F429951
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 384 | 155 | 384 | 281 |
Family's Representative Sequence
| Representative Sequence | 3300037471|Ga0395905_0531097|Ga0395905_0531097_74_1033 |
| Length | 319 |
| Sequence | LICGCCIAAAHSAEAAICYPGLTCPSGKETKRMMAVRFFRRSRSTADSQKAETKESVGSLLRFLLTIAIIAWAFRSFVGAPFNIPSGSMLPTLYVGDYVAVTKWPYGYSRYSFPLAFPSFDGRIFGGLPHRGDVVVFRHPTEDADLIKRVIALAGDRVAVSDGQLILNGRPVPRQPLAPAKIAVTPNSPCRAIPPSTPTIALDDKQPICLYHAFLETLPGGPTYTVLDQVDHGAADDFPETTVPAGRVFLMGDNRDDSLDSRFPTYEGGIGMVPTENLIGRASFTFWSTDGGASWFKPWTWFTALRGSRIGNGYTGKAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 4 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 33 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 34 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 35 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 39 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 40 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 41 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 42 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 43 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 44 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 45 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 46 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 47 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 48 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 49 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 50 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 51 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 52 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 54 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 55 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 56 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 57 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 59 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 60 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 61 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 62 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 70 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 71 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 72 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 80 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 127 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 128 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 129 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 130 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 131 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 132 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 133 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 134 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 135 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 136 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 137 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 138 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 139 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 140 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 144 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 145 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 146 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 147 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 148 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 149 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 150 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 151 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 152 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 153 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 154 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 155 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 100 |
| Metatranscriptomes | 0 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.26 |
| Nodule | 0 |
| Rhizoplane | 7.29 |
| Rhizosphere | 92.45 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24752J21851_1004059 | 3300001976 | Bacteria | 1923 |
| 2 | JGI24739J22299_10010073 | 3300001989 | Bacteria | 3513 |
| 3 | JGI24737J22298_10000172 | 3300001990 | Bacteria | 20869 |
| 4 | JGI24737J22298_10001166 | 3300001990 | Bacteria | 9251 |
| 5 | JGI24737J22298_10032463 | 3300001990 | Bacteria | 1625 |
| 6 | JGI24745J21846_1001435 | 3300002073 | Bacteria | 2314 |
| 7 | JGI24744J21845_10019765 | 3300002077 | Bacteria | 1331 |
| 8 | JGI24034J26672_10006866 | 3300002239 | Bacteria | 1649 |
| 9 | Ga0065715_10165652 | 3300005293 | Bacteria | 1589 |
| 10 | Ga0070658_10036686 | 3300005327 | Bacteria | 3951 |
| 11 | Ga0070658_10038193 | 3300005327 | Bacteria | 3873 |
| 12 | Ga0070658_10048204 | 3300005327 | Bacteria | 3448 |
| 13 | Ga0070676_10021919 | 3300005328 | Bacteria | 3579 |
| 14 | Ga0070683_100037821 | 3300005329 | Bacteria | 4419 |
| 15 | Ga0070670_100013595 | 3300005331 | Bacteria | 6976 |
| 16 | Ga0070670_100018265 | 3300005331 | Bacteria | 6016 |
| 17 | Ga0070677_10076351 | 3300005333 | Bacteria | 1422 |
| 18 | Ga0068869_100506333 | 3300005334 | Bacteria | 1009 |
| 19 | Ga0070666_10015985 | 3300005335 | Bacteria | 4794 |
| 20 | Ga0070666_10017759 | 3300005335 | Bacteria | 4564 |
| 21 | Ga0070666_10052317 | 3300005335 | Bacteria | 2752 |
| 22 | Ga0068868_100031808 | 3300005338 | Bacteria | 4057 |
| 23 | Ga0068868_100178990 | 3300005338 | Bacteria | 1758 |
| 24 | Ga0070660_100001509 | 3300005339 | Bacteria | 15957 |
| 25 | Ga0070660_100023985 | 3300005339 | Bacteria | 4523 |
| 26 | Ga0070660_100078800 | 3300005339 | Bacteria | 2583 |
| 27 | Ga0070660_100195111 | 3300005339 | Bacteria | 1641 |
| 28 | Ga0070660_100217484 | 3300005339 | Bacteria | 1552 |
| 29 | Ga0070660_100284758 | 3300005339 | Bacteria | 1353 |
| 30 | Ga0070691_10000966 | 3300005341 | Bacteria | 11743 |
| 31 | Ga0070661_100003586 | 3300005344 | Bacteria | 10685 |
| 32 | Ga0070661_100004643 | 3300005344 | Bacteria | 9459 |
| 33 | Ga0070661_100027778 | 3300005344 | Bacteria | 4077 |
| 34 | Ga0070675_100116381 | 3300005354 | Bacteria | 2267 |
| 35 | Ga0070675_100119850 | 3300005354 | Bacteria | 2235 |
| 36 | Ga0070675_100479898 | 3300005354 | Bacteria | 1118 |
| 37 | Ga0070671_100002442 | 3300005355 | Bacteria | 14371 |
| 38 | Ga0070671_100043168 | 3300005355 | Bacteria | 3747 |
| 39 | Ga0070671_100066503 | 3300005355 | Bacteria | 3004 |
| 40 | Ga0070671_100153832 | 3300005355 | Bacteria | 1943 |
| 41 | Ga0070674_100067354 | 3300005356 | Bacteria | 2518 |
| 42 | Ga0070674_100161997 | 3300005356 | Bacteria | 1698 |
| 43 | Ga0070673_100024424 | 3300005364 | Bacteria | 4432 |
| 44 | Ga0070673_100028540 | 3300005364 | Bacteria | 4151 |
| 45 | Ga0070673_100057079 | 3300005364 | Bacteria | 3084 |
| 46 | Ga0070673_100284590 | 3300005364 | Bacteria | 1451 |
| 47 | Ga0070673_100484852 | 3300005364 | Bacteria | 1116 |
| 48 | Ga0070659_100001907 | 3300005366 | Bacteria | 14906 |
| 49 | Ga0070659_100012067 | 3300005366 | Bacteria | 6397 |
| 50 | Ga0070659_100022212 | 3300005366 | Bacteria | 4840 |
| 51 | Ga0070659_100140310 | 3300005366 | Bacteria | 1967 |
| 52 | Ga0070659_100268711 | 3300005366 | Bacteria | 1416 |
| 53 | Ga0070667_100001032 | 3300005367 | Bacteria | 25440 |
| 54 | Ga0070667_100002148 | 3300005367 | Bacteria | 17364 |
| 55 | Ga0070667_100203105 | 3300005367 | Bacteria | 1759 |
| 56 | Ga0070709_10065820 | 3300005434 | Bacteria | 2322 |
| 57 | Ga0070714_100049213 | 3300005435 | Bacteria | 3587 |
| 58 | Ga0070714_100219667 | 3300005435 | Bacteria | 1746 |
| 59 | Ga0070713_100108444 | 3300005436 | Bacteria | 2417 |
| 60 | Ga0070711_100394312 | 3300005439 | Bacteria | 1122 |
| 61 | Ga0070663_100031587 | 3300005455 | Bacteria | 3640 |
| 62 | Ga0070663_100350692 | 3300005455 | Bacteria | 1195 |
| 63 | Ga0070678_100000889 | 3300005456 | Bacteria | 15354 |
| 64 | Ga0070678_100013061 | 3300005456 | Bacteria | 5191 |
| 65 | Ga0070662_100009181 | 3300005457 | Bacteria | 6456 |
| 66 | Ga0070662_100017631 | 3300005457 | Bacteria | 4818 |
| 67 | Ga0070662_100018296 | 3300005457 | Bacteria | 4738 |
| 68 | Ga0070662_100087124 | 3300005457 | Bacteria | 2337 |
| 69 | Ga0070662_100227704 | 3300005457 | Bacteria | 1490 |
| 70 | Ga0068867_100010099 | 3300005459 | Bacteria | 6653 |
| 71 | Ga0068867_100191501 | 3300005459 | Bacteria | 1632 |
| 72 | Ga0070684_100030763 | 3300005535 | Bacteria | 4565 |
| 73 | Ga0068853_100047060 | 3300005539 | Bacteria | 3701 |
| 74 | Ga0068853_100164153 | 3300005539 | Bacteria | 2006 |
| 75 | Ga0068853_100258520 | 3300005539 | Bacteria | 1600 |
| 76 | Ga0070672_100002340 | 3300005543 | Bacteria | 11982 |
| 77 | Ga0070672_100002525 | 3300005543 | Bacteria | 11648 |
| 78 | Ga0070672_100254720 | 3300005543 | Bacteria | 1479 |
| 79 | Ga0070665_100053988 | 3300005548 | Bacteria | 4030 |
| 80 | Ga0070665_100570603 | 3300005548 | Bacteria | 1144 |
| 81 | Ga0070664_100010612 | 3300005564 | Bacteria | 7465 |
| 82 | Ga0070664_100020123 | 3300005564 | Bacteria | 5494 |
| 83 | Ga0070664_100030014 | 3300005564 | Bacteria | 4534 |
| 84 | Ga0070664_100042361 | 3300005564 | Bacteria | 3844 |
| 85 | Ga0068857_100002400 | 3300005577 | Bacteria | 15273 |
| 86 | Ga0068857_100006185 | 3300005577 | Bacteria | 10233 |
| 87 | Ga0068857_100061045 | 3300005577 | Bacteria | 3349 |
| 88 | Ga0068857_100180735 | 3300005577 | Bacteria | 1920 |
| 89 | Ga0068854_100021395 | 3300005578 | Bacteria | 4389 |
| 90 | Ga0068854_100063130 | 3300005578 | Bacteria | 2688 |
| 91 | Ga0068854_100066983 | 3300005578 | Bacteria | 2615 |
| 92 | Ga0068854_100181209 | 3300005578 | Bacteria | 1645 |
| 93 | Ga0068856_100548076 | 3300005614 | Bacteria | 1178 |
| 94 | Ga0068852_100001822 | 3300005616 | Bacteria | 14491 |
| 95 | Ga0068852_100015269 | 3300005616 | Bacteria | 5948 |
| 96 | Ga0068852_100033274 | 3300005616 | Bacteria | 4278 |
| 97 | Ga0068852_100265524 | 3300005616 | Bacteria | 1650 |
| 98 | Ga0068852_100369145 | 3300005616 | Bacteria | 1405 |
| 99 | Ga0068859_100033630 | 3300005617 | Bacteria | 5149 |
| 100 | Ga0068859_100201486 | 3300005617 | Bacteria | 2075 |
| 101 | Ga0068864_100002309 | 3300005618 | Bacteria | 15778 |
| 102 | Ga0068864_100003157 | 3300005618 | Bacteria | 13623 |
| 103 | Ga0068864_100010134 | 3300005618 | Bacteria | 7781 |
| 104 | Ga0068866_10062190 | 3300005718 | Bacteria | 1942 |
| 105 | Ga0068866_10076974 | 3300005718 | Bacteria | 1780 |
| 106 | Ga0068861_100363858 | 3300005719 | Bacteria | 1273 |
| 107 | Ga0068851_10020093 | 3300005834 | Bacteria | 3230 |
| 108 | Ga0068851_10048310 | 3300005834 | Bacteria | 2156 |
| 109 | Ga0068851_10088731 | 3300005834 | Bacteria | 1625 |
| 110 | Ga0068863_100008753 | 3300005841 | Bacteria | 9883 |
| 111 | Ga0068863_100014029 | 3300005841 | Bacteria | 7719 |
| 112 | Ga0068858_100016866 | 3300005842 | Bacteria | 6858 |
| 113 | Ga0068858_100020431 | 3300005842 | Bacteria | 6192 |
| 114 | Ga0068860_100115768 | 3300005843 | Bacteria | 2564 |
| 115 | Ga0068862_100060368 | 3300005844 | Bacteria | 3257 |
| 116 | Ga0081539_10128831 | 3300005985 | Bacteria | 1246 |
| 117 | Ga0070717_10146343 | 3300006028 | Bacteria | 2041 |
| 118 | Ga0075362_10117539 | 3300006177 | Bacteria | 1256 |
| 119 | Ga0097621_100011743 | 3300006237 | Bacteria | 6468 |
| 120 | Ga0097621_100025728 | 3300006237 | Bacteria | 4607 |
| 121 | Ga0097621_100131998 | 3300006237 | Bacteria | 2127 |
| 122 | Ga0097621_100406458 | 3300006237 | Bacteria | 1220 |
| 123 | Ga0068871_100003418 | 3300006358 | Bacteria | 10915 |
| 124 | Ga0068865_100002786 | 3300006881 | Bacteria | 10384 |
| 125 | Ga0068865_100003011 | 3300006881 | Bacteria | 10063 |
| 126 | Ga0068865_100064471 | 3300006881 | Bacteria | 2579 |
| 127 | Ga0097620_100033627 | 3300006931 | Bacteria | 5149 |
| 128 | Ga0097620_100201498 | 3300006931 | Bacteria | 2075 |
| 129 | Ga0105240_10052853 | 3300009093 | Bacteria | 5104 |
| 130 | Ga0105240_10243482 | 3300009093 | Bacteria | 2084 |
| 131 | Ga0105245_10012462 | 3300009098 | Bacteria | 7399 |
| 132 | Ga0105245_10088412 | 3300009098 | Bacteria | 2846 |
| 133 | Ga0105243_10199044 | 3300009148 | Bacteria | 1755 |
| 134 | Ga0105241_10154871 | 3300009174 | Bacteria | 1878 |
| 135 | Ga0105242_10003308 | 3300009176 | Bacteria | 12547 |
| 136 | Ga0105248_10001494 | 3300009177 | Bacteria | 26021 |
| 137 | Ga0105248_10006331 | 3300009177 | Bacteria | 12988 |
| 138 | Ga0105248_10161260 | 3300009177 | Bacteria | 2529 |
| 139 | Ga0105248_10180586 | 3300009177 | Bacteria | 2378 |
| 140 | Ga0105248_10316452 | 3300009177 | Bacteria | 1758 |
| 141 | Ga0105237_10027805 | 3300009545 | Bacteria | 5764 |
| 142 | Ga0105238_10008144 | 3300009551 | Bacteria | 10483 |
| 143 | Ga0105238_10038697 | 3300009551 | Bacteria | 4843 |
| 144 | Ga0105249_10647977 | 3300009553 | Bacteria | 1114 |
| 145 | Ga0105239_10087185 | 3300010375 | Bacteria | 3441 |
| 146 | Ga0105246_10052609 | 3300011119 | Bacteria | 2799 |
| 147 | Ga0105246_10505630 | 3300011119 | Bacteria | 1027 |
| 148 | Ga0157373_10009371 | 3300013100 | Bacteria | 7235 |
| 149 | Ga0157373_10028733 | 3300013100 | Bacteria | 4010 |
| 150 | Ga0157373_10071924 | 3300013100 | Bacteria | 2442 |
| 151 | Ga0157373_10167732 | 3300013100 | Bacteria | 1545 |
| 152 | Ga0157371_10121181 | 3300013102 | Bacteria | 1860 |
| 153 | Ga0157371_10126062 | 3300013102 | Bacteria | 1821 |
| 154 | Ga0157371_10262186 | 3300013102 | Bacteria | 1246 |
| 155 | Ga0157370_10002132 | 3300013104 | Bacteria | 24152 |
| 156 | Ga0157369_10010201 | 3300013105 | Bacteria | 10718 |
| 157 | Ga0157369_10133344 | 3300013105 | Bacteria | 2631 |
| 158 | Ga0157374_10019892 | 3300013296 | Bacteria | 5949 |
| 159 | Ga0157374_10082739 | 3300013296 | Bacteria | 3048 |
| 160 | Ga0157374_10115702 | 3300013296 | Bacteria | 2583 |
| 161 | Ga0157374_10131984 | 3300013296 | Bacteria | 2418 |
| 162 | Ga0157378_10009310 | 3300013297 | Bacteria | 8556 |
| 163 | Ga0157378_10048255 | 3300013297 | Bacteria | 3786 |
| 164 | Ga0157378_10086697 | 3300013297 | Bacteria | 2838 |
| 165 | Ga0157378_10317195 | 3300013297 | Bacteria | 1513 |
| 166 | Ga0163162_10019478 | 3300013306 | Bacteria | 6657 |
| 167 | Ga0163162_10024015 | 3300013306 | Bacteria | 6016 |
| 168 | Ga0163162_10032880 | 3300013306 | Bacteria | 5151 |
| 169 | Ga0163162_10129364 | 3300013306 | Bacteria | 2633 |
| 170 | Ga0157372_10021307 | 3300013307 | Bacteria | 7001 |
| 171 | Ga0157372_10221918 | 3300013307 | Bacteria | 2191 |
| 172 | Ga0157372_10618803 | 3300013307 | Bacteria | 1262 |
| 173 | Ga0157375_10007721 | 3300013308 | Bacteria | 9415 |
| 174 | Ga0157375_10018918 | 3300013308 | Bacteria | 6253 |
| 175 | Ga0157375_10059996 | 3300013308 | Bacteria | 3770 |
| 176 | Ga0157375_10090337 | 3300013308 | Bacteria | 3121 |
| 177 | Ga0163163_10002645 | 3300014325 | Bacteria | 15158 |
| 178 | Ga0163163_10028520 | 3300014325 | Bacteria | 5361 |
| 179 | Ga0163163_10109588 | 3300014325 | Bacteria | 2788 |
| 180 | Ga0182008_10088237 | 3300014497 | Bacteria | 1528 |
| 181 | Ga0157377_10202175 | 3300014745 | Bacteria | 1262 |
| 182 | Ga0157379_10010111 | 3300014968 | Bacteria | 8225 |
| 183 | Ga0157376_10002926 | 3300014969 | Bacteria | 11717 |
| 184 | Ga0207697_10013441 | 3300025315 | Bacteria | 3416 |
| 185 | Ga0207697_10052158 | 3300025315 | Bacteria | 1692 |
| 186 | Ga0207682_10020124 | 3300025893 | Bacteria | 2618 |
| 187 | Ga0207642_10075690 | 3300025899 | Bacteria | 1617 |
| 188 | Ga0207688_10004520 | 3300025901 | Bacteria | 7572 |
| 189 | Ga0207647_10001452 | 3300025904 | Bacteria | 18194 |
| 190 | Ga0207647_10007265 | 3300025904 | Bacteria | 8018 |
| 191 | Ga0207647_10015410 | 3300025904 | Bacteria | 5241 |
| 192 | Ga0207643_10022846 | 3300025908 | Bacteria | 3446 |
| 193 | Ga0207705_10000475 | 3300025909 | Bacteria | 34403 |
| 194 | Ga0207705_10011041 | 3300025909 | Bacteria | 6550 |
| 195 | Ga0207705_10205409 | 3300025909 | Bacteria | 1493 |
| 196 | Ga0207695_10063623 | 3300025913 | Bacteria | 3803 |
| 197 | Ga0207671_10078157 | 3300025914 | Bacteria | 2478 |
| 198 | Ga0207660_10154733 | 3300025917 | Bacteria | 1764 |
| 199 | Ga0207657_10000919 | 3300025919 | Bacteria | 31133 |
| 200 | Ga0207657_10005161 | 3300025919 | Bacteria | 13700 |
| 201 | Ga0207657_10005933 | 3300025919 | Bacteria | 12714 |
| 202 | Ga0207657_10006910 | 3300025919 | Bacteria | 11706 |
| 203 | Ga0207657_10039871 | 3300025919 | Bacteria | 4168 |
| 204 | Ga0207657_10121244 | 3300025919 | Bacteria | 2151 |
| 205 | Ga0207657_10181146 | 3300025919 | Bacteria | 1703 |
| 206 | Ga0207649_10002717 | 3300025920 | Bacteria | 9805 |
| 207 | Ga0207649_10022408 | 3300025920 | Bacteria | 3649 |
| 208 | Ga0207649_10040650 | 3300025920 | Bacteria | 2828 |
| 209 | Ga0207649_10100025 | 3300025920 | Bacteria | 1917 |
| 210 | Ga0207694_10046515 | 3300025924 | Bacteria | 3354 |
| 211 | Ga0207650_10003728 | 3300025925 | Bacteria | 10424 |
| 212 | Ga0207650_10007235 | 3300025925 | Bacteria | 7559 |
| 213 | Ga0207650_10176106 | 3300025925 | Bacteria | 1702 |
| 214 | Ga0207659_10113403 | 3300025926 | Bacteria | 2064 |
| 215 | Ga0207659_10132070 | 3300025926 | Bacteria | 1928 |
| 216 | Ga0207687_10004771 | 3300025927 | Bacteria | 9017 |
| 217 | Ga0207700_10148085 | 3300025928 | Bacteria | 1937 |
| 218 | Ga0207644_10000522 | 3300025931 | Bacteria | 24894 |
| 219 | Ga0207644_10000744 | 3300025931 | Bacteria | 20651 |
| 220 | Ga0207644_10001113 | 3300025931 | Bacteria | 17260 |
| 221 | Ga0207644_10001832 | 3300025931 | Bacteria | 13807 |
| 222 | Ga0207644_10140228 | 3300025931 | Bacteria | 1861 |
| 223 | Ga0207690_10007049 | 3300025932 | Bacteria | 6669 |
| 224 | Ga0207690_10022770 | 3300025932 | Bacteria | 3901 |
| 225 | Ga0207690_10023595 | 3300025932 | Bacteria | 3841 |
| 226 | Ga0207690_10092431 | 3300025932 | Bacteria | 2141 |
| 227 | Ga0207706_10001627 | 3300025933 | Bacteria | 22270 |
| 228 | Ga0207706_10001832 | 3300025933 | Bacteria | 20857 |
| 229 | Ga0207706_10003071 | 3300025933 | Bacteria | 16064 |
| 230 | Ga0207706_10033298 | 3300025933 | Bacteria | 4588 |
| 231 | Ga0207706_10057532 | 3300025933 | Bacteria | 3425 |
| 232 | Ga0207706_10289534 | 3300025933 | Bacteria | 1428 |
| 233 | Ga0207709_10261299 | 3300025935 | Bacteria | 1270 |
| 234 | Ga0207669_10016112 | 3300025937 | Bacteria | 3789 |
| 235 | Ga0207669_10130394 | 3300025937 | Bacteria | 1726 |
| 236 | Ga0207669_10186247 | 3300025937 | Bacteria | 1493 |
| 237 | Ga0207704_10007755 | 3300025938 | Bacteria | 5094 |
| 238 | Ga0207704_10085824 | 3300025938 | Bacteria | 2051 |
| 239 | Ga0207691_10001381 | 3300025940 | Bacteria | 24252 |
| 240 | Ga0207691_10001970 | 3300025940 | Bacteria | 20068 |
| 241 | Ga0207691_10051372 | 3300025940 | Bacteria | 3769 |
| 242 | Ga0207691_10199652 | 3300025940 | Bacteria | 1741 |
| 243 | Ga0207711_10004917 | 3300025941 | Bacteria | 11345 |
| 244 | Ga0207711_10010222 | 3300025941 | Bacteria | 7792 |
| 245 | Ga0207711_10015974 | 3300025941 | Bacteria | 6227 |
| 246 | Ga0207711_10244844 | 3300025941 | Bacteria | 1645 |
| 247 | Ga0207689_10495128 | 3300025942 | Bacteria | 1024 |
| 248 | Ga0207661_10038477 | 3300025944 | Bacteria | 3749 |
| 249 | Ga0207679_10013960 | 3300025945 | Bacteria | 5267 |
| 250 | Ga0207679_10016870 | 3300025945 | Bacteria | 4856 |
| 251 | Ga0207679_10041905 | 3300025945 | Bacteria | 3286 |
| 252 | Ga0207679_10205790 | 3300025945 | Bacteria | 1647 |
| 253 | Ga0207667_10002705 | 3300025949 | Bacteria | 21934 |
| 254 | Ga0207667_10122628 | 3300025949 | Bacteria | 2678 |
| 255 | Ga0207651_10212729 | 3300025960 | Bacteria | 1557 |
| 256 | Ga0207651_10346303 | 3300025960 | Bacteria | 1250 |
| 257 | Ga0207640_10031644 | 3300025981 | Bacteria | 3272 |
| 258 | Ga0207640_10061097 | 3300025981 | Bacteria | 2494 |
| 259 | Ga0207640_10203250 | 3300025981 | Bacteria | 1503 |
| 260 | Ga0207658_10020918 | 3300025986 | Bacteria | 4534 |
| 261 | Ga0207658_10061395 | 3300025986 | Bacteria | 2809 |
| 262 | Ga0207658_10174739 | 3300025986 | Bacteria | 1773 |
| 263 | Ga0207677_10005869 | 3300026023 | Bacteria | 6681 |
| 264 | Ga0207677_10044849 | 3300026023 | Bacteria | 2949 |
| 265 | Ga0207677_10127337 | 3300026023 | Bacteria | 1927 |
| 266 | Ga0207639_10023082 | 3300026041 | Bacteria | 4488 |
| 267 | Ga0207639_10159567 | 3300026041 | Bacteria | 1899 |
| 268 | Ga0207678_10079449 | 3300026067 | Bacteria | 2809 |
| 269 | Ga0207678_10094600 | 3300026067 | Bacteria | 2553 |
| 270 | Ga0207678_10304147 | 3300026067 | Bacteria | 1371 |
| 271 | Ga0207641_10008123 | 3300026088 | Bacteria | 8690 |
| 272 | Ga0207641_10018468 | 3300026088 | Bacteria | 5717 |
| 273 | Ga0207641_10065329 | 3300026088 | Bacteria | 3112 |
| 274 | Ga0207648_10002294 | 3300026089 | Bacteria | 20667 |
| 275 | Ga0207648_10056491 | 3300026089 | Bacteria | 3425 |
| 276 | Ga0207648_10193606 | 3300026089 | Bacteria | 1803 |
| 277 | Ga0207676_10006903 | 3300026095 | Bacteria | 8046 |
| 278 | Ga0207676_10017039 | 3300026095 | Bacteria | 5263 |
| 279 | Ga0207676_10037630 | 3300026095 | Bacteria | 3688 |
| 280 | Ga0207674_10000725 | 3300026116 | Bacteria | 43126 |
| 281 | Ga0207674_10005100 | 3300026116 | Bacteria | 15681 |
| 282 | Ga0207674_10005725 | 3300026116 | Bacteria | 14735 |
| 283 | Ga0207683_10006429 | 3300026121 | Bacteria | 10062 |
| 284 | Ga0207683_10013889 | 3300026121 | Bacteria | 6867 |
| 285 | Ga0207683_10024585 | 3300026121 | Bacteria | 5189 |
| 286 | Ga0207683_10053751 | 3300026121 | Bacteria | 3532 |
| 287 | Ga0207698_10011182 | 3300026142 | Bacteria | 5807 |
| 288 | Ga0207698_10022529 | 3300026142 | Bacteria | 4380 |
| 289 | Ga0207698_10040484 | 3300026142 | Bacteria | 3463 |
| 290 | Ga0207698_10048912 | 3300026142 | Bacteria | 3214 |
| 291 | Ga0207698_10165106 | 3300026142 | Bacteria | 1942 |
| 292 | Ga0268266_10014788 | 3300028379 | Bacteria | 6704 |
| 293 | Ga0268266_10075571 | 3300028379 | Bacteria | 2926 |
| 294 | Ga0268265_10083771 | 3300028380 | Bacteria | 2526 |
| 295 | Ga0307405_10008360 | 3300031731 | Bacteria | 5239 |
| 296 | Ga0307410_10501772 | 3300031852 | Bacteria | 998 |
| 297 | Ga0307416_100000569 | 3300032002 | Bacteria | 18881 |
| 298 | Ga0307416_100160099 | 3300032002 | Bacteria | 2079 |
| 299 | Ga0307414_10020146 | 3300032004 | Bacteria | 4151 |
| 300 | Ga0373937_0254875 | 3300036401 | Bacteria | 1654 |
| 301 | Ga0395899_0000432 | 3300037312 | Bacteria | 48281 |
| 302 | Ga0395899_0016019 | 3300037312 | Bacteria | 5717 |
| 303 | Ga0395899_0030225 | 3300037312 | Bacteria | 4075 |
| 304 | Ga0395899_0055079 | 3300037312 | Bacteria | 2942 |
| 305 | Ga0395900_0000432 | 3300037418 | Bacteria | 60134 |
| 306 | Ga0395900_0001148 | 3300037418 | Bacteria | 33301 |
| 307 | Ga0395900_0039357 | 3300037418 | Bacteria | 4871 |
| 308 | Ga0395900_0069601 | 3300037418 | Bacteria | 3617 |
| 309 | Ga0395900_0088568 | 3300037418 | Bacteria | 3182 |
| 310 | Ga0395900_0090486 | 3300037418 | Bacteria | 3145 |
| 311 | Ga0395900_0091093 | 3300037418 | Bacteria | 3133 |
| 312 | Ga0395900_0094463 | 3300037418 | Bacteria | 3072 |
| 313 | Ga0395900_0100303 | 3300037418 | Bacteria | 2974 |
| 314 | Ga0395900_0115288 | 3300037418 | Bacteria | 2757 |
| 315 | Ga0395900_0197491 | 3300037418 | Bacteria | 2037 |
| 316 | Ga0395900_0239121 | 3300037418 | Bacteria | 1822 |
| 317 | Ga0395900_0328462 | 3300037418 | Bacteria | 1508 |
| 318 | Ga0395898_0000021 | 3300037466 | Bacteria | 393971 |
| 319 | Ga0395898_0034924 | 3300037466 | Bacteria | 5003 |
| 320 | Ga0395898_0086129 | 3300037466 | Bacteria | 3028 |
| 321 | Ga0395898_0111778 | 3300037466 | Bacteria | 2618 |
| 322 | Ga0395898_0194394 | 3300037466 | Bacteria | 1938 |
| 323 | Ga0395905_0000413 | 3300037471 | Bacteria | 60132 |
| 324 | Ga0395905_0000649 | 3300037471 | Bacteria | 46291 |
| 325 | Ga0395905_0004444 | 3300037471 | Bacteria | 14575 |
| 326 | Ga0395905_0005169 | 3300037471 | Bacteria | 13387 |
| 327 | Ga0395905_0017192 | 3300037471 | Bacteria | 6870 |
| 328 | Ga0395905_0041687 | 3300037471 | Bacteria | 4308 |
| 329 | Ga0395905_0045062 | 3300037471 | Bacteria | 4137 |
| 330 | Ga0395905_0047289 | 3300037471 | Bacteria | 4033 |
| 331 | Ga0395905_0056746 | 3300037471 | Bacteria | 3663 |
| 332 | Ga0395905_0086870 | 3300037471 | Bacteria | 2932 |
| 333 | Ga0395905_0102455 | 3300037471 | Bacteria | 2687 |
| 334 | Ga0395905_0169216 | 3300037471 | Bacteria | 2052 |
| 335 | Ga0395905_0531097 | 3300037471 | Bacteria | 1077 |
| 336 | Ga0395905_0594611 | 3300037471 | Bacteria | 1008 |
| 337 | Ga0395901_0000476 | 3300038443 | Bacteria | 46589 |
| 338 | Ga0395901_0010511 | 3300038443 | Bacteria | 9374 |
| 339 | Ga0395901_0036122 | 3300038443 | Bacteria | 5105 |
| 340 | Ga0395901_0076546 | 3300038443 | Bacteria | 3491 |
| 341 | Ga0395901_0085249 | 3300038443 | Bacteria | 3302 |
| 342 | Ga0395901_0178303 | 3300038443 | Bacteria | 2228 |
| 343 | Ga0395901_0259943 | 3300038443 | Bacteria | 1807 |
| 344 | Ga0395901_0302073 | 3300038443 | Bacteria | 1659 |
| 345 | Ga0395901_0324837 | 3300038443 | Bacteria | 1591 |
| 346 | Ga0395901_0330754 | 3300038443 | Bacteria | 1575 |
| 347 | Ga0439458_0000231 | 3300042157 | Bacteria | 13292 |
| 348 | Ga0439458_0000814 | 3300042157 | Bacteria | 8018 |
| 349 | Ga0439458_0038029 | 3300042157 | Bacteria | 1161 |
| 350 | Ga0466969_0035024 | 3300044656 | Bacteria | 2542 |
| 351 | Ga0466959_0103248 | 3300045049 | Bacteria | 2039 |
| 352 | Ga0466967_0294927 | 3300045976 | Bacteria | 1559 |
| 353 | Ga0495663_0003568 | 3300046525 | Bacteria | 4474 |
| 354 | Ga0495621_0003418 | 3300046539 | Bacteria | 4386 |
| 355 | Ga0495677_0001639 | 3300047445 | Bacteria | 8998 |
| 356 | Ga0496100_0035259 | 3300048903 | Bacteria | 3145 |
| 357 | Ga0496100_0142320 | 3300048903 | Bacteria | 1701 |
| 358 | Ga0496101_0009079 | 3300048904 | Bacteria | 6521 |
| 359 | Ga0496102_0020465 | 3300048905 | Bacteria | 5847 |
| 360 | Ga0496102_0058000 | 3300048905 | Bacteria | 3537 |
| 361 | Ga0496106_0444978 | 3300048909 | Bacteria | 1041 |
| 362 | Ga0496107_0001637 | 3300048910 | Bacteria | 13959 |
| 363 | Ga0496107_0041492 | 3300048910 | Bacteria | 3304 |
| 364 | Ga0496107_0060236 | 3300048910 | Bacteria | 2747 |
| 365 | Ga0496107_0140674 | 3300048910 | Bacteria | 1784 |
| 366 | Ga0496108_0002271 | 3300048911 | Bacteria | 15400 |
| 367 | Ga0496108_0115054 | 3300048911 | Bacteria | 2303 |
| 368 | Ga0496109_0014399 | 3300048912 | Bacteria | 6882 |
| 369 | Ga0496109_0132111 | 3300048912 | Bacteria | 2331 |
| 370 | Ga0496109_0143709 | 3300048912 | Bacteria | 2231 |
| 371 | Ga0496110_0007769 | 3300048913 | Bacteria | 8589 |
| 372 | Ga0496110_0016392 | 3300048913 | Bacteria | 6186 |
| 373 | Ga0496110_0064923 | 3300048913 | Bacteria | 3227 |
| 374 | Ga0496111_0058138 | 3300048914 | Bacteria | 2799 |
| 375 | Ga0496111_0329983 | 3300048914 | Bacteria | 1130 |
| 376 | Ga0496112_0010155 | 3300048915 | Bacteria | 8530 |
| 377 | Ga0496112_0021670 | 3300048915 | Bacteria | 6112 |
| 378 | Ga0496112_0047822 | 3300048915 | Bacteria | 4196 |
| 379 | Ga0496113_0002378 | 3300048916 | Bacteria | 10913 |
| 380 | Ga0496113_0006537 | 3300048916 | Bacteria | 7400 |
| 381 | Ga0496113_0025766 | 3300048916 | Bacteria | 4196 |
| 382 | Ga0496113_0042922 | 3300048916 | Bacteria | 3343 |
| 383 | Ga0496114_0000023 | 3300048917 | Bacteria | 219092 |
| 384 | Ga0501069_0130466 | 3300049585 | Bacteria | 1439 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300005366 | Ga0070659_100140310 | Ga0070659_1001403102 | 231 |
| 2 | 3300005434 | Ga0070709_10065820 | Ga0070709_100658203 | 247 |
| 3 | 3300005435 | Ga0070714_100049213 | Ga0070714_1000492133 | 247 |
| 4 | 3300005436 | Ga0070713_100108444 | Ga0070713_1001084443 | 247 |
| 5 | 3300005439 | Ga0070711_100394312 | Ga0070711_1003943121 | 247 |
| 6 | 3300006028 | Ga0070717_10146343 | Ga0070717_101463433 | 247 |
| 7 | 3300025928 | Ga0207700_10148085 | Ga0207700_101480852 | 247 |
| 8 | 3300005985 | Ga0081539_10128831 | Ga0081539_101288312 | 253 |
| 9 | 3300038443 | Ga0395901_0259943 | Ga0395901_0259943_692_1555 | 253 |
| 10 | 3300014497 | Ga0182008_10088237 | Ga0182008_100882372 | 257 |
| 11 | 3300025981 | Ga0207640_10031644 | Ga0207640_100316445 | 257 |
| 12 | 3300005339 | Ga0070660_100195111 | Ga0070660_1001951112 | 258 |
| 13 | 3300005354 | Ga0070675_100119850 | Ga0070675_1001198502 | 258 |
| 14 | 3300005356 | Ga0070674_100161997 | Ga0070674_1001619971 | 258 |
| 15 | 3300005364 | Ga0070673_100484852 | Ga0070673_1004848522 | 258 |
| 16 | 3300005367 | Ga0070667_100203105 | Ga0070667_1002031052 | 258 |
| 17 | 3300005548 | Ga0070665_100053988 | Ga0070665_1000539883 | 258 |
| 18 | 3300006237 | Ga0097621_100131998 | Ga0097621_1001319982 | 258 |
| 19 | 3300009177 | Ga0105248_10316452 | Ga0105248_103164523 | 258 |
| 20 | 3300011119 | Ga0105246_10505630 | Ga0105246_105056301 | 258 |
| 21 | 3300013296 | Ga0157374_10115702 | Ga0157374_101157023 | 258 |
| 22 | 3300013306 | Ga0163162_10129364 | Ga0163162_101293642 | 258 |
| 23 | 3300013308 | Ga0157375_10090337 | Ga0157375_100903373 | 258 |
| 24 | 3300025315 | Ga0207697_10052158 | Ga0207697_100521582 | 258 |
| 25 | 3300025919 | Ga0207657_10181146 | Ga0207657_101811462 | 258 |
| 26 | 3300025926 | Ga0207659_10113403 | Ga0207659_101134032 | 258 |
| 27 | 3300025937 | Ga0207669_10130394 | Ga0207669_101303942 | 258 |
| 28 | 3300025941 | Ga0207711_10244844 | Ga0207711_102448441 | 258 |
| 29 | 3300025960 | Ga0207651_10212729 | Ga0207651_102127292 | 258 |
| 30 | 3300028379 | Ga0268266_10075571 | Ga0268266_100755712 | 258 |
| 31 | 3300001976 | JGI24752J21851_1004059 | JGI24752J21851_10040593 | 259 |
| 32 | 3300001989 | JGI24739J22299_10010073 | JGI24739J22299_100100735 | 259 |
| 33 | 3300001990 | JGI24737J22298_10000172 | JGI24737J22298_1000017220 | 259 |
| 34 | 3300001990 | JGI24737J22298_10001166 | JGI24737J22298_100011664 | 259 |
| 35 | 3300001990 | JGI24737J22298_10032463 | JGI24737J22298_100324632 | 259 |
| 36 | 3300002073 | JGI24745J21846_1001435 | JGI24745J21846_10014353 | 259 |
| 37 | 3300002077 | JGI24744J21845_10019765 | JGI24744J21845_100197652 | 259 |
| 38 | 3300002239 | JGI24034J26672_10006866 | JGI24034J26672_100068662 | 259 |
| 39 | 3300005293 | Ga0065715_10165652 | Ga0065715_101656521 | 259 |
| 40 | 3300005327 | Ga0070658_10036686 | Ga0070658_100366864 | 259 |
| 41 | 3300005327 | Ga0070658_10038193 | Ga0070658_100381935 | 259 |
| 42 | 3300005327 | Ga0070658_10048204 | Ga0070658_100482043 | 259 |
| 43 | 3300005328 | Ga0070676_10021919 | Ga0070676_100219193 | 259 |
| 44 | 3300005329 | Ga0070683_100037821 | Ga0070683_1000378213 | 259 |
| 45 | 3300005331 | Ga0070670_100013595 | Ga0070670_1000135954 | 259 |
| 46 | 3300005331 | Ga0070670_100018265 | Ga0070670_1000182654 | 259 |
| 47 | 3300005333 | Ga0070677_10076351 | Ga0070677_100763512 | 259 |
| 48 | 3300005334 | Ga0068869_100506333 | Ga0068869_1005063331 | 259 |
| 49 | 3300005335 | Ga0070666_10015985 | Ga0070666_100159853 | 259 |
| 50 | 3300005335 | Ga0070666_10017759 | Ga0070666_100177595 | 259 |
| 51 | 3300005335 | Ga0070666_10052317 | Ga0070666_100523172 | 259 |
| 52 | 3300005338 | Ga0068868_100031808 | Ga0068868_1000318083 | 259 |
| 53 | 3300005338 | Ga0068868_100178990 | Ga0068868_1001789902 | 259 |
| 54 | 3300005339 | Ga0070660_100001509 | Ga0070660_1000015097 | 259 |
| 55 | 3300005339 | Ga0070660_100023985 | Ga0070660_1000239853 | 259 |
| 56 | 3300005339 | Ga0070660_100078800 | Ga0070660_1000788002 | 259 |
| 57 | 3300005339 | Ga0070660_100217484 | Ga0070660_1002174842 | 259 |
| 58 | 3300005339 | Ga0070660_100284758 | Ga0070660_1002847582 | 259 |
| 59 | 3300005341 | Ga0070691_10000966 | Ga0070691_1000096612 | 259 |
| 60 | 3300005344 | Ga0070661_100003586 | Ga0070661_1000035865 | 259 |
| 61 | 3300005344 | Ga0070661_100004643 | Ga0070661_1000046435 | 259 |
| 62 | 3300005344 | Ga0070661_100027778 | Ga0070661_1000277783 | 259 |
| 63 | 3300005354 | Ga0070675_100116381 | Ga0070675_1001163812 | 259 |
| 64 | 3300005354 | Ga0070675_100479898 | Ga0070675_1004798982 | 259 |
| 65 | 3300005355 | Ga0070671_100002442 | Ga0070671_1000024424 | 259 |
| 66 | 3300005355 | Ga0070671_100043168 | Ga0070671_1000431683 | 259 |
| 67 | 3300005355 | Ga0070671_100066503 | Ga0070671_1000665033 | 259 |
| 68 | 3300005355 | Ga0070671_100153832 | Ga0070671_1001538322 | 259 |
| 69 | 3300005356 | Ga0070674_100067354 | Ga0070674_1000673543 | 259 |
| 70 | 3300005364 | Ga0070673_100024424 | Ga0070673_1000244243 | 259 |
| 71 | 3300005364 | Ga0070673_100028540 | Ga0070673_1000285402 | 259 |
| 72 | 3300005364 | Ga0070673_100057079 | Ga0070673_1000570792 | 259 |
| 73 | 3300005364 | Ga0070673_100284590 | Ga0070673_1002845902 | 259 |
| 74 | 3300005366 | Ga0070659_100001907 | Ga0070659_1000019072 | 259 |
| 75 | 3300005366 | Ga0070659_100012067 | Ga0070659_1000120674 | 259 |
| 76 | 3300005366 | Ga0070659_100022212 | Ga0070659_1000222124 | 259 |
| 77 | 3300005366 | Ga0070659_100268711 | Ga0070659_1002687111 | 259 |
| 78 | 3300005367 | Ga0070667_100001032 | Ga0070667_1000010328 | 259 |
| 79 | 3300005367 | Ga0070667_100002148 | Ga0070667_10000214811 | 259 |
| 80 | 3300005435 | Ga0070714_100219667 | Ga0070714_1002196672 | 259 |
| 81 | 3300005455 | Ga0070663_100031587 | Ga0070663_1000315874 | 259 |
| 82 | 3300005455 | Ga0070663_100350692 | Ga0070663_1003506921 | 259 |
| 83 | 3300005456 | Ga0070678_100000889 | Ga0070678_1000008893 | 259 |
| 84 | 3300005456 | Ga0070678_100013061 | Ga0070678_1000130614 | 259 |
| 85 | 3300005457 | Ga0070662_100009181 | Ga0070662_1000091816 | 259 |
| 86 | 3300005457 | Ga0070662_100017631 | Ga0070662_1000176316 | 259 |
| 87 | 3300005457 | Ga0070662_100018296 | Ga0070662_1000182963 | 259 |
| 88 | 3300005457 | Ga0070662_100087124 | Ga0070662_1000871242 | 259 |
| 89 | 3300005457 | Ga0070662_100227704 | Ga0070662_1002277042 | 259 |
| 90 | 3300005459 | Ga0068867_100010099 | Ga0068867_1000100993 | 259 |
| 91 | 3300005459 | Ga0068867_100191501 | Ga0068867_1001915012 | 259 |
| 92 | 3300005535 | Ga0070684_100030763 | Ga0070684_1000307633 | 259 |
| 93 | 3300005539 | Ga0068853_100047060 | Ga0068853_1000470603 | 259 |
| 94 | 3300005539 | Ga0068853_100164153 | Ga0068853_1001641532 | 259 |
| 95 | 3300005539 | Ga0068853_100258520 | Ga0068853_1002585202 | 259 |
| 96 | 3300005543 | Ga0070672_100002340 | Ga0070672_10000234010 | 259 |
| 97 | 3300005543 | Ga0070672_100002525 | Ga0070672_1000025258 | 259 |
| 98 | 3300005543 | Ga0070672_100254720 | Ga0070672_1002547202 | 259 |
| 99 | 3300005548 | Ga0070665_100570603 | Ga0070665_1005706032 | 259 |
| 100 | 3300005564 | Ga0070664_100010612 | Ga0070664_1000106127 | 259 |
| 101 | 3300005564 | Ga0070664_100020123 | Ga0070664_1000201234 | 259 |
| 102 | 3300005564 | Ga0070664_100030014 | Ga0070664_1000300144 | 259 |
| 103 | 3300005564 | Ga0070664_100042361 | Ga0070664_1000423614 | 259 |
| 104 | 3300005577 | Ga0068857_100002400 | Ga0068857_10000240011 | 259 |
| 105 | 3300005577 | Ga0068857_100006185 | Ga0068857_1000061852 | 259 |
| 106 | 3300005577 | Ga0068857_100061045 | Ga0068857_1000610453 | 259 |
| 107 | 3300005577 | Ga0068857_100180735 | Ga0068857_1001807352 | 259 |
| 108 | 3300005578 | Ga0068854_100021395 | Ga0068854_1000213955 | 259 |
| 109 | 3300005578 | Ga0068854_100063130 | Ga0068854_1000631302 | 259 |
| 110 | 3300005578 | Ga0068854_100066983 | Ga0068854_1000669832 | 259 |
| 111 | 3300005578 | Ga0068854_100181209 | Ga0068854_1001812092 | 259 |
| 112 | 3300005614 | Ga0068856_100548076 | Ga0068856_1005480762 | 259 |
| 113 | 3300005616 | Ga0068852_100001822 | Ga0068852_1000018228 | 259 |
| 114 | 3300005616 | Ga0068852_100015269 | Ga0068852_1000152693 | 259 |
| 115 | 3300005616 | Ga0068852_100033274 | Ga0068852_1000332742 | 259 |
| 116 | 3300005616 | Ga0068852_100265524 | Ga0068852_1002655241 | 259 |
| 117 | 3300005616 | Ga0068852_100369145 | Ga0068852_1003691452 | 259 |
| 118 | 3300005617 | Ga0068859_100033630 | Ga0068859_1000336305 | 259 |
| 119 | 3300005617 | Ga0068859_100201486 | Ga0068859_1002014862 | 259 |
| 120 | 3300005618 | Ga0068864_100002309 | Ga0068864_1000023095 | 259 |
| 121 | 3300005618 | Ga0068864_100003157 | Ga0068864_1000031574 | 259 |
| 122 | 3300005618 | Ga0068864_100010134 | Ga0068864_1000101344 | 259 |
| 123 | 3300005718 | Ga0068866_10062190 | Ga0068866_100621901 | 259 |
| 124 | 3300005718 | Ga0068866_10076974 | Ga0068866_100769742 | 259 |
| 125 | 3300005719 | Ga0068861_100363858 | Ga0068861_1003638581 | 259 |
| 126 | 3300005834 | Ga0068851_10020093 | Ga0068851_100200933 | 259 |
| 127 | 3300005834 | Ga0068851_10048310 | Ga0068851_100483102 | 259 |
| 128 | 3300005834 | Ga0068851_10088731 | Ga0068851_100887312 | 259 |
| 129 | 3300005841 | Ga0068863_100008753 | Ga0068863_1000087536 | 259 |
| 130 | 3300005841 | Ga0068863_100014029 | Ga0068863_1000140296 | 259 |
| 131 | 3300005842 | Ga0068858_100016866 | Ga0068858_1000168663 | 259 |
| 132 | 3300005842 | Ga0068858_100020431 | Ga0068858_1000204315 | 259 |
| 133 | 3300005843 | Ga0068860_100115768 | Ga0068860_1001157682 | 259 |
| 134 | 3300005844 | Ga0068862_100060368 | Ga0068862_1000603682 | 259 |
| 135 | 3300006177 | Ga0075362_10117539 | Ga0075362_101175392 | 259 |
| 136 | 3300006237 | Ga0097621_100011743 | Ga0097621_1000117435 | 259 |
| 137 | 3300006237 | Ga0097621_100025728 | Ga0097621_1000257283 | 259 |
| 138 | 3300006237 | Ga0097621_100406458 | Ga0097621_1004064581 | 259 |
| 139 | 3300006358 | Ga0068871_100003418 | Ga0068871_1000034183 | 259 |
| 140 | 3300006881 | Ga0068865_100002786 | Ga0068865_1000027862 | 259 |
| 141 | 3300006881 | Ga0068865_100003011 | Ga0068865_1000030113 | 259 |
| 142 | 3300006881 | Ga0068865_100064471 | Ga0068865_1000644712 | 259 |
| 143 | 3300006931 | Ga0097620_100033627 | Ga0097620_1000336275 | 259 |
| 144 | 3300006931 | Ga0097620_100201498 | Ga0097620_1002014982 | 259 |
| 145 | 3300009093 | Ga0105240_10052853 | Ga0105240_100528532 | 259 |
| 146 | 3300009093 | Ga0105240_10243482 | Ga0105240_102434822 | 259 |
| 147 | 3300009098 | Ga0105245_10012462 | Ga0105245_100124625 | 259 |
| 148 | 3300009098 | Ga0105245_10088412 | Ga0105245_100884122 | 259 |
| 149 | 3300009148 | Ga0105243_10199044 | Ga0105243_101990442 | 259 |
| 150 | 3300009174 | Ga0105241_10154871 | Ga0105241_101548712 | 259 |
| 151 | 3300009176 | Ga0105242_10003308 | Ga0105242_100033089 | 259 |
| 152 | 3300009177 | Ga0105248_10001494 | Ga0105248_100014947 | 259 |
| 153 | 3300009177 | Ga0105248_10006331 | Ga0105248_100063319 | 259 |
| 154 | 3300009177 | Ga0105248_10161260 | Ga0105248_101612602 | 259 |
| 155 | 3300009177 | Ga0105248_10180586 | Ga0105248_101805862 | 259 |
| 156 | 3300009545 | Ga0105237_10027805 | Ga0105237_100278053 | 259 |
| 157 | 3300009551 | Ga0105238_10008144 | Ga0105238_100081449 | 259 |
| 158 | 3300009551 | Ga0105238_10038697 | Ga0105238_100386973 | 259 |
| 159 | 3300009553 | Ga0105249_10647977 | Ga0105249_106479771 | 259 |
| 160 | 3300010375 | Ga0105239_10087185 | Ga0105239_100871853 | 259 |
| 161 | 3300011119 | Ga0105246_10052609 | Ga0105246_100526092 | 259 |
| 162 | 3300013100 | Ga0157373_10009371 | Ga0157373_100093715 | 259 |
| 163 | 3300013100 | Ga0157373_10028733 | Ga0157373_100287332 | 259 |
| 164 | 3300013100 | Ga0157373_10071924 | Ga0157373_100719242 | 259 |
| 165 | 3300013100 | Ga0157373_10167732 | Ga0157373_101677322 | 259 |
| 166 | 3300013102 | Ga0157371_10121181 | Ga0157371_101211813 | 259 |
| 167 | 3300013102 | Ga0157371_10126062 | Ga0157371_101260622 | 259 |
| 168 | 3300013102 | Ga0157371_10262186 | Ga0157371_102621861 | 259 |
| 169 | 3300013104 | Ga0157370_10002132 | Ga0157370_1000213218 | 259 |
| 170 | 3300013105 | Ga0157369_10010201 | Ga0157369_100102017 | 259 |
| 171 | 3300013105 | Ga0157369_10133344 | Ga0157369_101333442 | 259 |
| 172 | 3300013296 | Ga0157374_10019892 | Ga0157374_100198922 | 259 |
| 173 | 3300013296 | Ga0157374_10082739 | Ga0157374_100827393 | 259 |
| 174 | 3300013296 | Ga0157374_10131984 | Ga0157374_101319842 | 259 |
| 175 | 3300013297 | Ga0157378_10009310 | Ga0157378_100093103 | 259 |
| 176 | 3300013297 | Ga0157378_10048255 | Ga0157378_100482554 | 259 |
| 177 | 3300013297 | Ga0157378_10086697 | Ga0157378_100866971 | 259 |
| 178 | 3300013297 | Ga0157378_10317195 | Ga0157378_103171952 | 259 |
| 179 | 3300013306 | Ga0163162_10019478 | Ga0163162_100194789 | 259 |
| 180 | 3300013306 | Ga0163162_10024015 | Ga0163162_100240153 | 259 |
| 181 | 3300013306 | Ga0163162_10032880 | Ga0163162_100328804 | 259 |
| 182 | 3300013307 | Ga0157372_10021307 | Ga0157372_100213075 | 259 |
| 183 | 3300013307 | Ga0157372_10221918 | Ga0157372_102219183 | 259 |
| 184 | 3300013307 | Ga0157372_10618803 | Ga0157372_106188031 | 259 |
| 185 | 3300013308 | Ga0157375_10007721 | Ga0157375_1000772111 | 259 |
| 186 | 3300013308 | Ga0157375_10018918 | Ga0157375_100189183 | 259 |
| 187 | 3300013308 | Ga0157375_10059996 | Ga0157375_100599962 | 259 |
| 188 | 3300014325 | Ga0163163_10002645 | Ga0163163_100026452 | 259 |
| 189 | 3300014325 | Ga0163163_10028520 | Ga0163163_100285203 | 259 |
| 190 | 3300014325 | Ga0163163_10109588 | Ga0163163_101095883 | 259 |
| 191 | 3300014745 | Ga0157377_10202175 | Ga0157377_102021752 | 259 |
| 192 | 3300014968 | Ga0157379_10010111 | Ga0157379_100101114 | 259 |
| 193 | 3300014969 | Ga0157376_10002926 | Ga0157376_100029262 | 259 |
| 194 | 3300025315 | Ga0207697_10013441 | Ga0207697_100134414 | 259 |
| 195 | 3300025893 | Ga0207682_10020124 | Ga0207682_100201243 | 259 |
| 196 | 3300025899 | Ga0207642_10075690 | Ga0207642_100756901 | 259 |
| 197 | 3300025901 | Ga0207688_10004520 | Ga0207688_100045205 | 259 |
| 198 | 3300025904 | Ga0207647_10001452 | Ga0207647_100014528 | 259 |
| 199 | 3300025904 | Ga0207647_10007265 | Ga0207647_100072656 | 259 |
| 200 | 3300025904 | Ga0207647_10015410 | Ga0207647_100154105 | 259 |
| 201 | 3300025908 | Ga0207643_10022846 | Ga0207643_100228464 | 259 |
| 202 | 3300025909 | Ga0207705_10000475 | Ga0207705_1000047523 | 259 |
| 203 | 3300025909 | Ga0207705_10011041 | Ga0207705_100110414 | 259 |
| 204 | 3300025909 | Ga0207705_10205409 | Ga0207705_102054092 | 259 |
| 205 | 3300025913 | Ga0207695_10063623 | Ga0207695_100636233 | 259 |
| 206 | 3300025914 | Ga0207671_10078157 | Ga0207671_100781573 | 259 |
| 207 | 3300025917 | Ga0207660_10154733 | Ga0207660_101547332 | 259 |
| 208 | 3300025919 | Ga0207657_10000919 | Ga0207657_100009193 | 259 |
| 209 | 3300025919 | Ga0207657_10005161 | Ga0207657_1000516110 | 259 |
| 210 | 3300025919 | Ga0207657_10005933 | Ga0207657_100059339 | 259 |
| 211 | 3300025919 | Ga0207657_10006910 | Ga0207657_100069109 | 259 |
| 212 | 3300025919 | Ga0207657_10039871 | Ga0207657_100398713 | 259 |
| 213 | 3300025919 | Ga0207657_10121244 | Ga0207657_101212442 | 259 |
| 214 | 3300025920 | Ga0207649_10002717 | Ga0207649_100027179 | 259 |
| 215 | 3300025920 | Ga0207649_10022408 | Ga0207649_100224084 | 259 |
| 216 | 3300025920 | Ga0207649_10040650 | Ga0207649_100406502 | 259 |
| 217 | 3300025920 | Ga0207649_10100025 | Ga0207649_101000252 | 259 |
| 218 | 3300025924 | Ga0207694_10046515 | Ga0207694_100465152 | 259 |
| 219 | 3300025925 | Ga0207650_10003728 | Ga0207650_1000372810 | 259 |
| 220 | 3300025925 | Ga0207650_10007235 | Ga0207650_100072357 | 259 |
| 221 | 3300025925 | Ga0207650_10176106 | Ga0207650_101761062 | 259 |
| 222 | 3300025926 | Ga0207659_10132070 | Ga0207659_101320702 | 259 |
| 223 | 3300025927 | Ga0207687_10004771 | Ga0207687_100047713 | 259 |
| 224 | 3300025931 | Ga0207644_10000522 | Ga0207644_100005225 | 259 |
| 225 | 3300025931 | Ga0207644_10000744 | Ga0207644_100007449 | 259 |
| 226 | 3300025931 | Ga0207644_10001113 | Ga0207644_100011134 | 259 |
| 227 | 3300025931 | Ga0207644_10001832 | Ga0207644_1000183212 | 259 |
| 228 | 3300025931 | Ga0207644_10140228 | Ga0207644_101402282 | 259 |
| 229 | 3300025932 | Ga0207690_10007049 | Ga0207690_100070494 | 259 |
| 230 | 3300025932 | Ga0207690_10022770 | Ga0207690_100227703 | 259 |
| 231 | 3300025932 | Ga0207690_10023595 | Ga0207690_100235953 | 259 |
| 232 | 3300025932 | Ga0207690_10092431 | Ga0207690_100924312 | 259 |
| 233 | 3300025933 | Ga0207706_10001627 | Ga0207706_1000162717 | 259 |
| 234 | 3300025933 | Ga0207706_10001832 | Ga0207706_1000183221 | 259 |
| 235 | 3300025933 | Ga0207706_10003071 | Ga0207706_1000307112 | 259 |
| 236 | 3300025933 | Ga0207706_10033298 | Ga0207706_100332985 | 259 |
| 237 | 3300025933 | Ga0207706_10057532 | Ga0207706_100575323 | 259 |
| 238 | 3300025933 | Ga0207706_10289534 | Ga0207706_102895341 | 259 |
| 239 | 3300025935 | Ga0207709_10261299 | Ga0207709_102612991 | 259 |
| 240 | 3300025937 | Ga0207669_10016112 | Ga0207669_100161123 | 259 |
| 241 | 3300025937 | Ga0207669_10186247 | Ga0207669_101862472 | 259 |
| 242 | 3300025938 | Ga0207704_10007755 | Ga0207704_100077552 | 259 |
| 243 | 3300025938 | Ga0207704_10085824 | Ga0207704_100858243 | 259 |
| 244 | 3300025940 | Ga0207691_10001381 | Ga0207691_100013817 | 259 |
| 245 | 3300025940 | Ga0207691_10001970 | Ga0207691_100019709 | 259 |
| 246 | 3300025940 | Ga0207691_10051372 | Ga0207691_100513723 | 259 |
| 247 | 3300025940 | Ga0207691_10199652 | Ga0207691_101996522 | 259 |
| 248 | 3300025941 | Ga0207711_10004917 | Ga0207711_100049173 | 259 |
| 249 | 3300025941 | Ga0207711_10010222 | Ga0207711_100102229 | 259 |
| 250 | 3300025941 | Ga0207711_10015974 | Ga0207711_100159744 | 259 |
| 251 | 3300025942 | Ga0207689_10495128 | Ga0207689_104951281 | 259 |
| 252 | 3300025944 | Ga0207661_10038477 | Ga0207661_100384773 | 259 |
| 253 | 3300025945 | Ga0207679_10013960 | Ga0207679_100139604 | 259 |
| 254 | 3300025945 | Ga0207679_10016870 | Ga0207679_100168704 | 259 |
| 255 | 3300025945 | Ga0207679_10041905 | Ga0207679_100419053 | 259 |
| 256 | 3300025945 | Ga0207679_10205790 | Ga0207679_102057902 | 259 |
| 257 | 3300025949 | Ga0207667_10002705 | Ga0207667_100027057 | 259 |
| 258 | 3300025949 | Ga0207667_10122628 | Ga0207667_101226282 | 259 |
| 259 | 3300025960 | Ga0207651_10346303 | Ga0207651_103463031 | 259 |
| 260 | 3300025981 | Ga0207640_10061097 | Ga0207640_100610972 | 259 |
| 261 | 3300025981 | Ga0207640_10203250 | Ga0207640_102032502 | 259 |
| 262 | 3300025986 | Ga0207658_10020918 | Ga0207658_100209183 | 259 |
| 263 | 3300025986 | Ga0207658_10061395 | Ga0207658_100613952 | 259 |
| 264 | 3300025986 | Ga0207658_10174739 | Ga0207658_101747392 | 259 |
| 265 | 3300026023 | Ga0207677_10005869 | Ga0207677_100058692 | 259 |
| 266 | 3300026023 | Ga0207677_10044849 | Ga0207677_100448493 | 259 |
| 267 | 3300026023 | Ga0207677_10127337 | Ga0207677_101273371 | 259 |
| 268 | 3300026041 | Ga0207639_10023082 | Ga0207639_100230823 | 259 |
| 269 | 3300026041 | Ga0207639_10159567 | Ga0207639_101595672 | 259 |
| 270 | 3300026067 | Ga0207678_10079449 | Ga0207678_100794493 | 259 |
| 271 | 3300026067 | Ga0207678_10094600 | Ga0207678_100946003 | 259 |
| 272 | 3300026067 | Ga0207678_10304147 | Ga0207678_103041472 | 259 |
| 273 | 3300026088 | Ga0207641_10008123 | Ga0207641_100081235 | 259 |
| 274 | 3300026088 | Ga0207641_10018468 | Ga0207641_100184684 | 259 |
| 275 | 3300026088 | Ga0207641_10065329 | Ga0207641_100653293 | 259 |
| 276 | 3300026089 | Ga0207648_10002294 | Ga0207648_100022943 | 259 |
| 277 | 3300026089 | Ga0207648_10056491 | Ga0207648_100564912 | 259 |
| 278 | 3300026089 | Ga0207648_10193606 | Ga0207648_101936062 | 259 |
| 279 | 3300026095 | Ga0207676_10006903 | Ga0207676_100069034 | 259 |
| 280 | 3300026095 | Ga0207676_10017039 | Ga0207676_100170392 | 259 |
| 281 | 3300026095 | Ga0207676_10037630 | Ga0207676_100376303 | 259 |
| 282 | 3300026116 | Ga0207674_10000725 | Ga0207674_1000072510 | 259 |
| 283 | 3300026116 | Ga0207674_10005100 | Ga0207674_100051007 | 259 |
| 284 | 3300026116 | Ga0207674_10005725 | Ga0207674_1000572516 | 259 |
| 285 | 3300026121 | Ga0207683_10006429 | Ga0207683_100064296 | 259 |
| 286 | 3300026121 | Ga0207683_10013889 | Ga0207683_100138893 | 259 |
| 287 | 3300026121 | Ga0207683_10024585 | Ga0207683_100245853 | 259 |
| 288 | 3300026121 | Ga0207683_10053751 | Ga0207683_100537513 | 259 |
| 289 | 3300026142 | Ga0207698_10011182 | Ga0207698_100111823 | 259 |
| 290 | 3300026142 | Ga0207698_10022529 | Ga0207698_100225293 | 259 |
| 291 | 3300026142 | Ga0207698_10040484 | Ga0207698_100404842 | 259 |
| 292 | 3300026142 | Ga0207698_10048912 | Ga0207698_100489125 | 259 |
| 293 | 3300026142 | Ga0207698_10165106 | Ga0207698_101651063 | 259 |
| 294 | 3300028379 | Ga0268266_10014788 | Ga0268266_100147886 | 259 |
| 295 | 3300028380 | Ga0268265_10083771 | Ga0268265_100837712 | 259 |
| 296 | 3300031731 | Ga0307405_10008360 | Ga0307405_100083604 | 259 |
| 297 | 3300031852 | Ga0307410_10501772 | Ga0307410_105017722 | 259 |
| 298 | 3300032002 | Ga0307416_100000569 | Ga0307416_10000056920 | 259 |
| 299 | 3300032002 | Ga0307416_100160099 | Ga0307416_1001600992 | 259 |
| 300 | 3300032004 | Ga0307414_10020146 | Ga0307414_100201464 | 259 |
| 301 | 3300036401 | Ga0373937_0254875 | Ga0373937_0254875_225_1085 | 259 |
| 302 | 3300037312 | Ga0395899_0000432 | Ga0395899_0000432_18407_19267 | 259 |
| 303 | 3300037312 | Ga0395899_0016019 | Ga0395899_0016019_1886_2677 | 259 |
| 304 | 3300037312 | Ga0395899_0030225 | Ga0395899_0030225_1396_2256 | 259 |
| 305 | 3300037312 | Ga0395899_0055079 | Ga0395899_0055079_916_1776 | 259 |
| 306 | 3300037418 | Ga0395900_0000432 | Ga0395900_0000432_31286_32146 | 259 |
| 307 | 3300037418 | Ga0395900_0001148 | Ga0395900_0001148_27653_28444 | 259 |
| 308 | 3300037418 | Ga0395900_0039357 | Ga0395900_0039357_781_1644 | 259 |
| 309 | 3300037418 | Ga0395900_0069601 | Ga0395900_0069601_1782_2642 | 259 |
| 310 | 3300037418 | Ga0395900_0088568 | Ga0395900_0088568_1778_2587 | 259 |
| 311 | 3300037418 | Ga0395900_0090486 | Ga0395900_0090486_1252_2112 | 259 |
| 312 | 3300037418 | Ga0395900_0091093 | Ga0395900_0091093_200_1060 | 259 |
| 313 | 3300037418 | Ga0395900_0094463 | Ga0395900_0094463_87_941 | 259 |
| 314 | 3300037418 | Ga0395900_0100303 | Ga0395900_0100303_1222_2118 | 259 |
| 315 | 3300037418 | Ga0395900_0115288 | Ga0395900_0115288_1857_2720 | 259 |
| 316 | 3300037418 | Ga0395900_0197491 | Ga0395900_0197491_824_1633 | 259 |
| 317 | 3300037418 | Ga0395900_0239121 | Ga0395900_0239121_610_1470 | 259 |
| 318 | 3300037418 | Ga0395900_0328462 | Ga0395900_0328462_154_1017 | 259 |
| 319 | 3300037466 | Ga0395898_0000021 | Ga0395898_0000021_365120_365980 | 259 |
| 320 | 3300037466 | Ga0395898_0034924 | Ga0395898_0034924_3325_4185 | 259 |
| 321 | 3300037466 | Ga0395898_0086129 | Ga0395898_0086129_1884_2675 | 259 |
| 322 | 3300037466 | Ga0395898_0111778 | Ga0395898_0111778_1022_1882 | 259 |
| 323 | 3300037466 | Ga0395898_0194394 | Ga0395898_0194394_285_1145 | 259 |
| 324 | 3300037471 | Ga0395905_0000413 | Ga0395905_0000413_31286_32146 | 259 |
| 325 | 3300037471 | Ga0395905_0000649 | Ga0395905_0000649_15923_16714 | 259 |
| 326 | 3300037471 | Ga0395905_0004444 | Ga0395905_0004444_1077_1940 | 259 |
| 327 | 3300037471 | Ga0395905_0005169 | Ga0395905_0005169_1851_2711 | 259 |
| 328 | 3300037471 | Ga0395905_0017192 | Ga0395905_0017192_2505_3368 | 259 |
| 329 | 3300037471 | Ga0395905_0041687 | Ga0395905_0041687_3027_3893 | 259 |
| 330 | 3300037471 | Ga0395905_0045062 | Ga0395905_0045062_1732_2592 | 259 |
| 331 | 3300037471 | Ga0395905_0047289 | Ga0395905_0047289_366_1175 | 259 |
| 332 | 3300037471 | Ga0395905_0056746 | Ga0395905_0056746_2633_3448 | 259 |
| 333 | 3300037471 | Ga0395905_0086870 | Ga0395905_0086870_1244_2104 | 259 |
| 334 | 3300037471 | Ga0395905_0102455 | Ga0395905_0102455_1733_2593 | 259 |
| 335 | 3300037471 | Ga0395905_0169216 | Ga0395905_0169216_1031_1894 | 259 |
| 336 | 3300037471 | Ga0395905_0531097 | Ga0395905_0531097_74_1033 | 259 |
| 337 | 3300037471 | Ga0395905_0594611 | Ga0395905_0594611_96_956 | 259 |
| 338 | 3300038443 | Ga0395901_0000476 | Ga0395901_0000476_31326_32186 | 259 |
| 339 | 3300038443 | Ga0395901_0010511 | Ga0395901_0010511_8102_8893 | 259 |
| 340 | 3300038443 | Ga0395901_0036122 | Ga0395901_0036122_3438_4298 | 259 |
| 341 | 3300038443 | Ga0395901_0076546 | Ga0395901_0076546_2220_3083 | 259 |
| 342 | 3300038443 | Ga0395901_0085249 | Ga0395901_0085249_716_1525 | 259 |
| 343 | 3300038443 | Ga0395901_0178303 | Ga0395901_0178303_272_1132 | 259 |
| 344 | 3300038443 | Ga0395901_0302073 | Ga0395901_0302073_47_856 | 259 |
| 345 | 3300038443 | Ga0395901_0324837 | Ga0395901_0324837_693_1553 | 259 |
| 346 | 3300038443 | Ga0395901_0330754 | Ga0395901_0330754_198_1058 | 259 |
| 347 | 3300042157 | Ga0439458_0000231 | Ga0439458_0000231_3852_4712 | 259 |
| 348 | 3300042157 | Ga0439458_0000814 | Ga0439458_0000814_1312_2172 | 259 |
| 349 | 3300042157 | Ga0439458_0038029 | Ga0439458_0038029_46_906 | 259 |
| 350 | 3300044656 | Ga0466969_0035024 | Ga0466969_0035024_67_927 | 259 |
| 351 | 3300045049 | Ga0466959_0103248 | Ga0466959_0103248_353_1213 | 259 |
| 352 | 3300045976 | Ga0466967_0294927 | Ga0466967_0294927_191_1048 | 259 |
| 353 | 3300046525 | Ga0495663_0003568 | Ga0495663_0003568_3572_4429 | 259 |
| 354 | 3300046539 | Ga0495621_0003418 | Ga0495621_0003418_2000_2860 | 259 |
| 355 | 3300047445 | Ga0495677_0001639 | Ga0495677_0001639_949_1809 | 259 |
| 356 | 3300048903 | Ga0496100_0035259 | Ga0496100_0035259_468_1322 | 259 |
| 357 | 3300048903 | Ga0496100_0142320 | Ga0496100_0142320_35_814 | 259 |
| 358 | 3300048904 | Ga0496101_0009079 | Ga0496101_0009079_4676_5530 | 259 |
| 359 | 3300048905 | Ga0496102_0020465 | Ga0496102_0020465_4294_5148 | 259 |
| 360 | 3300048905 | Ga0496102_0058000 | Ga0496102_0058000_822_1601 | 259 |
| 361 | 3300048909 | Ga0496106_0444978 | Ga0496106_0444978_160_1014 | 259 |
| 362 | 3300048910 | Ga0496107_0001637 | Ga0496107_0001637_5382_6236 | 259 |
| 363 | 3300048910 | Ga0496107_0041492 | Ga0496107_0041492_2309_3088 | 259 |
| 364 | 3300048910 | Ga0496107_0060236 | Ga0496107_0060236_233_1090 | 259 |
| 365 | 3300048910 | Ga0496107_0140674 | Ga0496107_0140674_262_1122 | 259 |
| 366 | 3300048911 | Ga0496108_0002271 | Ga0496108_0002271_12198_12977 | 259 |
| 367 | 3300048911 | Ga0496108_0115054 | Ga0496108_0115054_1063_1923 | 259 |
| 368 | 3300048912 | Ga0496109_0014399 | Ga0496109_0014399_1222_2082 | 259 |
| 369 | 3300048912 | Ga0496109_0132111 | Ga0496109_0132111_1298_2158 | 259 |
| 370 | 3300048912 | Ga0496109_0143709 | Ga0496109_0143709_645_1424 | 259 |
| 371 | 3300048913 | Ga0496110_0007769 | Ga0496110_0007769_6443_7297 | 259 |
| 372 | 3300048913 | Ga0496110_0016392 | Ga0496110_0016392_2924_3703 | 259 |
| 373 | 3300048913 | Ga0496110_0064923 | Ga0496110_0064923_2084_2944 | 259 |
| 374 | 3300048914 | Ga0496111_0058138 | Ga0496111_0058138_1418_2272 | 259 |
| 375 | 3300048914 | Ga0496111_0329983 | Ga0496111_0329983_209_988 | 259 |
| 376 | 3300048915 | Ga0496112_0010155 | Ga0496112_0010155_3397_4254 | 259 |
| 377 | 3300048915 | Ga0496112_0021670 | Ga0496112_0021670_2834_3613 | 259 |
| 378 | 3300048915 | Ga0496112_0047822 | Ga0496112_0047822_1811_2671 | 259 |
| 379 | 3300048916 | Ga0496113_0002378 | Ga0496113_0002378_4824_5684 | 259 |
| 380 | 3300048916 | Ga0496113_0006537 | Ga0496113_0006537_5511_6368 | 259 |
| 381 | 3300048916 | Ga0496113_0025766 | Ga0496113_0025766_820_1599 | 259 |
| 382 | 3300048916 | Ga0496113_0042922 | Ga0496113_0042922_656_1510 | 259 |
| 383 | 3300048917 | Ga0496114_0000023 | Ga0496114_0000023_27597_28457 | 259 |
| 384 | 3300049585 | Ga0501069_0130466 | Ga0501069_0130466_426_1286 | 259 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4n31-assembly1.cif.gz_A | structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation | 0.7484 | 18 | 224 |
| 4n31-assembly1.cif.gz_B | structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation | 0.7444 | 69 | 224 |
| 4n31-assembly1.cif.gz_A | structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation | 0.6864 | 18 | 224 |
| 3s04-assembly3.cif.gz_A | crystal structure of escherichia coli type i signal peptidase in complex with an arylomycin lipoglycopeptide antibiotic | 0.662 | 18 | 231 |
| 3s04-assembly3.cif.gz_A | crystal structure of escherichia coli type i signal peptidase in complex with an arylomycin lipoglycopeptide antibiotic | 0.6346 | 18 | 231 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q54RP1_162_281_2.10.109.10 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.7733 | 14 | 220 | 2.10.109.10 |
| 4n31B00 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.7444 | 69 | 224 | 2.10.109.10 |
| af_O04348_174_312_2.10.109.10 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.7298 | 18 | 220 | 2.10.109.10 |
| af_O74800_20_156_2.10.109.10 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.7267 | 14 | 227 | 2.10.109.10 |
| af_O04348_174_312_2.10.109.10 | Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A | 0.7202 | 18 | 220 | 2.10.109.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A443G007-F1-model_v4 | deleted | 0.8661 | 71 | 221 |
|
| AF-A0A443G007-F1-model_v4 | deleted | 0.8413 | 71 | 221 |
|
| AF-A4EYM9-F1-model_v4 | Signal peptidase I (EC 3.4.21.89) | 0.8403 | 69 | 220 |
GO:0004252
GO:0006465 GO:0016020 |
| AF-A0A6F8Q1V6-F1-model_v4 | deleted | 0.8379 | 75 | 227 |
|
| AF-A0A7U0SZV8-F1-model_v4 | deleted | 0.8342 | 88 | 201 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar