F429987

General Info

Members Datasets Scaffolds Average Seq Length
384 183 768 352

Family's Representative Sequence

Representative Sequence 3300046475|Ga0495639_0008037|Ga0495639_0008037_2958_4028
Length 356
Sequence MRLCAGLLIFASLAAAQGKKNDESRKPLTLASQGSFFVGGESKTLAAVAGRGGVFGSPGEITINQMYVQFQIPPNGDRHVPVVMVHGCCLSSKTWETTPDGRMGWNEYFVRKDRPVYLADQASRARSGFDPSVISAVKAGTVPPSQLPNVLAATHQTAWSVFRFGPKFGEPFADGQFPIEAVDELYKQMIPDLNATLPNPNPTWKNMAALAVKVNGAVLMGHSESGFFPEQAALADPSAIPSIKGLISIEMPCPELQPAQIAMLAKIPTLVMFGDHLSDIPGGGPANWNASYESCQKFVQQMKDKGGDAEMMYLPKMGIKGNSHMLMQDRNNLQLADLILTWIDGHVESKKAAGKR

Samples

Sample ID Description Type Environment
1 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
52 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
53 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
56 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
57 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
66 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
67 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
68 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
69 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
70 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
71 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
72 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
73 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
79 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
80 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
87 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
88 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
89 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
90 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
91 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
92 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
93 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
94 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
142 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
153 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
154 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
161 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
164 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
165 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
166 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
169 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
170 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
173 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
174 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
175 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
178 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
179 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
180 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
181 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
182 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
183 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.56
Rhizosphere 97.4
Stem 0
Stem Tuber 0
Unclassified 14.58

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495639_0008037 3300046475 Bacteria 4529
2 JGI24746J21847_1003567 3300001977 Bacteria 2450
3 JGI25406J46586_10018228 3300003203 Bacteria 2888
4 Ga0058862_12708187 3300004803 Bacteria 1885
5 Ga0065714_10095591 3300005288 Bacteria 1783
6 Ga0065712_10000553 3300005290 Bacteria 13550
7 Ga0065715_10007355 3300005293 Bacteria 3830
8 Ga0065715_10181321 3300005293 Bacteria 1474
9 Ga0065707_10120822 3300005295 Bacteria 2124
10 Ga0065707_10121766 3300005295 Bacteria 2103
11 Ga0065707_10150909 3300005295 Bacteria 1655
12 Ga0070676_10004530 3300005328 Bacteria 7317
13 Ga0070676_10019294 3300005328 Bacteria 3792
14 Ga0070676_10031210 3300005328 Bacteria 3044
15 Ga0070690_100017819 3300005330 Bacteria 4280
16 Ga0070690_100082708 3300005330 Bacteria 2102
17 Ga0070690_100256412 3300005330 Bacteria 1239
18 Ga0070670_100010911 3300005331 Bacteria 7759
19 Ga0070670_100013919 3300005331 Bacteria 6898
20 Ga0070670_100014579 3300005331 Bacteria 6750
21 Ga0070677_10003804 3300005333 Bacteria 4889
22 Ga0070677_10019323 3300005333 Bacteria 2466
23 Ga0070677_10019609 3300005333 Bacteria 2453
24 Ga0068869_100022926 3300005334 Bacteria 4306
25 Ga0068869_100124164 3300005334 Bacteria 1978
26 Ga0070666_10009835 3300005335 Bacteria 5971
27 Ga0068868_100017351 3300005338 Bacteria 5361
28 Ga0068868_100098574 3300005338 Bacteria 2363
29 Ga0070660_100082531 3300005339 Bacteria 2524
30 Ga0070689_100010751 3300005340 Bacteria 6536
31 Ga0070689_100084488 3300005340 Bacteria 2495
32 Ga0070661_100006468 3300005344 Bacteria 8078
33 Ga0070661_100044735 3300005344 Bacteria 3235
34 Ga0070668_100055843 3300005347 Plasmid 3049
35 Ga0070669_100031883 3300005353 Bacteria 3807
36 Ga0070669_100148036 3300005353 Bacteria 1815
37 Ga0070669_100281725 3300005353 Unclassified 1332
38 Ga0070675_100000652 3300005354 Bacteria 23995
39 Ga0070675_100008348 3300005354 Bacteria 8036
40 Ga0070675_100022991 3300005354 Bacteria 4981
41 Ga0070675_100032087 3300005354 Bacteria 4248
42 Ga0070675_100058422 3300005354 Bacteria 3181
43 Ga0070675_100062365 3300005354 Bacteria 3080
44 Ga0070675_100077447 3300005354 Bacteria 2768
45 Ga0070675_100085697 3300005354 Unclassified 2632
46 Ga0070671_100004706 3300005355 Bacteria 10841
47 Ga0070671_100025275 3300005355 Unclassified 4872
48 Ga0070671_100073655 3300005355 Bacteria 2853
49 Ga0070671_100140382 3300005355 Bacteria 2039
50 Ga0070674_100002229 3300005356 Bacteria 10665
51 Ga0070674_100092045 3300005356 Unclassified 2191
52 Ga0070673_100003354 3300005364 Bacteria 9956
53 Ga0070673_100004182 3300005364 Bacteria 9105
54 Ga0070673_100011417 3300005364 Bacteria 6059
55 Ga0070673_100056929 3300005364 Bacteria 3087
56 Ga0070673_100068478 3300005364 Bacteria 2842
57 Ga0070673_100240117 3300005364 Unclassified 1575
58 Ga0070688_100020274 3300005365 Bacteria 3863
59 Ga0070688_100031464 3300005365 Bacteria 3192
60 Ga0070667_100012855 3300005367 Bacteria 6917
61 Ga0070667_100025418 3300005367 Unclassified 4923
62 Ga0070701_10055671 3300005438 Unclassified 2067
63 Ga0070705_100125902 3300005440 Unclassified 1663
64 Ga0070700_100187418 3300005441 Unclassified 1444
65 Ga0070694_100072156 3300005444 Bacteria 2381
66 Ga0070663_100283840 3300005455 Bacteria 1320
67 Ga0070678_100071450 3300005456 Bacteria 2598
68 Ga0070678_100236582 3300005456 Bacteria 1525
69 Ga0070678_100270602 3300005456 Bacteria 1432
70 Ga0070662_100024290 3300005457 Unclassified 4174
71 Ga0070681_10003585 3300005458 Bacteria 14558
72 Ga0068867_100001024 3300005459 Bacteria 19120
73 Ga0068867_100249733 3300005459 Bacteria 1442
74 Ga0068867_100314241 3300005459 Bacteria 1296
75 Ga0070685_10003653 3300005466 Bacteria 7804
76 Ga0070685_10037791 3300005466 Bacteria 2736
77 Ga0070685_10126628 3300005466 Unclassified 1592
78 Ga0070707_100005984 3300005468 Bacteria 11346
79 Ga0070699_100004802 3300005518 Bacteria 11943
80 Ga0070684_100063781 3300005535 Bacteria 3231
81 Ga0070684_100087251 3300005535 Bacteria 2770
82 Ga0068853_100438431 3300005539 Unclassified 1227
83 Ga0070672_100017439 3300005543 Bacteria 5168
84 Ga0070672_100034300 3300005543 Bacteria 3851
85 Ga0070672_100081590 3300005543 Unclassified 2593
86 Ga0070672_100125295 3300005543 Bacteria 2106
87 Ga0070686_100036185 3300005544 Plasmid 3055
88 Ga0070696_100127950 3300005546 Unclassified 1845
89 Ga0070665_100059497 3300005548 Bacteria 3830
90 Ga0070704_100041075 3300005549 Bacteria 3190
91 Ga0068855_100006084 3300005563 Bacteria 14714
92 Ga0068855_100011824 3300005563 Bacteria 10552
93 Ga0070664_100000492 3300005564 Bacteria 29880
94 Ga0070664_100024234 3300005564 Bacteria 5018
95 Ga0070664_100029137 3300005564 Bacteria 4601
96 Ga0070664_100034498 3300005564 Bacteria 4245
97 Ga0068857_100224937 3300005577 Bacteria 1715
98 Ga0068854_100144128 3300005578 Bacteria 1831
99 Ga0068856_100008072 3300005614 Bacteria 10275
100 Ga0070702_100195378 3300005615 Bacteria 1335
101 Ga0068859_100046378 3300005617 Unclassified 4364
102 Ga0068859_100066850 3300005617 Bacteria 3629
103 Ga0068859_100067309 3300005617 Bacteria 3616
104 Ga0068859_100116104 3300005617 Bacteria 2741
105 Ga0068864_100002489 3300005618 Bacteria 15223
106 Ga0068864_100046653 3300005618 Bacteria 3718
107 Ga0068864_100060815 3300005618 Unclassified 3270
108 Ga0068864_100290773 3300005618 Unclassified 1528
109 Ga0068866_10007041 3300005718 Bacteria 4700
110 Ga0068863_100005948 3300005841 Bacteria 11971
111 Ga0068863_100026662 3300005841 Bacteria 5510
112 Ga0068858_100023055 3300005842 Bacteria 5806
113 Ga0068858_100034635 3300005842 Bacteria 4684
114 Ga0068858_100047492 3300005842 Unclassified 3979
115 Ga0068858_100050257 3300005842 Bacteria 3858
116 Ga0068858_100057008 3300005842 Bacteria 3610
117 Ga0068860_100002099 3300005843 Bacteria 21005
118 Ga0068860_100022822 3300005843 Bacteria 6051
119 Ga0068860_100039674 3300005843 Bacteria 4504
120 Ga0068860_100098368 3300005843 Bacteria 2790
121 Ga0068860_100309853 3300005843 Unclassified 1548
122 Ga0068862_100003413 3300005844 Bacteria 13698
123 Ga0081539_10000464 3300005985 Bacteria 85930
124 Ga0081539_10001728 3300005985 Bacteria 34898
125 Ga0097621_100011693 3300006237 Bacteria 6478
126 Ga0097621_100026072 3300006237 Bacteria 4582
127 Ga0097621_100140978 3300006237 Unclassified 2060
128 Ga0068871_100051741 3300006358 Bacteria 3326
129 Ga0068871_100068234 3300006358 Bacteria 2919
130 Ga0068871_100100188 3300006358 Bacteria 2426
131 Ga0075428_100032412 3300006844 Bacteria 5772
132 Ga0075428_100063518 3300006844 Unclassified 4042
133 Ga0075428_100258773 3300006844 Bacteria 1874
134 Ga0075430_100019883 3300006846 Bacteria 5713
135 Ga0075431_100007755 3300006847 Bacteria 10691
136 Ga0075431_100195064 3300006847 Bacteria 2074
137 Ga0075433_10002365 3300006852 Bacteria 14336
138 Ga0075433_10003547 3300006852 Bacteria 12039
139 Ga0075433_10004935 3300006852 Bacteria 10447
140 Ga0075433_10097625 3300006852 Bacteria 2600
141 Ga0075433_10104827 3300006852 Bacteria 2505
142 Ga0075433_10223390 3300006852 Unclassified 1673
143 Ga0075434_100000516 3300006871 Bacteria 29363
144 Ga0075434_100004686 3300006871 Bacteria 12358
145 Ga0075434_100008850 3300006871 Bacteria 9370
146 Ga0075434_100052276 3300006871 Bacteria 4059
147 Ga0075434_100066668 3300006871 Bacteria 3586
148 Ga0075434_100417954 3300006871 Bacteria 1362
149 Ga0075429_100068088 3300006880 Bacteria 3098
150 Ga0075429_100233716 3300006880 Bacteria 1610
151 Ga0068865_100009035 3300006881 Bacteria 6165
152 Ga0097620_100046379 3300006931 Unclassified 4364
153 Ga0097620_100066853 3300006931 Bacteria 3629
154 Ga0097620_100067305 3300006931 Bacteria 3616
155 Ga0097620_100116109 3300006931 Bacteria 2741
156 Ga0075435_100013799 3300007076 Bacteria 6022
157 Ga0075435_100084156 3300007076 Bacteria 2616
158 Ga0105240_10009670 3300009093 Bacteria 13626
159 Ga0111539_10000150 3300009094 Bacteria 79163
160 Ga0111539_10041209 3300009094 Bacteria 5553
161 Ga0111539_10069520 3300009094 Bacteria 4158
162 Ga0111539_10075140 3300009094 Bacteria 3981
163 Ga0111539_10153129 3300009094 Unclassified 2699
164 Ga0111539_10320100 3300009094 Bacteria 1805
165 Ga0105245_10018833 3300009098 Bacteria 6040
166 Ga0105245_10071967 3300009098 Bacteria 3140
167 Ga0105245_10102288 3300009098 Bacteria 2653
168 Ga0114129_10000330 3300009147 Bacteria 55300
169 Ga0114129_10049153 3300009147 Bacteria 5927
170 Ga0114129_10145391 3300009147 Bacteria 3248
171 Ga0114129_10209893 3300009147 Bacteria 2633
172 Ga0114129_10364539 3300009147 Bacteria 1911
173 Ga0105243_10016558 3300009148 Bacteria 5575
174 Ga0105241_10092294 3300009174 Unclassified 2390
175 Ga0105248_10000121 3300009177 Bacteria 89807
176 Ga0105248_10002915 3300009177 Bacteria 18984
177 Ga0105248_10004514 3300009177 Bacteria 15398
178 Ga0105248_10064661 3300009177 Unclassified 4107
179 Ga0105248_10082420 3300009177 Bacteria 3617
180 Ga0105248_10214645 3300009177 Bacteria 2167
181 Ga0105238_10005456 3300009551 Bacteria 12564
182 Ga0105238_10174163 3300009551 Bacteria 2128
183 Ga0105249_10022225 3300009553 Bacteria 5681
184 Ga0105249_10382709 3300009553 Bacteria 1433
185 Ga0105239_10059219 3300010375 Bacteria 4203
186 Ga0157370_10002436 3300013104 Bacteria 22439
187 Ga0157369_10006115 3300013105 Bacteria 13970
188 Ga0157374_10050690 3300013296 Unclassified 3860
189 Ga0157378_10007616 3300013297 Bacteria 9452
190 Ga0163162_10000523 3300013306 Bacteria 35637
191 Ga0163162_10008477 3300013306 Bacteria 10030
192 Ga0157372_10344210 3300013307 Bacteria 1737
193 Ga0157375_10001362 3300013308 Bacteria 21089
194 Ga0157375_10002834 3300013308 Bacteria 15010
195 Ga0157375_10215279 3300013308 Bacteria 2079
196 Ga0157375_10561018 3300013308 Bacteria 1303
197 Ga0163163_10001162 3300014325 Bacteria 22395
198 Ga0163163_10011623 3300014325 Bacteria 7998
199 Ga0163163_10027352 3300014325 Bacteria 5462
200 Ga0163163_10246740 3300014325 Unclassified 1836
201 Ga0157380_10001086 3300014326 Bacteria 17488
202 Ga0157380_10017315 3300014326 Bacteria 5331
203 Ga0157380_10181368 3300014326 Bacteria 1850
204 Ga0157380_10192651 3300014326 Bacteria 1801
205 Ga0157377_10050943 3300014745 Bacteria 2334
206 Ga0157379_10000921 3300014968 Bacteria 23764
207 Ga0157379_10030047 3300014968 Bacteria 4833
208 Ga0157379_10090373 3300014968 Bacteria 2747
209 Ga0157379_10298275 3300014968 Bacteria 1468
210 Ga0157376_10506837 3300014969 Bacteria 1187
211 Ga0163161_10023056 3300017792 Bacteria 4386
212 Ga0163161_10055891 3300017792 Bacteria 2866
213 Ga0163161_10145772 3300017792 Unclassified 1796
214 Ga0213875_10022894 3300021388 Bacteria 2987
215 Ga0207697_10006987 3300025315 Bacteria 5062
216 Ga0207697_10085770 3300025315 Bacteria 1330
217 Ga0207682_10001725 3300025893 Bacteria 10019
218 Ga0207682_10005013 3300025893 Bacteria 5431
219 Ga0207682_10011423 3300025893 Bacteria 3467
220 Ga0207642_10024382 3300025899 Bacteria 2432
221 Ga0207688_10005050 3300025901 Bacteria 7180
222 Ga0207688_10208538 3300025901 Bacteria 1173
223 Ga0207680_10235629 3300025903 Bacteria 1259
224 Ga0207645_10003847 3300025907 Bacteria 11235
225 Ga0207645_10015457 3300025907 Bacteria 5068
226 Ga0207645_10154923 3300025907 Unclassified 1497
227 Ga0207645_10233383 3300025907 Unclassified 1215
228 Ga0207643_10035231 3300025908 Bacteria 2805
229 Ga0207643_10058910 3300025908 Bacteria 2190
230 Ga0207643_10198083 3300025908 Bacteria 1222
231 Ga0207654_10004807 3300025911 Bacteria 6841
232 Ga0207654_10056280 3300025911 Bacteria 2281
233 Ga0207707_10010321 3300025912 Bacteria 8103
234 Ga0207707_10194566 3300025912 Unclassified 1769
235 Ga0207695_10016168 3300025913 Bacteria 8750
236 Ga0207662_10002860 3300025918 Bacteria 8738
237 Ga0207662_10039592 3300025918 Bacteria 2766
238 Ga0207657_10050668 3300025919 Bacteria 3612
239 Ga0207649_10047623 3300025920 Bacteria 2640
240 Ga0207652_10117973 3300025921 Bacteria 2358
241 Ga0207681_10032211 3300025923 Bacteria 3431
242 Ga0207681_10089313 3300025923 Bacteria 2197
243 Ga0207681_10239181 3300025923 Bacteria 1412
244 Ga0207681_10299629 3300025923 Unclassified 1271
245 Ga0207650_10000510 3300025925 Bacteria 32441
246 Ga0207650_10015340 3300025925 Bacteria 5334
247 Ga0207650_10033423 3300025925 Bacteria 3725
248 Ga0207650_10287017 3300025925 Bacteria 1341
249 Ga0207659_10004025 3300025926 Bacteria 8869
250 Ga0207659_10008903 3300025926 Bacteria 6255
251 Ga0207659_10010259 3300025926 Bacteria 5879
252 Ga0207659_10030106 3300025926 Unclassified 3705
253 Ga0207659_10035635 3300025926 Bacteria 3441
254 Ga0207659_10066663 3300025926 Bacteria 2613
255 Ga0207687_10005071 3300025927 Bacteria 8720
256 Ga0207664_10106623 3300025929 Unclassified 2323
257 Ga0207644_10064608 3300025931 Bacteria 2659
258 Ga0207644_10070505 3300025931 Bacteria 2555
259 Ga0207706_10028865 3300025933 Bacteria 4952
260 Ga0207709_10003849 3300025935 Bacteria 8792
261 Ga0207670_10032295 3300025936 Bacteria 3365
262 Ga0207670_10193653 3300025936 Bacteria 1540
263 Ga0207669_10088071 3300025937 Bacteria 2012
264 Ga0207704_10002729 3300025938 Bacteria 7958
265 Ga0207704_10173853 3300025938 Bacteria 1548
266 Ga0207691_10012307 3300025940 Bacteria 8202
267 Ga0207691_10074526 3300025940 Bacteria 3061
268 Ga0207691_10084874 3300025940 Unclassified 2842
269 Ga0207711_10014535 3300025941 Bacteria 6543
270 Ga0207711_10122015 3300025941 Unclassified 2327
271 Ga0207711_10190124 3300025941 Bacteria 1871
272 Ga0207689_10003005 3300025942 Bacteria 15556
273 Ga0207661_10082419 3300025944 Bacteria 2659
274 Ga0207679_10007017 3300025945 Bacteria 7138
275 Ga0207679_10036814 3300025945 Bacteria 3474
276 Ga0207679_10121526 3300025945 Bacteria 2080
277 Ga0207667_10026159 3300025949 Bacteria 6380
278 Ga0207651_10017493 3300025960 Bacteria 4239
279 Ga0207651_10020778 3300025960 Unclassified 3971
280 Ga0207651_10052352 3300025960 Bacteria 2783
281 Ga0207651_10118057 3300025960 Unclassified 2006
282 Ga0207651_10185289 3300025960 Bacteria 1655
283 Ga0207712_10029626 3300025961 Bacteria 3674
284 Ga0207677_10030616 3300026023 Unclassified 3438
285 Ga0207677_10039917 3300026023 Bacteria 3090
286 Ga0207703_10046278 3300026035 Unclassified 3504
287 Ga0207703_10073576 3300026035 Bacteria 2827
288 Ga0207703_10167121 3300026035 Bacteria 1932
289 Ga0207703_10194829 3300026035 Bacteria 1797
290 Ga0207639_10410677 3300026041 Unclassified 1222
291 Ga0207678_10147294 3300026067 Bacteria 2009
292 Ga0207708_10043874 3300026075 Bacteria 3408
293 Ga0207708_10049944 3300026075 Bacteria 3185
294 Ga0207702_10014215 3300026078 Bacteria 6611
295 Ga0207702_10055051 3300026078 Bacteria 3373
296 Ga0207641_10001690 3300026088 Bacteria 21462
297 Ga0207641_10039147 3300026088 Unclassified 3964
298 Ga0207648_10000587 3300026089 Bacteria 40789
299 Ga0207648_10383671 3300026089 Bacteria 1271
300 Ga0207676_10010042 3300026095 Bacteria 6734
301 Ga0207676_10242542 3300026095 Unclassified 1617
302 Ga0207676_10269719 3300026095 Bacteria 1541
303 Ga0207674_10195185 3300026116 Bacteria 1974
304 Ga0207674_10217016 3300026116 Bacteria 1861
305 Ga0207675_100037277 3300026118 Bacteria 4536
306 Ga0207675_100265843 3300026118 Bacteria 1663
307 Ga0207683_10009197 3300026121 Bacteria 8419
308 Ga0207683_10031838 3300026121 Bacteria 4579
309 Ga0207683_10129634 3300026121 Bacteria 2268
310 Ga0207683_10305769 3300026121 Bacteria 1455
311 Ga0207698_10041836 3300026142 Bacteria 3419
312 Ga0209974_10019582 3300027876 Bacteria 2244
313 Ga0207428_10002949 3300027907 Bacteria 16836
314 Ga0207428_10011638 3300027907 Bacteria 7764
315 Ga0268265_10054691 3300028380 Bacteria 3030
316 Ga0268265_10105716 3300028380 Bacteria 2285
317 Ga0268264_10038860 3300028381 Unclassified 3929
318 Ga0268264_10187167 3300028381 Bacteria 1884
319 Ga0265338_10180092 3300028800 Bacteria 1612
320 Ga0265314_10000658 3300031711 Bacteria 42283
321 Ga0373934_0005209 3300035086 Bacteria 4810
322 Ga0373934_0055897 3300035086 Bacteria 1569
323 Ga0373954_0004986 3300035118 Bacteria 5734
324 Ga0373955_0089484 3300035172 Bacteria 1752
325 Ga0373937_0016792 3300036401 Bacteria 6508
326 Ga0373937_0039381 3300036401 Bacteria 4307
327 Ga0373937_0082766 3300036401 Bacteria 2969
328 Ga0373937_0186790 3300036401 Bacteria 1947
329 Ga0373925_0506108 3300037068 Bacteria 992
330 Ga0436364_0012709 3300037853 Bacteria 1183
331 Ga0436364_1289035 3300037853 Bacteria 14704
332 Ga0436365_0074144 3300039437 Bacteria 4269
333 Ga0439453_0004309 3300041408 Unclassified 2110
334 Ga0495592_0070037 3300046454 Unclassified 2556
335 Ga0495653_0179184 3300046463 Unclassified 1456
336 Ga0495580_0033745 3300046472 Bacteria 3686
337 Ga0495582_0018631 3300046473 Bacteria 3795
338 Ga0495608_0065470 3300046511 Bacteria 2380
339 Ga0495618_0113503 3300046514 Unclassified 1735
340 Ga0495586_0025868 3300046535 Unclassified 3140
341 Ga0495586_0116667 3300046535 Bacteria 1489
342 Ga0495587_0004553 3300046536 Bacteria 9106
343 Ga0495667_0002263 3300046559 Bacteria 12884
344 Ga0495667_0205962 3300046559 Bacteria 1258
345 Ga0495634_0010869 3300046642 Bacteria 6650
346 Ga0495659_0012790 3300046664 Bacteria 2725
347 Ga0495657_0001304 3300046675 Bacteria 21715
348 Ga0495613_0002244 3300046689 Bacteria 14608
349 Ga0495613_0072175 3300046689 Bacteria 2516
350 Ga0495636_0013778 3300047318 Bacteria 3210
351 Ga0495636_0099847 3300047318 Bacteria 1268
352 Ga0495675_0166136 3300047444 Bacteria 1357
353 Ga0495684_0015676 3300047471 Bacteria 5832
354 Ga0495684_0080840 3300047471 Bacteria 2467
355 Ga0495684_0122376 3300047471 Bacteria 1959
356 Ga0495602_0003418 3300048088 Bacteria 16412
357 Ga0496104_0141903 3300048907 Bacteria 2308
358 Ga0496104_0169574 3300048907 Bacteria 2093
359 Ga0496108_0072818 3300048911 Unclassified 2901
360 Ga0496109_0038753 3300048912 Unclassified 4311
361 Ga0496113_0211757 3300048916 Bacteria 1543
362 Ga0496115_0137182 3300048918 Bacteria 2017
363 nmdc:mga05p37_118806_c1 3300050507 Bacteria 3248
364 nmdc:mga05p37_240839_c1 3300050507 Unclassified 2175
365 nmdc:mga05p37_3762_c1 3300050507 Bacteria 17761
366 nmdc:mga05p37_58924_c1 3300050507 Bacteria 4729
367 nmdc:mga09592_28557_c1 3300050508 Bacteria 4634
368 nmdc:mga09592_43622_c1 3300050508 Bacteria 3773
369 nmdc:mga0qj67_80330_c1 3300050509 Unclassified 2612
370 nmdc:mga06r32_173682_c1 3300050510 Bacteria 2139
371 nmdc:mga06r32_75167_c1 3300050510 Bacteria 3278
372 nmdc:mga08y16_105838_c1 3300050511 Bacteria 2928
373 nmdc:mga08y16_1168_c1 3300050511 Bacteria 25884
374 nmdc:mga08y16_170086_c1 3300050511 Bacteria 2263
375 nmdc:mga08y16_170332_c1 3300050511 Unclassified 2262
376 nmdc:mga08y16_6027_c1 3300050511 Bacteria 12706
377 nmdc:mga08y16_64992_c1 3300050511 Bacteria 3808
378 nmdc:mga0n895_101456_c1 3300050512 Bacteria 2888
379 nmdc:mga0n895_13008_c1 3300050512 Bacteria 7486
380 nmdc:mga0n895_410186_c1 3300050512 Bacteria 1370
381 nmdc:mga0a205_17742_c1 3300050515 Bacteria 6680
382 nmdc:mga0a205_25026_c1 3300050515 Bacteria 5683
383 nmdc:mga0a205_46015_c1 3300050515 Unclassified 4208
384 nmdc:mga0a205_4890_c1 3300050515 Bacteria 12050
385 Ga0495639_0008037
386 JGI24746J21847_1003567
387 JGI25406J46586_10018228
388 Ga0058862_12708187
389 Ga0065714_10095591
390 Ga0065712_10000553
391 Ga0065715_10007355
392 Ga0065715_10181321
393 Ga0065707_10120822
394 Ga0065707_10121766
395 Ga0065707_10150909
396 Ga0070676_10004530
397 Ga0070676_10019294
398 Ga0070676_10031210
399 Ga0070690_100017819
400 Ga0070690_100082708
401 Ga0070690_100256412
402 Ga0070670_100010911
403 Ga0070670_100013919
404 Ga0070670_100014579
405 Ga0070677_10003804
406 Ga0070677_10019323
407 Ga0070677_10019609
408 Ga0068869_100022926
409 Ga0068869_100124164
410 Ga0070666_10009835
411 Ga0068868_100017351
412 Ga0068868_100098574
413 Ga0070660_100082531
414 Ga0070689_100010751
415 Ga0070689_100084488
416 Ga0070661_100006468
417 Ga0070661_100044735
418 Ga0070668_100055843
419 Ga0070669_100031883
420 Ga0070669_100148036
421 Ga0070669_100281725
422 Ga0070675_100000652
423 Ga0070675_100008348
424 Ga0070675_100022991
425 Ga0070675_100032087
426 Ga0070675_100058422
427 Ga0070675_100062365
428 Ga0070675_100077447
429 Ga0070675_100085697
430 Ga0070671_100004706
431 Ga0070671_100025275
432 Ga0070671_100073655
433 Ga0070671_100140382
434 Ga0070674_100002229
435 Ga0070674_100092045
436 Ga0070673_100003354
437 Ga0070673_100004182
438 Ga0070673_100011417
439 Ga0070673_100056929
440 Ga0070673_100068478
441 Ga0070673_100240117
442 Ga0070688_100020274
443 Ga0070688_100031464
444 Ga0070667_100012855
445 Ga0070667_100025418
446 Ga0070701_10055671
447 Ga0070705_100125902
448 Ga0070700_100187418
449 Ga0070694_100072156
450 Ga0070663_100283840
451 Ga0070678_100071450
452 Ga0070678_100236582
453 Ga0070678_100270602
454 Ga0070662_100024290
455 Ga0070681_10003585
456 Ga0068867_100001024
457 Ga0068867_100249733
458 Ga0068867_100314241
459 Ga0070685_10003653
460 Ga0070685_10037791
461 Ga0070685_10126628
462 Ga0070707_100005984
463 Ga0070699_100004802
464 Ga0070684_100063781
465 Ga0070684_100087251
466 Ga0068853_100438431
467 Ga0070672_100017439
468 Ga0070672_100034300
469 Ga0070672_100081590
470 Ga0070672_100125295
471 Ga0070686_100036185
472 Ga0070696_100127950
473 Ga0070665_100059497
474 Ga0070704_100041075
475 Ga0068855_100006084
476 Ga0068855_100011824
477 Ga0070664_100000492
478 Ga0070664_100024234
479 Ga0070664_100029137
480 Ga0070664_100034498
481 Ga0068857_100224937
482 Ga0068854_100144128
483 Ga0068856_100008072
484 Ga0070702_100195378
485 Ga0068859_100046378
486 Ga0068859_100066850
487 Ga0068859_100067309
488 Ga0068859_100116104
489 Ga0068864_100002489
490 Ga0068864_100046653
491 Ga0068864_100060815
492 Ga0068864_100290773
493 Ga0068866_10007041
494 Ga0068863_100005948
495 Ga0068863_100026662
496 Ga0068858_100023055
497 Ga0068858_100034635
498 Ga0068858_100047492
499 Ga0068858_100050257
500 Ga0068858_100057008
501 Ga0068860_100002099
502 Ga0068860_100022822
503 Ga0068860_100039674
504 Ga0068860_100098368
505 Ga0068860_100309853
506 Ga0068862_100003413
507 Ga0081539_10000464
508 Ga0081539_10001728
509 Ga0097621_100011693
510 Ga0097621_100026072
511 Ga0097621_100140978
512 Ga0068871_100051741
513 Ga0068871_100068234
514 Ga0068871_100100188
515 Ga0075428_100032412
516 Ga0075428_100063518
517 Ga0075428_100258773
518 Ga0075430_100019883
519 Ga0075431_100007755
520 Ga0075431_100195064
521 Ga0075433_10002365
522 Ga0075433_10003547
523 Ga0075433_10004935
524 Ga0075433_10097625
525 Ga0075433_10104827
526 Ga0075433_10223390
527 Ga0075434_100000516
528 Ga0075434_100004686
529 Ga0075434_100008850
530 Ga0075434_100052276
531 Ga0075434_100066668
532 Ga0075434_100417954
533 Ga0075429_100068088
534 Ga0075429_100233716
535 Ga0068865_100009035
536 Ga0097620_100046379
537 Ga0097620_100066853
538 Ga0097620_100067305
539 Ga0097620_100116109
540 Ga0075435_100013799
541 Ga0075435_100084156
542 Ga0105240_10009670
543 Ga0111539_10000150
544 Ga0111539_10041209
545 Ga0111539_10069520
546 Ga0111539_10075140
547 Ga0111539_10153129
548 Ga0111539_10320100
549 Ga0105245_10018833
550 Ga0105245_10071967
551 Ga0105245_10102288
552 Ga0114129_10000330
553 Ga0114129_10049153
554 Ga0114129_10145391
555 Ga0114129_10209893
556 Ga0114129_10364539
557 Ga0105243_10016558
558 Ga0105241_10092294
559 Ga0105248_10000121
560 Ga0105248_10002915
561 Ga0105248_10004514
562 Ga0105248_10064661
563 Ga0105248_10082420
564 Ga0105248_10214645
565 Ga0105238_10005456
566 Ga0105238_10174163
567 Ga0105249_10022225
568 Ga0105249_10382709
569 Ga0105239_10059219
570 Ga0157370_10002436
571 Ga0157369_10006115
572 Ga0157374_10050690
573 Ga0157378_10007616
574 Ga0163162_10000523
575 Ga0163162_10008477
576 Ga0157372_10344210
577 Ga0157375_10001362
578 Ga0157375_10002834
579 Ga0157375_10215279
580 Ga0157375_10561018
581 Ga0163163_10001162
582 Ga0163163_10011623
583 Ga0163163_10027352
584 Ga0163163_10246740
585 Ga0157380_10001086
586 Ga0157380_10017315
587 Ga0157380_10181368
588 Ga0157380_10192651
589 Ga0157377_10050943
590 Ga0157379_10000921
591 Ga0157379_10030047
592 Ga0157379_10090373
593 Ga0157379_10298275
594 Ga0157376_10506837
595 Ga0163161_10023056
596 Ga0163161_10055891
597 Ga0163161_10145772
598 Ga0213875_10022894
599 Ga0207697_10006987
600 Ga0207697_10085770
601 Ga0207682_10001725
602 Ga0207682_10005013
603 Ga0207682_10011423
604 Ga0207642_10024382
605 Ga0207688_10005050
606 Ga0207688_10208538
607 Ga0207680_10235629
608 Ga0207645_10003847
609 Ga0207645_10015457
610 Ga0207645_10154923
611 Ga0207645_10233383
612 Ga0207643_10035231
613 Ga0207643_10058910
614 Ga0207643_10198083
615 Ga0207654_10004807
616 Ga0207654_10056280
617 Ga0207707_10010321
618 Ga0207707_10194566
619 Ga0207695_10016168
620 Ga0207662_10002860
621 Ga0207662_10039592
622 Ga0207657_10050668
623 Ga0207649_10047623
624 Ga0207652_10117973
625 Ga0207681_10032211
626 Ga0207681_10089313
627 Ga0207681_10239181
628 Ga0207681_10299629
629 Ga0207650_10000510
630 Ga0207650_10015340
631 Ga0207650_10033423
632 Ga0207650_10287017
633 Ga0207659_10004025
634 Ga0207659_10008903
635 Ga0207659_10010259
636 Ga0207659_10030106
637 Ga0207659_10035635
638 Ga0207659_10066663
639 Ga0207687_10005071
640 Ga0207664_10106623
641 Ga0207644_10064608
642 Ga0207644_10070505
643 Ga0207706_10028865
644 Ga0207709_10003849
645 Ga0207670_10032295
646 Ga0207670_10193653
647 Ga0207669_10088071
648 Ga0207704_10002729
649 Ga0207704_10173853
650 Ga0207691_10012307
651 Ga0207691_10074526
652 Ga0207691_10084874
653 Ga0207711_10014535
654 Ga0207711_10122015
655 Ga0207711_10190124
656 Ga0207689_10003005
657 Ga0207661_10082419
658 Ga0207679_10007017
659 Ga0207679_10036814
660 Ga0207679_10121526
661 Ga0207667_10026159
662 Ga0207651_10017493
663 Ga0207651_10020778
664 Ga0207651_10052352
665 Ga0207651_10118057
666 Ga0207651_10185289
667 Ga0207712_10029626
668 Ga0207677_10030616
669 Ga0207677_10039917
670 Ga0207703_10046278
671 Ga0207703_10073576
672 Ga0207703_10167121
673 Ga0207703_10194829
674 Ga0207639_10410677
675 Ga0207678_10147294
676 Ga0207708_10043874
677 Ga0207708_10049944
678 Ga0207702_10014215
679 Ga0207702_10055051
680 Ga0207641_10001690
681 Ga0207641_10039147
682 Ga0207648_10000587
683 Ga0207648_10383671
684 Ga0207676_10010042
685 Ga0207676_10242542
686 Ga0207676_10269719
687 Ga0207674_10195185
688 Ga0207674_10217016
689 Ga0207675_100037277
690 Ga0207675_100265843
691 Ga0207683_10009197
692 Ga0207683_10031838
693 Ga0207683_10129634
694 Ga0207683_10305769
695 Ga0207698_10041836
696 Ga0209974_10019582
697 Ga0207428_10002949
698 Ga0207428_10011638
699 Ga0268265_10054691
700 Ga0268265_10105716
701 Ga0268264_10038860
702 Ga0268264_10187167
703 Ga0265338_10180092
704 Ga0265314_10000658
705 Ga0373934_0005209
706 Ga0373934_0055897
707 Ga0373954_0004986
708 Ga0373955_0089484
709 Ga0373937_0016792
710 Ga0373937_0039381
711 Ga0373937_0082766
712 Ga0373937_0186790
713 Ga0373925_0506108
714 Ga0436364_0012709
715 Ga0436364_1289035
716 Ga0436365_0074144
717 Ga0439453_0004309
718 Ga0495592_0070037
719 Ga0495653_0179184
720 Ga0495580_0033745
721 Ga0495582_0018631
722 Ga0495608_0065470
723 Ga0495618_0113503
724 Ga0495586_0025868
725 Ga0495586_0116667
726 Ga0495587_0004553
727 Ga0495667_0002263
728 Ga0495667_0205962
729 Ga0495634_0010869
730 Ga0495659_0012790
731 Ga0495657_0001304
732 Ga0495613_0002244
733 Ga0495613_0072175
734 Ga0495636_0013778
735 Ga0495636_0099847
736 Ga0495675_0166136
737 Ga0495684_0015676
738 Ga0495684_0080840
739 Ga0495684_0122376
740 Ga0495602_0003418
741 Ga0496104_0141903
742 Ga0496104_0169574
743 Ga0496108_0072818
744 Ga0496109_0038753
745 Ga0496113_0211757
746 Ga0496115_0137182
747 nmdc:mga05p37_118806_c1
748 nmdc:mga05p37_240839_c1
749 nmdc:mga05p37_3762_c1
750 nmdc:mga05p37_58924_c1
751 nmdc:mga09592_28557_c1
752 nmdc:mga09592_43622_c1
753 nmdc:mga0qj67_80330_c1
754 nmdc:mga06r32_173682_c1
755 nmdc:mga06r32_75167_c1
756 nmdc:mga08y16_105838_c1
757 nmdc:mga08y16_1168_c1
758 nmdc:mga08y16_170086_c1
759 nmdc:mga08y16_170332_c1
760 nmdc:mga08y16_6027_c1
761 nmdc:mga08y16_64992_c1
762 nmdc:mga0n895_101456_c1
763 nmdc:mga0n895_13008_c1
764 nmdc:mga0n895_410186_c1
765 nmdc:mga0a205_17742_c1
766 nmdc:mga0a205_25026_c1
767 nmdc:mga0a205_46015_c1
768 nmdc:mga0a205_4890_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wkw-assembly1.cif.gz_B alcaligenes esterase complexed with product analogue 0.8035 32 348
2wkw-assembly1.cif.gz_B alcaligenes esterase complexed with product analogue 0.7915 32 348
7yd2-assembly1.cif.gz_B sule_p44r_s209a 0.7134 32 347
4q34-assembly1.cif.gz_A-2 crystal structure of a putative esterase (bdi_1566) from parabacteroides distasonis atcc 8503 at 1.60 a resolution 0.7108 32 347
8goy-assembly1.cif.gz_B sule p44r 0.7089 33 347
ID Description Score Start End Superfamily
2wkwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.8045 32 348 3.40.50.1820
2wkwA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7926 32 348 3.40.50.1820
af_Q7T387_10_213_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.7001 71 346 3.40.50.1820
4q34A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.6962 32 347 3.40.50.1820
4q34A00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.6879 32 347 3.40.50.1820
ID Description Score Start End GO Terms
AF-A0A1V3IMU4-F1-model_v4 Alpha/beta hydrolase 0.8737 256 346
AF-A0A2G4KAC5-F1-model_v4 Uncharacterized protein 0.8734 237 357
AF-A0A537BQV8-F1-model_v4 Esterase 0.8692 221 347
AF-A0A845KIE6-F1-model_v4 deleted 0.8589 238 346
AF-K1T2T6-F1-model_v4 Dienelactone hydrolase domain-containing protein 0.8344 238 347

Map