F430020

General Info

Members Datasets Scaffolds Average Seq Length
384 213 768 157

Family's Representative Sequence

Representative Sequence 3300049570|Ga0501033_0173121|Ga0501033_0173121_411_878
Length 155
Sequence MSAFLDTSVLVAGLIDFGPQSAPAQLVLHEVAEKRVTAPATAWHCCLEFFSVATRLPPEFRLTPGDAVQLLQDLLTRVGVYELPDTERLSMLRAAASDMITGGRIYDTHIAEIARAAGAEVVITDNRRHFLSALRYGMRVETPAEFLATLKRRKS

Samples

Sample ID Description Type Environment
1 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
11 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
17 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
21 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
22 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
23 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
24 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
25 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
26 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
27 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
38 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
39 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
40 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
43 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
44 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
45 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
46 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
47 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
54 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
55 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
56 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
57 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
58 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
59 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
60 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
61 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
62 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
63 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
64 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
65 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
66 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
84 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
115 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
118 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
119 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
120 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
121 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
122 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
123 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
124 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
125 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
126 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
127 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
128 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
129 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
130 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
131 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
132 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
133 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
134 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
135 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
136 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
137 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
140 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
141 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
142 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
143 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
144 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
145 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
146 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
147 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
150 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
151 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
152 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
153 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
159 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
160 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
161 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
162 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
163 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
164 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
165 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
166 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
167 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
168 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
169 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
170 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
171 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
174 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
177 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
178 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
182 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
183 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
184 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
185 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
186 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
187 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
188 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
189 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
190 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
191 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
192 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
193 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
196 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
197 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
198 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
199 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
200 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
201 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
202 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
203 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
204 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
205 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
206 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
207 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
208 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
209 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
210 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
211 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
212 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
213 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.08
Nodule 0
Rhizoplane 3.39
Rhizosphere 94.53
Stem 0
Stem Tuber 0
Unclassified 26.3

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501033_0173121 3300049570 Unclassified 1550
2 MBSR1b_contig_1236702 2162886012 Unclassified 924
3 Ga0065704_10715368 3300005289 Unclassified 555
4 Ga0065712_10099265 3300005290 Bacteria 2096
5 Ga0065715_10000196 3300005293 Bacteria 27388
6 Ga0065715_10135108 3300005293 Bacteria 1941
7 Ga0065715_10278320 3300005293 Unclassified 1093
8 Ga0065707_10001377 3300005295 Bacteria 8301
9 Ga0070676_10201878 3300005328 Bacteria 1304
10 Ga0070690_100411538 3300005330 Unclassified 995
11 Ga0070670_100011606 3300005331 Bacteria 7530
12 Ga0070670_100311830 3300005331 Bacteria 1377
13 Ga0070670_100769943 3300005331 Bacteria 868
14 Ga0070670_101370605 3300005331 Unclassified 648
15 Ga0070677_10149376 3300005333 Unclassified 1086
16 Ga0070680_100074460 3300005336 Bacteria 2794
17 Ga0070660_100297335 3300005339 Unclassified 1323
18 Ga0070687_100135130 3300005343 Bacteria 1429
19 Ga0070661_100250632 3300005344 Bacteria 1366
20 Ga0070675_100019852 3300005354 Bacteria 5360
21 Ga0070675_100520137 3300005354 Unclassified 1074
22 Ga0070671_100307420 3300005355 Bacteria 1350
23 Ga0070674_100797699 3300005356 Unclassified 815
24 Ga0070667_100146811 3300005367 Bacteria 2069
25 Ga0070713_100170840 3300005436 Bacteria 1948
26 Ga0070705_100457141 3300005440 Bacteria 959
27 Ga0070708_100089823 3300005445 Bacteria 2796
28 Ga0070708_101410674 3300005445 Bacteria 650
29 Ga0070663_100090331 3300005455 Bacteria 2268
30 Ga0070678_100486202 3300005456 Bacteria 1087
31 Ga0070681_10110899 3300005458 Bacteria 2683
32 Ga0070681_10237317 3300005458 Bacteria 1737
33 Ga0070681_10331939 3300005458 Bacteria 1430
34 Ga0068867_100377891 3300005459 Unclassified 1189
35 Ga0070685_10012895 3300005466 Bacteria 4399
36 Ga0070706_100387038 3300005467 Bacteria 1302
37 Ga0070707_100190289 3300005468 Bacteria 2001
38 Ga0070707_100291757 3300005468 Bacteria 1585
39 Ga0070707_100343463 3300005468 Bacteria 1450
40 Ga0070707_101437205 3300005468 Unclassified 656
41 Ga0070698_100886344 3300005471 Unclassified 838
42 Ga0070698_101087024 3300005471 Bacteria 748
43 Ga0070699_100134800 3300005518 Bacteria 2178
44 Ga0070699_100871434 3300005518 Bacteria 824
45 Ga0070684_100190121 3300005535 Bacteria 1868
46 Ga0070697_100274795 3300005536 Unclassified 1445
47 Ga0070672_100140633 3300005543 Bacteria 1991
48 Ga0070686_100490898 3300005544 Unclassified 951
49 Ga0070686_100515237 3300005544 Unclassified 930
50 Ga0070695_100647869 3300005545 Bacteria 834
51 Ga0070665_100973722 3300005548 Unclassified 861
52 Ga0070704_100090614 3300005549 Bacteria 2278
53 Ga0070704_100258606 3300005549 Bacteria 1433
54 Ga0070704_101291270 3300005549 Bacteria 668
55 Ga0070664_100211911 3300005564 Unclassified 1731
56 Ga0070664_100712822 3300005564 Unclassified 935
57 Ga0068857_100019463 3300005577 Bacteria 5962
58 Ga0068857_100350386 3300005577 Bacteria 1367
59 Ga0068857_100538638 3300005577 Unclassified 1099
60 Ga0068854_100855872 3300005578 Bacteria 796
61 Ga0068856_100086547 3300005614 Bacteria 3114
62 Ga0070702_100339274 3300005615 Unclassified 1054
63 Ga0070702_101739785 3300005615 Unclassified 519
64 Ga0068852_100486339 3300005616 Bacteria 1227
65 Ga0068852_100606679 3300005616 Unclassified 1099
66 Ga0068859_100114575 3300005617 Bacteria 2760
67 Ga0068859_100222857 3300005617 Bacteria 1974
68 Ga0068859_100296473 3300005617 Bacteria 1710
69 Ga0068859_102092955 3300005617 Bacteria 625
70 Ga0068864_100179099 3300005618 Bacteria 1937
71 Ga0068864_100503916 3300005618 Bacteria 1165
72 Ga0068866_10681564 3300005718 Unclassified 703
73 Ga0068866_11132181 3300005718 Bacteria 562
74 Ga0068861_100115281 3300005719 Bacteria 2159
75 Ga0068861_100883239 3300005719 Unclassified 845
76 Ga0068870_10178047 3300005840 Bacteria 1274
77 Ga0068863_100158973 3300005841 Bacteria 2164
78 Ga0068858_100874784 3300005842 Unclassified 878
79 Ga0068860_100107353 3300005843 Bacteria 2668
80 Ga0068860_100252858 3300005843 Bacteria 1717
81 Ga0068860_100474815 3300005843 Bacteria 1246
82 Ga0068860_101577768 3300005843 Unclassified 678
83 Ga0068862_100061448 3300005844 Bacteria 3230
84 Ga0068862_100350658 3300005844 Bacteria 1369
85 Ga0081539_10008089 3300005985 Bacteria 9303
86 Ga0081539_10121132 3300005985 Archaea 1299
87 Ga0070717_11170931 3300006028 Bacteria 700
88 Ga0075368_10023958 3300006042 Bacteria 2335
89 Ga0075432_10176071 3300006058 Unclassified 835
90 Ga0075362_10000228 3300006177 Bacteria 15674
91 Ga0075367_10005874 3300006178 Bacteria 6152
92 Ga0075366_10003831 3300006195 Bacteria 8010
93 Ga0075428_100000750 3300006844 Bacteria 33763
94 Ga0075428_100899309 3300006844 Bacteria 939
95 Ga0075428_101278170 3300006844 Unclassified 772
96 Ga0075430_100002347 3300006846 Bacteria 15724
97 Ga0075431_100021420 3300006847 Bacteria 6611
98 Ga0075431_100859345 3300006847 Bacteria 878
99 Ga0075433_10009021 3300006852 Bacteria 7965
100 Ga0075433_10292190 3300006852 Bacteria 1443
101 Ga0075433_10651655 3300006852 Bacteria 923
102 Ga0075434_100087241 3300006871 Bacteria 3121
103 Ga0075434_101664928 3300006871 Unclassified 646
104 Ga0075434_101895516 3300006871 Bacteria 602
105 Ga0068865_100858532 3300006881 Unclassified 787
106 Ga0075436_100175720 3300006914 Bacteria 1512
107 Ga0075436_100273143 3300006914 Bacteria 1207
108 Ga0097620_100114568 3300006931 Bacteria 2760
109 Ga0097620_100222852 3300006931 Bacteria 1974
110 Ga0097620_100296470 3300006931 Bacteria 1710
111 Ga0097620_102093158 3300006931 Bacteria 625
112 Ga0075435_100003201 3300007076 Bacteria 11083
113 Ga0075435_100012356 3300007076 Bacteria 6319
114 Ga0075435_100101017 3300007076 Bacteria 2390
115 Ga0075435_100126196 3300007076 Bacteria 2139
116 Ga0075435_101101761 3300007076 Bacteria 694
117 Ga0105240_11089497 3300009093 Bacteria 850
118 Ga0111539_10001025 3300009094 Bacteria 36662
119 Ga0111539_10083027 3300009094 Unclassified 3768
120 Ga0111539_10194718 3300009094 Bacteria 2364
121 Ga0105245_10021384 3300009098 Bacteria 5674
122 Ga0114129_10009633 3300009147 Bacteria 13783
123 Ga0114129_10011484 3300009147 Bacteria 12609
124 Ga0114129_10060556 3300009147 Bacteria 5293
125 Ga0114129_10079264 3300009147 Bacteria 4567
126 Ga0114129_10125407 3300009147 Bacteria 3531
127 Ga0114129_10253364 3300009147 Bacteria 2362
128 Ga0105243_10119848 3300009148 Bacteria 2216
129 Ga0105243_10781745 3300009148 Bacteria 939
130 Ga0105248_10336524 3300009177 Bacteria 1700
131 Ga0105248_10601821 3300009177 Bacteria 1240
132 Ga0105248_10855221 3300009177 Unclassified 1027
133 Ga0105249_10013919 3300009553 Bacteria 7112
134 Ga0105246_11514164 3300011119 Unclassified 630
135 Ga0105246_11571505 3300011119 Unclassified 620
136 Ga0105246_12056258 3300011119 Bacteria 552
137 Ga0157370_10163591 3300013104 Bacteria 2070
138 Ga0157374_10613600 3300013296 Unclassified 1098
139 Ga0157375_10571665 3300013308 Bacteria 1291
140 Ga0157375_11366949 3300013308 Unclassified 834
141 Ga0163163_10049136 3300014325 Bacteria 4150
142 Ga0157380_10878507 3300014326 Unclassified 921
143 Ga0157380_11303655 3300014326 Bacteria 773
144 Ga0157380_11420071 3300014326 Bacteria 745
145 Ga0157376_10681366 3300014969 Bacteria 1031
146 Ga0206356_10627622 3300020070 Bacteria 1515
147 Ga0206353_11737156 3300020082 Unclassified 2785
148 Ga0207697_10118684 3300025315 Unclassified 1137
149 Ga0207697_10295534 3300025315 Bacteria 718
150 Ga0207682_10219712 3300025893 Unclassified 879
151 Ga0207642_10523086 3300025899 Bacteria 729
152 Ga0207699_10013522 3300025906 Bacteria 4182
153 Ga0207643_10173914 3300025908 Bacteria 1301
154 Ga0207684_10360042 3300025910 Bacteria 1252
155 Ga0207707_10482934 3300025912 Bacteria 1058
156 Ga0207652_10825060 3300025921 Unclassified 822
157 Ga0207646_10168829 3300025922 Bacteria 1976
158 Ga0207646_10802757 3300025922 Bacteria 838
159 Ga0207646_10913463 3300025922 Bacteria 778
160 Ga0207646_11248639 3300025922 Bacteria 650
161 Ga0207681_10026380 3300025923 Bacteria 3747
162 Ga0207650_10603450 3300025925 Bacteria 923
163 Ga0207687_10065045 3300025927 Bacteria 2589
164 Ga0207700_10020049 3300025928 Bacteria 4531
165 Ga0207644_10056769 3300025931 Bacteria 2826
166 Ga0207644_11409713 3300025931 Bacteria 585
167 Ga0207706_10308680 3300025933 Unclassified 1378
168 Ga0207669_10508392 3300025937 Bacteria 965
169 Ga0207711_10389919 3300025941 Bacteria 1293
170 Ga0207689_10232092 3300025942 Unclassified 1525
171 Ga0207661_10253343 3300025944 Unclassified 1566
172 Ga0207661_11089900 3300025944 Unclassified 735
173 Ga0207679_10308494 3300025945 Unclassified 1366
174 Ga0207712_10259722 3300025961 Bacteria 1408
175 Ga0207678_10019816 3300026067 Bacteria 5914
176 Ga0207708_10129375 3300026075 Bacteria 1973
177 Ga0207702_11592050 3300026078 Bacteria 646
178 Ga0207676_11403630 3300026095 Bacteria 694
179 Ga0207674_10076100 3300026116 Bacteria 3365
180 Ga0207674_10560640 3300026116 Unclassified 1103
181 Ga0207674_10882586 3300026116 Unclassified 862
182 Ga0207675_100338031 3300026118 Bacteria 1473
183 Ga0207683_10131307 3300026121 Unclassified 2253
184 Ga0207683_10725280 3300026121 Bacteria 922
185 Ga0207698_10537828 3300026142 Bacteria 1143
186 Ga0209970_1035251 3300027614 Bacteria 879
187 Ga0207428_10085817 3300027907 Bacteria 2451
188 Ga0207428_10588585 3300027907 Bacteria 802
189 Ga0207428_10751579 3300027907 Unclassified 695
190 Ga0268264_11333941 3300028381 Unclassified 728
191 Ga0307408_100014784 3300031548 Bacteria 5189
192 Ga0307408_100309815 3300031548 Unclassified 1326
193 Ga0307408_100599650 3300031548 Bacteria 978
194 Ga0307405_10116999 3300031731 Unclassified 1816
195 Ga0307405_10561726 3300031731 Unclassified 925
196 Ga0307413_10004556 3300031824 Bacteria 6049
197 Ga0307410_10126852 3300031852 Bacteria 1869
198 Ga0307406_10142332 3300031901 Bacteria 1699
199 Ga0307406_10254543 3300031901 Bacteria 1325
200 Ga0307406_10324002 3300031901 Bacteria 1193
201 Ga0307407_10019615 3300031903 Unclassified 3447
202 Ga0307412_10020839 3300031911 Unclassified 3996
203 Ga0307412_10574827 3300031911 Bacteria 950
204 Ga0307412_10739231 3300031911 Bacteria 848
205 Ga0307412_11370227 3300031911 Bacteria 639
206 Ga0307409_100009050 3300031995 Bacteria 6092
207 Ga0307409_100420580 3300031995 Bacteria 1282
208 Ga0307409_101355448 3300031995 Bacteria 737
209 Ga0307409_102273668 3300031995 Unclassified 571
210 Ga0307416_100044934 3300032002 Unclassified 3473
211 Ga0307416_100052911 3300032002 Bacteria 3254
212 Ga0307416_100084065 3300032002 Bacteria 2703
213 Ga0307416_100405209 3300032002 Bacteria 1403
214 Ga0307416_100500018 3300032002 Bacteria 1280
215 Ga0307416_101990958 3300032002 Unclassified 684
216 Ga0307415_100028241 3300032126 Unclassified 3566
217 Ga0307415_101236517 3300032126 Bacteria 705
218 Ga0373926_0049681 3300035083 Unclassified 1511
219 Ga0373940_0208941 3300035088 Unclassified 644
220 Ga0373944_0106632 3300035089 Bacteria 952
221 Ga0373923_0303856 3300035111 Unclassified 755
222 Ga0373932_0045323 3300035112 Unclassified 1286
223 Ga0373956_0313304 3300035119 Unclassified 748
224 Ga0373943_0185479 3300035170 Bacteria 1145
225 Ga0373943_0656828 3300035170 Bacteria 620
226 Ga0373931_0243143 3300035691 Unclassified 1092
227 Ga0373933_0013664 3300035724 Bacteria 4503
228 Ga0373947_0297092 3300035725 Unclassified 1076
229 Ga0373947_0463070 3300035725 Bacteria 859
230 Ga0373937_0001867 3300036401 Bacteria 17709
231 Ga0373925_0105516 3300037068 Bacteria 2171
232 Ga0439439_0088410 3300041406 Bacteria 844
233 Ga0439433_0062692 3300041999 Bacteria 888
234 Ga0439445_0078758 3300042004 Bacteria 919
235 Ga0439449_0059614 3300042007 Bacteria 1409
236 Ga0450923_137886 3300042125 Bacteria 584
237 Ga0439435_0005070 3300042436 Bacteria 2877
238 Ga0439435_0107743 3300042436 Unclassified 862
239 Ga0439464_0149126 3300042439 Bacteria 731
240 Ga0450916_010716 3300042530 Bacteria 1150
241 Ga0453684_0117421 3300044712 Bacteria 3220
242 Ga0466967_0272548 3300045976 Bacteria 1622
243 Ga0495580_0381635 3300046472 Bacteria 952
244 Ga0495582_0214912 3300046473 Bacteria 1100
245 Ga0495639_0006129 3300046475 Bacteria 5169
246 Ga0495643_0012557 3300046522 Bacteria 5106
247 Ga0495586_0153326 3300046535 Bacteria 1297
248 Ga0495667_0109900 3300046559 Bacteria 1781
249 Ga0495647_0038016 3300046681 Unclassified 1819
250 Ga0495647_0267636 3300046681 Bacteria 764
251 Ga0495658_0286670 3300046683 Bacteria 1040
252 Ga0495669_0240781 3300046684 Unclassified 868
253 Ga0495669_0454711 3300046684 Bacteria 622
254 Ga0495674_0492512 3300047319 Bacteria 981
255 Ga0496101_0987854 3300048904 Unclassified 662
256 Ga0496102_0005888 3300048905 Bacteria 10433
257 Ga0496103_0254022 3300048906 Bacteria 1131
258 Ga0496104_0180017 3300048907 Unclassified 2024
259 Ga0496106_0050985 3300048909 Bacteria 3120
260 Ga0496107_0175727 3300048910 Bacteria 1590
261 Ga0496109_0183792 3300048912 Bacteria 1964
262 Ga0496109_0601465 3300048912 Bacteria 1036
263 Ga0496110_0110884 3300048913 Bacteria 2465
264 Ga0496111_0169683 3300048914 Unclassified 1621
265 Ga0496112_0060410 3300048915 Bacteria 3736
266 Ga0496112_0069230 3300048915 Bacteria 3486
267 Ga0496114_0424474 3300048917 Bacteria 1178
268 Ga0501031_0273618 3300049568 Bacteria 1096
269 Ga0501032_0191755 3300049569 Bacteria 1336
270 Ga0501032_0373761 3300049569 Bacteria 917
271 Ga0501036_0090691 3300049572 Unclassified 2582
272 Ga0501036_0625713 3300049572 Bacteria 892
273 Ga0501038_0011598 3300049574 Bacteria 8041
274 Ga0501038_0302979 3300049574 Bacteria 1254
275 Ga0501038_1008292 3300049574 Bacteria 611
276 Ga0501039_0026698 3300049575 Bacteria 4438
277 Ga0501039_0133158 3300049575 Bacteria 1951
278 Ga0501040_0049464 3300049576 Bacteria 2874
279 Ga0501040_0122886 3300049576 Bacteria 1822
280 Ga0501041_0238923 3300049577 Bacteria 1141
281 Ga0501041_0303510 3300049577 Bacteria 1006
282 Ga0501041_0658995 3300049577 Bacteria 669
283 Ga0501042_0187143 3300049578 Bacteria 1493
284 Ga0501042_0256073 3300049578 Bacteria 1263
285 Ga0501042_0319981 3300049578 Unclassified 1121
286 Ga0501043_0190957 3300049579 Unclassified 1593
287 Ga0501043_0576465 3300049579 Bacteria 833
288 Ga0501046_0004713 3300049580 Bacteria 12300
289 Ga0501046_0322131 3300049580 Bacteria 1126
290 Ga0501048_0082497 3300049582 Unclassified 2268
291 Ga0501048_0340267 3300049582 Bacteria 1069
292 Ga0501068_0006334 3300049584 Bacteria 6520
293 Ga0501069_0504489 3300049585 Bacteria 722
294 Ga0501071_0461318 3300049587 Unclassified 973
295 Ga0501071_0993612 3300049587 Bacteria 648
296 Ga0501072_0016396 3300049588 Bacteria 5687
297 Ga0501072_0720426 3300049588 Unclassified 783
298 Ga0501073_0191046 3300049589 Unclassified 1417
299 Ga0501074_0147023 3300049590 Bacteria 1685
300 Ga0501074_0182415 3300049590 Unclassified 1497
301 Ga0501074_0267000 3300049590 Bacteria 1216
302 Ga0501075_0004714 3300049591 Bacteria 9259
303 Ga0501075_0020310 3300049591 Bacteria 4830
304 Ga0501075_0021597 3300049591 Unclassified 4694
305 Ga0501075_0099683 3300049591 Bacteria 2206
306 Ga0501075_0178487 3300049591 Unclassified 1620
307 Ga0501075_0338988 3300049591 Bacteria 1146
308 Ga0501075_0542422 3300049591 Unclassified 888
309 Ga0501076_0012837 3300049592 Bacteria 6269
310 Ga0501076_0013409 3300049592 Bacteria 6146
311 Ga0501076_0016436 3300049592 Bacteria 5611
312 Ga0501076_0017435 3300049592 Bacteria 5458
313 Ga0501076_0037302 3300049592 Bacteria 3811
314 Ga0501076_0068265 3300049592 Bacteria 2840
315 Ga0501077_0002664 3300049593 Bacteria 10705
316 Ga0501077_0027301 3300049593 Unclassified 3626
317 Ga0501077_0223984 3300049593 Bacteria 1195
318 Ga0501079_0019472 3300049741 Bacteria 5184
319 Ga0501079_0030093 3300049741 Bacteria 4172
320 Ga0501079_0037325 3300049741 Bacteria 3745
321 Ga0501079_0058574 3300049741 Bacteria 2972
322 Ga0501080_0083922 3300049742 Bacteria 2960
323 Ga0501080_0134847 3300049742 Unclassified 2285
324 Ga0501080_0566024 3300049742 Bacteria 1011
325 Ga0501080_0567133 3300049742 Bacteria 1010
326 Ga0501080_0582889 3300049742 Bacteria 994
327 Ga0501081_0013855 3300049743 Bacteria 5305
328 Ga0501081_0102626 3300049743 Bacteria 2023
329 Ga0501081_0849692 3300049743 Unclassified 687
330 Ga0501083_0126962 3300049744 Bacteria 1672
331 Ga0501083_0220698 3300049744 Unclassified 1235
332 Ga0501035_0789462 3300049822 Unclassified 759
333 Ga0501045_0009966 3300049824 Bacteria 6647
334 Ga0501045_0010105 3300049824 Bacteria 6605
335 Ga0501045_0020563 3300049824 Bacteria 4717
336 Ga0501045_0088206 3300049824 Bacteria 2291
337 Ga0501045_0107862 3300049824 Bacteria 2064
338 Ga0501045_0612638 3300049824 Bacteria 806
339 nmdc:mga03n38_383875_c1 3300050490 Bacteria 770
340 nmdc:mga00v17_4081_c1 3300050491 Bacteria 7553
341 nmdc:mga0yw44_416854_c1 3300050492 Bacteria 909
342 nmdc:mga0k408_1720_c1 3300050493 Bacteria 11742
343 nmdc:mga05p37_220456_c1 3300050507 Bacteria 2289
344 nmdc:mga05p37_285399_c1 3300050507 Bacteria 1967
345 nmdc:mga05p37_310349_c1 3300050507 Bacteria 1870
346 nmdc:mga05p37_351066_c1 3300050507 Bacteria 1737
347 nmdc:mga05p37_50485_c1 3300050507 Bacteria 5116
348 nmdc:mga0qj67_201509_c1 3300050509 Unclassified 1617
349 nmdc:mga0qj67_208169_c1 3300050509 Bacteria 1589
350 nmdc:mga06r32_130912_c1 3300050510 Unclassified 2481
351 nmdc:mga06r32_244769_c1 3300050510 Bacteria 1781
352 nmdc:mga06r32_557170_c1 3300050510 Unclassified 1120
353 nmdc:mga06r32_750795_c1 3300050510 Bacteria 939
354 nmdc:mga08y16_152461_c1 3300050511 Bacteria 2402
355 nmdc:mga08y16_42511_c2 3300050511 Unclassified 4399
356 nmdc:mga08y16_560700_c1 3300050511 Unclassified 1155
357 nmdc:mga08y16_99019_c1 3300050511 Bacteria 3036
358 nmdc:mga0n895_1194425_c1 3300050512 Unclassified 735
359 nmdc:mga0n895_181807_c1 3300050512 Bacteria 2134
360 nmdc:mga0rr50_122674_c1 3300050513 Bacteria 2070
361 nmdc:mga0rr50_420283_c1 3300050513 Unclassified 1131
362 nmdc:mga0rr50_7629_c1 3300050513 Bacteria 6689
363 nmdc:mga08x19_31605_c1 3300050514 Bacteria 3331
364 nmdc:mga0a205_5144_c1 3300050515 Bacteria 11765
365 nmdc:mga0a205_619908_c1 3300050515 Bacteria 934
366 Ga0495595_0178591 3300053084 Unclassified 1052
367 Ga0495619_0095248 3300053085 Bacteria 2020
368 Ga0501084_0004687 3300054114 Bacteria 11167
369 Ga0501084_0012166 3300054114 Bacteria 7123
370 Ga0501084_0700150 3300054114 Bacteria 854
371 Ga0590071_006207 3300059421 Bacteria 2848
372 Ga0501082_0002318 3300060353 Bacteria 16651
373 Ga0501082_0026892 3300060353 Bacteria 4957
374 Ga0501082_0444821 3300060353 Unclassified 1132
375 Ga0501082_0829280 3300060353 Unclassified 809
376 Ga0501082_0934185 3300060353 Bacteria 759
377 Ga0501082_1478527 3300060353 Bacteria 593
378 Ga0530510_0059122 3300061734 Bacteria 2773
379 Ga0530510_0105171 3300061734 Unclassified 2065
380 Ga0530510_0191982 3300061734 Bacteria 1516
381 Ga0530510_0212582 3300061734 Bacteria 1437
382 Ga0530510_0248976 3300061734 Bacteria 1324
383 Ga0530510_0593734 3300061734 Bacteria 842
384 Ga0530510_0705496 3300061734 Bacteria 769
385 Ga0501033_0173121
386 MBSR1b_contig_1236702
387 Ga0065704_10715368
388 Ga0065712_10099265
389 Ga0065715_10000196
390 Ga0065715_10135108
391 Ga0065715_10278320
392 Ga0065707_10001377
393 Ga0070676_10201878
394 Ga0070690_100411538
395 Ga0070670_100011606
396 Ga0070670_100311830
397 Ga0070670_100769943
398 Ga0070670_101370605
399 Ga0070677_10149376
400 Ga0070680_100074460
401 Ga0070660_100297335
402 Ga0070687_100135130
403 Ga0070661_100250632
404 Ga0070675_100019852
405 Ga0070675_100520137
406 Ga0070671_100307420
407 Ga0070674_100797699
408 Ga0070667_100146811
409 Ga0070713_100170840
410 Ga0070705_100457141
411 Ga0070708_100089823
412 Ga0070708_101410674
413 Ga0070663_100090331
414 Ga0070678_100486202
415 Ga0070681_10110899
416 Ga0070681_10237317
417 Ga0070681_10331939
418 Ga0068867_100377891
419 Ga0070685_10012895
420 Ga0070706_100387038
421 Ga0070707_100190289
422 Ga0070707_100291757
423 Ga0070707_100343463
424 Ga0070707_101437205
425 Ga0070698_100886344
426 Ga0070698_101087024
427 Ga0070699_100134800
428 Ga0070699_100871434
429 Ga0070684_100190121
430 Ga0070697_100274795
431 Ga0070672_100140633
432 Ga0070686_100490898
433 Ga0070686_100515237
434 Ga0070695_100647869
435 Ga0070665_100973722
436 Ga0070704_100090614
437 Ga0070704_100258606
438 Ga0070704_101291270
439 Ga0070664_100211911
440 Ga0070664_100712822
441 Ga0068857_100019463
442 Ga0068857_100350386
443 Ga0068857_100538638
444 Ga0068854_100855872
445 Ga0068856_100086547
446 Ga0070702_100339274
447 Ga0070702_101739785
448 Ga0068852_100486339
449 Ga0068852_100606679
450 Ga0068859_100114575
451 Ga0068859_100222857
452 Ga0068859_100296473
453 Ga0068859_102092955
454 Ga0068864_100179099
455 Ga0068864_100503916
456 Ga0068866_10681564
457 Ga0068866_11132181
458 Ga0068861_100115281
459 Ga0068861_100883239
460 Ga0068870_10178047
461 Ga0068863_100158973
462 Ga0068858_100874784
463 Ga0068860_100107353
464 Ga0068860_100252858
465 Ga0068860_100474815
466 Ga0068860_101577768
467 Ga0068862_100061448
468 Ga0068862_100350658
469 Ga0081539_10008089
470 Ga0081539_10121132
471 Ga0070717_11170931
472 Ga0075368_10023958
473 Ga0075432_10176071
474 Ga0075362_10000228
475 Ga0075367_10005874
476 Ga0075366_10003831
477 Ga0075428_100000750
478 Ga0075428_100899309
479 Ga0075428_101278170
480 Ga0075430_100002347
481 Ga0075431_100021420
482 Ga0075431_100859345
483 Ga0075433_10009021
484 Ga0075433_10292190
485 Ga0075433_10651655
486 Ga0075434_100087241
487 Ga0075434_101664928
488 Ga0075434_101895516
489 Ga0068865_100858532
490 Ga0075436_100175720
491 Ga0075436_100273143
492 Ga0097620_100114568
493 Ga0097620_100222852
494 Ga0097620_100296470
495 Ga0097620_102093158
496 Ga0075435_100003201
497 Ga0075435_100012356
498 Ga0075435_100101017
499 Ga0075435_100126196
500 Ga0075435_101101761
501 Ga0105240_11089497
502 Ga0111539_10001025
503 Ga0111539_10083027
504 Ga0111539_10194718
505 Ga0105245_10021384
506 Ga0114129_10009633
507 Ga0114129_10011484
508 Ga0114129_10060556
509 Ga0114129_10079264
510 Ga0114129_10125407
511 Ga0114129_10253364
512 Ga0105243_10119848
513 Ga0105243_10781745
514 Ga0105248_10336524
515 Ga0105248_10601821
516 Ga0105248_10855221
517 Ga0105249_10013919
518 Ga0105246_11514164
519 Ga0105246_11571505
520 Ga0105246_12056258
521 Ga0157370_10163591
522 Ga0157374_10613600
523 Ga0157375_10571665
524 Ga0157375_11366949
525 Ga0163163_10049136
526 Ga0157380_10878507
527 Ga0157380_11303655
528 Ga0157380_11420071
529 Ga0157376_10681366
530 Ga0206356_10627622
531 Ga0206353_11737156
532 Ga0207697_10118684
533 Ga0207697_10295534
534 Ga0207682_10219712
535 Ga0207642_10523086
536 Ga0207699_10013522
537 Ga0207643_10173914
538 Ga0207684_10360042
539 Ga0207707_10482934
540 Ga0207652_10825060
541 Ga0207646_10168829
542 Ga0207646_10802757
543 Ga0207646_10913463
544 Ga0207646_11248639
545 Ga0207681_10026380
546 Ga0207650_10603450
547 Ga0207687_10065045
548 Ga0207700_10020049
549 Ga0207644_10056769
550 Ga0207644_11409713
551 Ga0207706_10308680
552 Ga0207669_10508392
553 Ga0207711_10389919
554 Ga0207689_10232092
555 Ga0207661_10253343
556 Ga0207661_11089900
557 Ga0207679_10308494
558 Ga0207712_10259722
559 Ga0207678_10019816
560 Ga0207708_10129375
561 Ga0207702_11592050
562 Ga0207676_11403630
563 Ga0207674_10076100
564 Ga0207674_10560640
565 Ga0207674_10882586
566 Ga0207675_100338031
567 Ga0207683_10131307
568 Ga0207683_10725280
569 Ga0207698_10537828
570 Ga0209970_1035251
571 Ga0207428_10085817
572 Ga0207428_10588585
573 Ga0207428_10751579
574 Ga0268264_11333941
575 Ga0307408_100014784
576 Ga0307408_100309815
577 Ga0307408_100599650
578 Ga0307405_10116999
579 Ga0307405_10561726
580 Ga0307413_10004556
581 Ga0307410_10126852
582 Ga0307406_10142332
583 Ga0307406_10254543
584 Ga0307406_10324002
585 Ga0307407_10019615
586 Ga0307412_10020839
587 Ga0307412_10574827
588 Ga0307412_10739231
589 Ga0307412_11370227
590 Ga0307409_100009050
591 Ga0307409_100420580
592 Ga0307409_101355448
593 Ga0307409_102273668
594 Ga0307416_100044934
595 Ga0307416_100052911
596 Ga0307416_100084065
597 Ga0307416_100405209
598 Ga0307416_100500018
599 Ga0307416_101990958
600 Ga0307415_100028241
601 Ga0307415_101236517
602 Ga0373926_0049681
603 Ga0373940_0208941
604 Ga0373944_0106632
605 Ga0373923_0303856
606 Ga0373932_0045323
607 Ga0373956_0313304
608 Ga0373943_0185479
609 Ga0373943_0656828
610 Ga0373931_0243143
611 Ga0373933_0013664
612 Ga0373947_0297092
613 Ga0373947_0463070
614 Ga0373937_0001867
615 Ga0373925_0105516
616 Ga0439439_0088410
617 Ga0439433_0062692
618 Ga0439445_0078758
619 Ga0439449_0059614
620 Ga0450923_137886
621 Ga0439435_0005070
622 Ga0439435_0107743
623 Ga0439464_0149126
624 Ga0450916_010716
625 Ga0453684_0117421
626 Ga0466967_0272548
627 Ga0495580_0381635
628 Ga0495582_0214912
629 Ga0495639_0006129
630 Ga0495643_0012557
631 Ga0495586_0153326
632 Ga0495667_0109900
633 Ga0495647_0038016
634 Ga0495647_0267636
635 Ga0495658_0286670
636 Ga0495669_0240781
637 Ga0495669_0454711
638 Ga0495674_0492512
639 Ga0496101_0987854
640 Ga0496102_0005888
641 Ga0496103_0254022
642 Ga0496104_0180017
643 Ga0496106_0050985
644 Ga0496107_0175727
645 Ga0496109_0183792
646 Ga0496109_0601465
647 Ga0496110_0110884
648 Ga0496111_0169683
649 Ga0496112_0060410
650 Ga0496112_0069230
651 Ga0496114_0424474
652 Ga0501031_0273618
653 Ga0501032_0191755
654 Ga0501032_0373761
655 Ga0501036_0090691
656 Ga0501036_0625713
657 Ga0501038_0011598
658 Ga0501038_0302979
659 Ga0501038_1008292
660 Ga0501039_0026698
661 Ga0501039_0133158
662 Ga0501040_0049464
663 Ga0501040_0122886
664 Ga0501041_0238923
665 Ga0501041_0303510
666 Ga0501041_0658995
667 Ga0501042_0187143
668 Ga0501042_0256073
669 Ga0501042_0319981
670 Ga0501043_0190957
671 Ga0501043_0576465
672 Ga0501046_0004713
673 Ga0501046_0322131
674 Ga0501048_0082497
675 Ga0501048_0340267
676 Ga0501068_0006334
677 Ga0501069_0504489
678 Ga0501071_0461318
679 Ga0501071_0993612
680 Ga0501072_0016396
681 Ga0501072_0720426
682 Ga0501073_0191046
683 Ga0501074_0147023
684 Ga0501074_0182415
685 Ga0501074_0267000
686 Ga0501075_0004714
687 Ga0501075_0020310
688 Ga0501075_0021597
689 Ga0501075_0099683
690 Ga0501075_0178487
691 Ga0501075_0338988
692 Ga0501075_0542422
693 Ga0501076_0012837
694 Ga0501076_0013409
695 Ga0501076_0016436
696 Ga0501076_0017435
697 Ga0501076_0037302
698 Ga0501076_0068265
699 Ga0501077_0002664
700 Ga0501077_0027301
701 Ga0501077_0223984
702 Ga0501079_0019472
703 Ga0501079_0030093
704 Ga0501079_0037325
705 Ga0501079_0058574
706 Ga0501080_0083922
707 Ga0501080_0134847
708 Ga0501080_0566024
709 Ga0501080_0567133
710 Ga0501080_0582889
711 Ga0501081_0013855
712 Ga0501081_0102626
713 Ga0501081_0849692
714 Ga0501083_0126962
715 Ga0501083_0220698
716 Ga0501035_0789462
717 Ga0501045_0009966
718 Ga0501045_0010105
719 Ga0501045_0020563
720 Ga0501045_0088206
721 Ga0501045_0107862
722 Ga0501045_0612638
723 nmdc:mga03n38_383875_c1
724 nmdc:mga00v17_4081_c1
725 nmdc:mga0yw44_416854_c1
726 nmdc:mga0k408_1720_c1
727 nmdc:mga05p37_220456_c1
728 nmdc:mga05p37_285399_c1
729 nmdc:mga05p37_310349_c1
730 nmdc:mga05p37_351066_c1
731 nmdc:mga05p37_50485_c1
732 nmdc:mga0qj67_201509_c1
733 nmdc:mga0qj67_208169_c1
734 nmdc:mga06r32_130912_c1
735 nmdc:mga06r32_244769_c1
736 nmdc:mga06r32_557170_c1
737 nmdc:mga06r32_750795_c1
738 nmdc:mga08y16_152461_c1
739 nmdc:mga08y16_42511_c2
740 nmdc:mga08y16_560700_c1
741 nmdc:mga08y16_99019_c1
742 nmdc:mga0n895_1194425_c1
743 nmdc:mga0n895_181807_c1
744 nmdc:mga0rr50_122674_c1
745 nmdc:mga0rr50_420283_c1
746 nmdc:mga0rr50_7629_c1
747 nmdc:mga08x19_31605_c1
748 nmdc:mga0a205_5144_c1
749 nmdc:mga0a205_619908_c1
750 Ga0495595_0178591
751 Ga0495619_0095248
752 Ga0501084_0004687
753 Ga0501084_0012166
754 Ga0501084_0700150
755 Ga0590071_006207
756 Ga0501082_0002318
757 Ga0501082_0026892
758 Ga0501082_0444821
759 Ga0501082_0829280
760 Ga0501082_0934185
761 Ga0501082_1478527
762 Ga0530510_0059122
763 Ga0530510_0105171
764 Ga0530510_0191982
765 Ga0530510_0212582
766 Ga0530510_0248976
767 Ga0530510_0593734
768 Ga0530510_0705496

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13470

PIN_3

PIN domain

2

128

0.71

PF01850

PIN

PIN domain

3

134

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
7vwo-assembly3.cif.gz_I ta complex from mycobacterium tuberculosis 0.7185 4 145
1o4w-assembly1.cif.gz_A-2 crystal structure of a pin (pilt n-terminus) domain containing protein (af0591) from archaeoglobus fulgidus at 1.90 a resolution 0.7093 1 144
7vwo-assembly3.cif.gz_I ta complex from mycobacterium tuberculosis 0.7007 4 145
5ecw-assembly1.cif.gz_A structure of the shigella flexneri vapc mutant d7a 0.6893 1 145
5ecy-assembly1.cif.gz_H structure of the shigella flexneri vapc mutant d98n crystal form 2 0.6877 1 144
ID Description Score Start End Superfamily
af_P9WF61_2_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.732 5 137 3.40.50.1010
af_P9WF61_2_126_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.716 5 137 3.40.50.1010
af_P9WF85_2_140_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7151 5 143 3.40.50.1010
af_P9WFB3_1_135_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.712 4 145 3.40.50.1010
af_P9WF55_1_133_3.40.50.1010 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;5'-nuclease 0.7114 4 133 3.40.50.1010
ID Description Score Start End GO Terms
AF-A0A2V8BR09-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.8488 4 157 GO:0000287
GO:0004540
GO:0090729
AF-A0A3N5NJ09-F1-model_v4 PIN domain-containing protein 0.8473 3 154
AF-A0A355EUE9-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.8383 1 153 GO:0000287
GO:0004540
GO:0090729
AF-A0A843RZB5-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.8302 1 152 GO:0000287
GO:0004540
GO:0090729
AF-A0A7X8UDL6-F1-model_v4 Ribonuclease VapC (RNase VapC) (EC 3.1.-.-) (Toxin VapC) 0.8287 1 148 GO:0000287
GO:0004540
GO:0090729

Map