
62 3300005458 Ga0070681_10007075 Ga0070681_1000707512 248
63 3300005458 Ga0070681_10181643 Ga0070681_101816432 248
64 3300005458 Ga0070681_10199593 Ga0070681_101995932 248
65 3300005458 Ga0070681_10586107 Ga0070681_105861071 248
66 3300005459 Ga0068867_100014186 Ga0068867_1000141866 248
67 3300005459 Ga0068867_100361013 Ga0068867_1003610132 248
68 3300005459 Ga0068867_100366746 Ga0068867_1003667461 248
69 3300005530 Ga0070679_100002027 Ga0070679_1000020276 248
70 3300005535 Ga0070684_100003345 Ga0070684_10000334511 248
71 3300005535 Ga0070684_100025876 Ga0070684_1000258763 248
72 3300005535 Ga0070684_100054675 Ga0070684_1000546752 248
73 3300005535 Ga0070684_100110385 Ga0070684_1001103852 248
74 3300005539 Ga0068853_100017994 Ga0068853_1000179942 248
75 3300005539 Ga0068853_100098455 Ga0068853_1000984552 248
76 3300005539 Ga0068853_100177348 Ga0068853_1001773482 248
77 3300005539 Ga0068853_100833904 Ga0068853_1008339041 248
78 3300005547 Ga0070693_100146502 Ga0070693_1001465022 248
79 3300005548 Ga0070665_100041563 Ga0070665_1000415636 248
80 3300005563 Ga0068855_100005374 Ga0068855_1000053748 248
81 3300005563 Ga0068855_100093751 Ga0068855_1000937511 248
82 3300005563 Ga0068855_100110747 Ga0068855_1001107475 248
83 3300005563 Ga0068855_100122251 Ga0068855_1001222515 248
84 3300005563 Ga0068855_100380085 Ga0068855_1003800852 248
85 3300005564 Ga0070664_100110554 Ga0070664_1001105542 248
86 3300005564 Ga0070664_100219002 Ga0070664_1002190022 248
87 3300005577 Ga0068857_100006119 Ga0068857_1000061195 248
88 3300005577 Ga0068857_100006731 Ga0068857_1000067315 248
89 3300005578 Ga0068854_100064478 Ga0068854_1000644784 248
90 3300005578 Ga0068854_100291561 Ga0068854_1002915612 248
91 3300005614 Ga0068856_100005254 Ga0068856_1000052546 248
92 3300005614 Ga0068856_100024477 Ga0068856_1000244775 248
93 3300005614 Ga0068856_100026490 Ga0068856_1000264905 248
94 3300005614 Ga0068856_100028736 Ga0068856_1000287365 248
95 3300005614 Ga0068856_100114555 Ga0068856_1001145552 248
96 3300005614 Ga0068856_100203063 Ga0068856_1002030632 248
97 3300005614 Ga0068856_100334238 Ga0068856_1003342382 248
98 3300005615 Ga0070702_100415915 Ga0070702_1004159151 248
99 3300005616 Ga0068852_100026711 Ga0068852_1000267115 248
100 3300005616 Ga0068852_100066849 Ga0068852_1000668495 248
101 3300005616 Ga0068852_100075836 Ga0068852_1000758364 248
102 3300005616 Ga0068852_100700297 Ga0068852_1007002972 248
103 3300005616 Ga0068852_100750065 Ga0068852_1007500652 248
104 3300005617 Ga0068859_100256923 Ga0068859_1002569232 248
105 3300005617 Ga0068859_100365984 Ga0068859_1003659842 248
106 3300005617 Ga0068859_101001372 Ga0068859_1010013721 248
107 3300005618 Ga0068864_100704464 Ga0068864_1007044642 248
108 3300005618 Ga0068864_100773201 Ga0068864_1007732011 248
109 3300005718 Ga0068866_10102735 Ga0068866_101027352 248
110 3300005834 Ga0068851_10197585 Ga0068851_101975851 248
111 3300005841 Ga0068863_100024248 Ga0068863_1000242486 248
112 3300005841 Ga0068863_100175623 Ga0068863_1001756233 248
113 3300005842 Ga0068858_100052067 Ga0068858_1000520672 248
114 3300005842 Ga0068858_100372585 Ga0068858_1003725852 248
115 3300005842 Ga0068858_100694010 Ga0068858_1006940102 248
116 3300006175 Ga0070712_100263460 Ga0070712_1002634602 248
117 3300006237 Ga0097621_100093062 Ga0097621_1000930622 248
118 3300006237 Ga0097621_100093517 Ga0097621_1000935172 248
119 3300006237 Ga0097621_100203754 Ga0097621_1002037542 248
120 3300006358 Ga0068871_100141642 Ga0068871_1001416423 248
121 3300006358 Ga0068871_100162461 Ga0068871_1001624612 248
122 3300006358 Ga0068871_100305582 Ga0068871_1003055822 248
123 3300006358 Ga0068871_100311085 Ga0068871_1003110852 248
124 3300006881 Ga0068865_100355508 Ga0068865_1003555082 248
125 3300006931 Ga0097620_100256907 Ga0097620_1002569072 248
126 3300006931 Ga0097620_100365955 Ga0097620_1003659552 248
127 3300006931 Ga0097620_101001280 Ga0097620_1010012801 248
128 3300009093 Ga0105240_10005632 Ga0105240_100056323 248
129 3300009093 Ga0105240_10005942 Ga0105240_1000594216 248
130 3300009093 Ga0105240_10069474 Ga0105240_100694744 248
131 3300009093 Ga0105240_10182809 Ga0105240_101828092 248
132 3300009093 Ga0105240_10760934 Ga0105240_107609341 248
133 3300009093 Ga0105240_11034097 Ga0105240_110340971 248
134 3300009098 Ga0105245_10002804 Ga0105245_100028049 248
135 3300009098 Ga0105245_10045473 Ga0105245_100454734 248
136 3300009098 Ga0105245_10058861 Ga0105245_100588612 248
137 3300009098 Ga0105245_10158829 Ga0105245_101588293 248
138 3300009098 Ga0105245_10756967 Ga0105245_107569672 248
139 3300009147 Ga0114129_10240463 Ga0114129_102404634 248
140 3300009147 Ga0114129_10735203 Ga0114129_107352032 248
141 3300009148 Ga0105243_10041103 Ga0105243_100411031 248
142 3300009148 Ga0105243_10340790 Ga0105243_103407901 248
143 3300009174 Ga0105241_10032412 Ga0105241_100324125 248
144 3300009174 Ga0105241_10129777 Ga0105241_101297773 248
145 3300009174 Ga0105241_10151858 Ga0105241_101518582 248
146 3300009174 Ga0105241_10246362 Ga0105241_102463622 248
147 3300009174 Ga0105241_10351540 Ga0105241_103515402 248
148 3300009174 Ga0105241_10545104 Ga0105241_105451042 248
149 3300009176 Ga0105242_10007383 Ga0105242_100073833 248
150 3300009176 Ga0105242_10015770 Ga0105242_100157705 248
151 3300009176 Ga0105242_10087779 Ga0105242_100877793 248
152 3300009176 Ga0105242_10186646 Ga0105242_101866462 248
153 3300009177 Ga0105248_10015594 Ga0105248_100155945 248
154 3300009177 Ga0105248_10267260 Ga0105248_102672602 248
155 3300009177 Ga0105248_10301012 Ga0105248_103010122 248
156 3300009545 Ga0105237_10003496 Ga0105237_100034968 248
157 3300009545 Ga0105237_10010718 Ga0105237_100107186 248
158 3300009545 Ga0105237_10035245 Ga0105237_100352455 248
159 3300009545 Ga0105237_10215948 Ga0105237_102159482 248
160 3300009551 Ga0105238_10015766 Ga0105238_100157664 248
161 3300009551 Ga0105238_10053939 Ga0105238_100539394 248
162 3300009551 Ga0105238_10063316 Ga0105238_100633164 248
163 3300009551 Ga0105238_10089437 Ga0105238_100894374 248
164 3300009553 Ga0105249_10052490 Ga0105249_100524902 248
165 3300009553 Ga0105249_10146463 Ga0105249_101464633 248
166 3300009553 Ga0105249_10764441 Ga0105249_107644411 248
167 3300010375 Ga0105239_10003499 Ga0105239_100034998 248
168 3300010375 Ga0105239_10008368 Ga0105239_1000836812 248
169 3300010375 Ga0105239_10010268 Ga0105239_100102682 248
170 3300010375 Ga0105239_10010471 Ga0105239_100104712 248
171 3300010375 Ga0105239_10029514 Ga0105239_100295147 248
172 3300011119 Ga0105246_10027327 Ga0105246_100273273 248
173 3300011119 Ga0105246_10276501 Ga0105246_102765012 248
174 3300013100 Ga0157373_10174937 Ga0157373_101749372 248
175 3300013100 Ga0157373_10301711 Ga0157373_103017112 248
176 3300013102 Ga0157371_10212980 Ga0157371_102129801 248
177 3300013104 Ga0157370_10004678 Ga0157370_100046783 248
178 3300013104 Ga0157370_10005275 Ga0157370_1000527513 248
179 3300013104 Ga0157370_10019878 Ga0157370_100198787 248
180 3300013104 Ga0157370_10056645 Ga0157370_100566455 248
181 3300013104 Ga0157370_10086286 Ga0157370_100862862 248
182 3300013104 Ga0157370_10411429 Ga0157370_104114292 248
183 3300013105 Ga0157369_10000661 Ga0157369_1000066134 248
184 3300013105 Ga0157369_10027320 Ga0157369_100273205 248
185 3300013105 Ga0157369_10320831 Ga0157369_103208312 248
186 3300013296 Ga0157374_10006350 Ga0157374_100063509 248
187 3300013296 Ga0157374_10105378 Ga0157374_101053781 248
188 3300013296 Ga0157374_10227857 Ga0157374_102278573 248
189 3300013296 Ga0157374_10468162 Ga0157374_104681622 248
190 3300013297 Ga0157378_10015930 Ga0157378_100159309 248
191 3300013297 Ga0157378_10021049 Ga0157378_100210492 248
192 3300013297 Ga0157378_10102872 Ga0157378_101028723 248
193 3300013297 Ga0157378_10309606 Ga0157378_103096062 248
194 3300013306 Ga0163162_10022715 Ga0163162_100227157 248
195 3300013306 Ga0163162_10771011 Ga0163162_107710112 248
196 3300013307 Ga0157372_10034818 Ga0157372_100348185 248
197 3300013307 Ga0157372_10126399 Ga0157372_101263992 248
198 3300013307 Ga0157372_10202512 Ga0157372_102025122 248
199 3300013307 Ga0157372_10223309 Ga0157372_102233092 248
200 3300013307 Ga0157372_10254212 Ga0157372_102542122 248
201 3300013308 Ga0157375_10011014 Ga0157375_100110146 248
202 3300013308 Ga0157375_10864127 Ga0157375_108641271 248
203 3300014325 Ga0163163_10001925 Ga0163163_1000192512 248
204 3300014325 Ga0163163_10031249 Ga0163163_100312492 248
205 3300014325 Ga0163163_10186753 Ga0163163_101867533 248
206 3300014325 Ga0163163_10302180 Ga0163163_103021802 248
207 3300014325 Ga0163163_10322715 Ga0163163_103227152 248
208 3300014968 Ga0157379_10038884 Ga0157379_100388842 248
209 3300014969 Ga0157376_10107685 Ga0157376_101076852 248
210 3300014969 Ga0157376_11119016 Ga0157376_111190161 248
211 3300021358 Ga0213873_10023561 Ga0213873_100235612 248
212 3300021361 Ga0213872_10000704 Ga0213872_100007046 248
213 3300021384 Ga0213876_10005804 Ga0213876_100058042 248
214 3300021388 Ga0213875_10000004 Ga0213875_10000004427 248
215 3300021388 Ga0213875_10001440 Ga0213875_100014406 248
216 3300021388 Ga0213875_10017993 Ga0213875_100179932 248
217 3300021388 Ga0213875_10026019 Ga0213875_100260192 248
218 3300021388 Ga0213875_10070290 Ga0213875_100702902 248
219 3300021441 Ga0213871_10023254 Ga0213871_100232542 248
220 3300025911 Ga0207654_10039781 Ga0207654_100397813 248
221 3300025911 Ga0207654_10073575 Ga0207654_100735752 248
222 3300025911 Ga0207654_10117088 Ga0207654_101170882 248
223 3300025911 Ga0207654_10196148 Ga0207654_101961482 248
224 3300025912 Ga0207707_10005556 Ga0207707_100055565 248
225 3300025912 Ga0207707_10012333 Ga0207707_100123333 248
226 3300025912 Ga0207707_10151287 Ga0207707_101512872 248
227 3300025912 Ga0207707_10163387 Ga0207707_101633872 248
228 3300025913 Ga0207695_10003415 Ga0207695_1000341517 248
229 3300025913 Ga0207695_10003446 Ga0207695_1000344623 248
230 3300025913 Ga0207695_10004563 Ga0207695_1000456316 248
231 3300025913 Ga0207695_10010994 Ga0207695_100109947 248
232 3300025913 Ga0207695_10173230 Ga0207695_101732302 248
233 3300025913 Ga0207695_10316738 Ga0207695_103167381 248
234 3300025913 Ga0207695_10451278 Ga0207695_104512782 248
235 3300025913 Ga0207695_10702217 Ga0207695_107022172 248
236 3300025914 Ga0207671_10004753 Ga0207671_100047536 248
237 3300025914 Ga0207671_10017624 Ga0207671_100176246 248
238 3300025914 Ga0207671_10030931 Ga0207671_100309315 248
239 3300025914 Ga0207671_10132200 Ga0207671_101322002 248
240 3300025915 Ga0207693_10258044 Ga0207693_102580442 248
241 3300025917 Ga0207660_10002592 Ga0207660_100025927 248
242 3300025919 Ga0207657_10007790 Ga0207657_1000779010 248
243 3300025919 Ga0207657_10035428 Ga0207657_100354285 248
244 3300025919 Ga0207657_10059844 Ga0207657_100598445 248
245 3300025919 Ga0207657_10072376 Ga0207657_100723762 248
246 3300025921 Ga0207652_10005092 Ga0207652_1000509211 248
247 3300025921 Ga0207652_10255402 Ga0207652_102554022 248
248 3300025921 Ga0207652_10432808 Ga0207652_104328082 248
249 3300025924 Ga0207694_10019682 Ga0207694_100196822 248
250 3300025924 Ga0207694_10044592 Ga0207694_100445924 248
251 3300025924 Ga0207694_10107322 Ga0207694_101073222 248
252 3300025927 Ga0207687_10009609 Ga0207687_100096096 248
253 3300025927 Ga0207687_10130477 Ga0207687_101304772 248
254 3300025927 Ga0207687_10551852 Ga0207687_105518521 248
255 3300025928 Ga0207700_10334995 Ga0207700_103349952 248
256 3300025931 Ga0207644_10051709 Ga0207644_100517092 248
257 3300025932 Ga0207690_10271095 Ga0207690_102710952 248
258 3300025933 Ga0207706_10051574 Ga0207706_100515745 248
259 3300025933 Ga0207706_10611222 Ga0207706_106112222 248
260 3300025934 Ga0207686_10013836 Ga0207686_100138365 248
261 3300025934 Ga0207686_10023205 Ga0207686_100232054 248
262 3300025934 Ga0207686_10043848 Ga0207686_100438482 248
263 3300025934 Ga0207686_10061874 Ga0207686_100618742 248
264 3300025935 Ga0207709_10279346 Ga0207709_102793462 248
265 3300025936 Ga0207670_10185060 Ga0207670_101850602 248
266 3300025936 Ga0207670_10231945 Ga0207670_102319452 248
267 3300025938 Ga0207704_10008779 Ga0207704_100087795 248
268 3300025940 Ga0207691_10327294 Ga0207691_103272942 248
269 3300025941 Ga0207711_10022970 Ga0207711_100229703 248
270 3300025941 Ga0207711_10218757 Ga0207711_102187572 248
271 3300025942 Ga0207689_10056729 Ga0207689_100567292 248
272 3300025942 Ga0207689_10117293 Ga0207689_101172933 248
273 3300025944 Ga0207661_10003068 Ga0207661_100030683 248
274 3300025944 Ga0207661_10004310 Ga0207661_100043109 248
275 3300025944 Ga0207661_10123234 Ga0207661_101232342 248
276 3300025944 Ga0207661_10239166 Ga0207661_102391662 248
277 3300025944 Ga0207661_10483619 Ga0207661_104836192 248
278 3300025945 Ga0207679_10087605 Ga0207679_100876052 248
279 3300025945 Ga0207679_10388886 Ga0207679_103888862 248
280 3300025949 Ga0207667_10003885 Ga0207667_100038859 248
281 3300025949 Ga0207667_10016828 Ga0207667_100168287 248
282 3300025949 Ga0207667_10021050 Ga0207667_100210507 248
283 3300025949 Ga0207667_10034218 Ga0207667_100342185 248
284 3300025949 Ga0207667_10064025 Ga0207667_100640252 248
285 3300025949 Ga0207667_10508497 Ga0207667_105084972 248
286 3300025960 Ga0207651_10312962 Ga0207651_103129621 248
287 3300025961 Ga0207712_10088649 Ga0207712_100886493 248
288 3300025981 Ga0207640_10045071 Ga0207640_100450712 248
289 3300025986 Ga0207658_10093635 Ga0207658_100936353 248
290 3300026023 Ga0207677_10063629 Ga0207677_100636292 248
291 3300026035 Ga0207703_10013164 Ga0207703_100131643 248
292 3300026035 Ga0207703_10093503 Ga0207703_100935032 248
293 3300026035 Ga0207703_10295029 Ga0207703_102950292 248
294 3300026035 Ga0207703_10819205 Ga0207703_108192051 248
295 3300026041 Ga0207639_10153124 Ga0207639_101531242 248
296 3300026041 Ga0207639_10171929 Ga0207639_101719292 248
297 3300026041 Ga0207639_10429638 Ga0207639_104296382 248
298 3300026067 Ga0207678_10019028 Ga0207678_100190282 248
299 3300026078 Ga0207702_10007992 Ga0207702_100079926 248
300 3300026078 Ga0207702_10012259 Ga0207702_100122595 248
301 3300026078 Ga0207702_10017551 Ga0207702_100175515 248
302 3300026078 Ga0207702_10230248 Ga0207702_102302482 248
303 3300026078 Ga0207702_10405411 Ga0207702_104054111 248
304 3300026088 Ga0207641_10016731 Ga0207641_100167313 248
305 3300026088 Ga0207641_10034011 Ga0207641_100340112 248
306 3300026089 Ga0207648_10027337 Ga0207648_100273376 248
307 3300026089 Ga0207648_10171367 Ga0207648_101713672 248
308 3300026089 Ga0207648_10176136 Ga0207648_101761362 248
309 3300026116 Ga0207674_10000915 Ga0207674_1000091518 248
310 3300026116 Ga0207674_10003947 Ga0207674_1000394719 248
311 3300026116 Ga0207674_10005826 Ga0207674_100058266 248
312 3300026118 Ga0207675_100129571 Ga0207675_1001295713 248
313 3300026121 Ga0207683_10225673 Ga0207683_102256732 248
314 3300026121 Ga0207683_10597666 Ga0207683_105976662 248
315 3300026142 Ga0207698_10024026 Ga0207698_100240265 248
316 3300026142 Ga0207698_10216808 Ga0207698_102168082 248
317 3300026142 Ga0207698_10574125 Ga0207698_105741251 248
318 3300028379 Ga0268266_10022435 Ga0268266_100224353 248
319 3300028381 Ga0268264_10012982 Ga0268264_100129826 248
320 3300031241 Ga0265325_10145637 Ga0265325_101456371 248
321 3300031595 Ga0265313_10018023 Ga0265313_100180232 248
322 3300032004 Ga0307414_10876280 Ga0307414_108762801 248
323 3300035117 Ga0373953_0026420 Ga0373953_0026420_1116_1862 248
324 3300035172 Ga0373955_0012758 Ga0373955_0012758_401_1147 248
325 3300035691 Ga0373931_0139462 Ga0373931_0139462_547_1293 248
326 3300037312 Ga0395899_0201879 Ga0395899_0201879_441_1319 248
327 3300037853 Ga0436364_0154432 Ga0436364_0154432_1326_2078 248
328 3300037853 Ga0436364_0290533 Ga0436364_0290533_2595_3347 248
329 3300037853 Ga0436364_0571917 Ga0436364_0571917_2408_3160 248
330 3300037853 Ga0436364_0586366 Ga0436364_0586366_2498_3265 248
331 3300037853 Ga0436364_0590659 Ga0436364_0590659_5504_6256 248
332 3300037853 Ga0436364_0653997 Ga0436364_0653997_9174_9926 248
333 3300037853 Ga0436364_0685938 Ga0436364_0685938_2425_3177 248
334 3300037853 Ga0436364_0748068 Ga0436364_0748068_136876_137628 248
335 3300037853 Ga0436364_0910171 Ga0436364_0910171_460_1209 248
336 3300037853 Ga0436364_0928289 Ga0436364_0928289_1313_2065 248
337 3300037853 Ga0436364_0980386 Ga0436364_0980386_3456_4211 248
338 3300037853 Ga0436364_1202601 Ga0436364_1202601_1941_2693 248
339 3300037853 Ga0436364_1528714 Ga0436364_1528714_60337_61095 248
340 3300039437 Ga0436365_0958697 Ga0436365_0958697_3480_4232 248
341 3300039437 Ga0436365_1031452 Ga0436365_1031452_4401_5153 248
342 3300039437 Ga0436365_1260596 Ga0436365_1260596_722_1474 248
343 3300039437 Ga0436365_1599095 Ga0436365_1599095_1300_2052 248
344 3300039437 Ga0436365_1663992 Ga0436365_1663992_58_816 248
345 3300039437 Ga0436365_1678616 Ga0436365_1678616_1679_2431 248
346 3300039437 Ga0436365_1765511 Ga0436365_1765511_193_945 248
347 3300039438 Ga0436360_0186791 Ga0436360_0186791_4395_5144 248
348 3300039447 Ga0436361_0786779 Ga0436361_0786779_77051_77800 248
349 3300039447 Ga0436361_0798686 Ga0436361_0798686_2773_3537 248
350 3300039450 Ga0436363_0109567 Ga0436363_0109567_871_1617 248
351 3300039450 Ga0436363_0728437 Ga0436363_0728437_575_1327 248
352 3300039450 Ga0436363_0797391 Ga0436363_0797391_2886_3638 248
353 3300039450 Ga0436363_0991515 Ga0436363_0991515_62_820 248
354 3300039450 Ga0436363_1446836 Ga0436363_1446836_1222_1974 248
355 3300039450 Ga0436363_1575260 Ga0436363_1575260_1898_2650 248
356 3300039453 Ga0436362_0204560 Ga0436362_0204560_450_1202 248
357 3300039453 Ga0436362_1249848 Ga0436362_1249848_735_1487 248
358 3300042876 Ga0451577_0432764 Ga0451577_0432764_320_1066 248
359 3300044712 Ga0453684_0342742 Ga0453684_0342742_921_1667 248
360 3300045976 Ga0466967_0222018 Ga0466967_0222018_88_837 248
361 3300046516 Ga0495628_0259705 Ga0495628_0259705_330_1079 248
362 3300046529 Ga0495652_0118793 Ga0495652_0118793_812_1561 248
363 3300046536 Ga0495587_0001238 Ga0495587_0001238_5311_6060 248
364 3300046559 Ga0495667_0125046 Ga0495667_0125046_111_857 248
365 3300046678 Ga0495599_0010834 Ga0495599_0010834_743_1492 248
366 3300047319 Ga0495674_0194710 Ga0495674_0194710_264_1013 248
367 3300048088 Ga0495602_0011586 Ga0495602_0011586_4578_5327 248
368 3300048907 Ga0496104_0246765 Ga0496104_0246765_850_1596 248
369 3300048916 Ga0496113_0102998 Ga0496113_0102998_1129_1881 248
370 3300048918 Ga0496115_0068844 Ga0496115_0068844_379_1131 248
371 3300048918 Ga0496115_0101174 Ga0496115_0101174_208_954 248
372 3300049571 Ga0501034_0259182 Ga0501034_0259182_623_1372 248
373 3300049579 Ga0501043_0020096 Ga0501043_0020096_1436_2242 248
374 3300049581 Ga0501047_0001793 Ga0501047_0001793_13367_14173 248
375 3300049586 Ga0501070_0017566 Ga0501070_0017566_2407_3213 248
376 3300049589 Ga0501073_0053030 Ga0501073_0053030_1271_2077 248
377 3300049677 Ga0501247_005958 Ga0501247_005958_539_1285 248
378 3300049679 Ga0501249_047613 Ga0501249_047613_77_823 248
379 3300049822 Ga0501035_0005640 Ga0501035_0005640_10614_11420 248
380 3300049823 Ga0501044_0000665 Ga0501044_0000665_21302_22105 248
381 3300049823 Ga0501044_0056877 Ga0501044_0056877_2517_3323 248
382 3300050507 nmdc:mga05p37_301630_c1 nmdc:mga05p37_301630_c1_547_1293 248
383 3300050514 nmdc:mga08x19_178584_c1 nmdc:mga08x19_178584_c1_48_800 248
384 3300053077 Ga0495601_0061066 Ga0495601_0061066_1333_2079 248
385 3300053153 Ga0500616_0128561 Ga0500616_0128561_297_1043 248

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

21

168

0.97

PF00535

Glycos_transf_2

Glycosyl transferase family 2

77

193

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
7qi9-assembly1.cif.gz_B crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.2 in complex with udp 0.776 2 111
4y7g-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate-glucose (udp-glc) and glycerol 3-phosphate (g3p) - gpgs mn2+ udp-glc g3p 0.7748 2 107
4y9x-assembly1.cif.gz_A crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+, uridine-diphosphate-glucose (udp-glc) and phosphoglyceric acid (pga) - gpgs mn2+ udp-glc pga-3 0.7708 2 107
5jsx-assembly1.cif.gz_A-2 crystal structure of glucosyl-3-phosphoglycerate synthase from mycobacterium tuberculosis in complex with mn2+ and uridine-diphosphate-glucose (udp-glc) 0.7624 2 112
7qcp-assembly1.cif.gz_A crystal structure of mycobacterium hassiacum glucosyl-3-phosphoglycerate synthase at ph 7.2 - apo form 0.7575 2 112
ID Description Score Start End Superfamily
af_Q2FV58_23_231_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.8008 2 99 3.90.550.10
af_Q54XQ9_524_764_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7761 1 112 3.90.550.10
af_Q54GU8_58_380_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7648 1 98 3.90.550.10
af_P04161_1_214_3.40.50.170 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Formyl transferase, N-terminal domain 0.7639 4 55 3.40.50.170
af_Q08BD2_96_387_3.90.550.10 Alpha Beta;Alpha-Beta Complex;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A;Spore Coat Polysaccharide Biosynthesis Protein SpsA; Chain A 0.7627 4 95 3.90.550.10
ID Description Score Start End GO Terms
AF-A0A4Q3JUE4-F1-model_v4 deleted 0.9876 2 90
AF-A0A7V9C9F4-F1-model_v4 Glycosyltransferase family 2 protein 0.9769 1 164 GO:0016740
AF-A0A848UZZ6-F1-model_v4 Glycosyltransferase family 2 protein 0.9769 1 96 GO:0016740
AF-A0A0G0IMH9-F1-model_v4 Glycosyl transferase family 2 0.9736 1 79 GO:0016740
AF-A0A522JJQ1-F1-model_v4 Glycosyltransferase family 2 protein 0.9713 2 95 GO:0016740

Feature Viewer

pLDDT pTM Quality
87.04 0.77 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map