F429951

General Info

Members Datasets Scaffolds Average Seq Length
384 155 384 281

Family's Representative Sequence

Representative Sequence 3300037471|Ga0395905_0531097|Ga0395905_0531097_74_1033
Length 319
Sequence LICGCCIAAAHSAEAAICYPGLTCPSGKETKRMMAVRFFRRSRSTADSQKAETKESVGSLLRFLLTIAIIAWAFRSFVGAPFNIPSGSMLPTLYVGDYVAVTKWPYGYSRYSFPLAFPSFDGRIFGGLPHRGDVVVFRHPTEDADLIKRVIALAGDRVAVSDGQLILNGRPVPRQPLAPAKIAVTPNSPCRAIPPSTPTIALDDKQPICLYHAFLETLPGGPTYTVLDQVDHGAADDFPETTVPAGRVFLMGDNRDDSLDSRFPTYEGGIGMVPTENLIGRASFTFWSTDGGASWFKPWTWFTALRGSRIGNGYTGKAK

Samples

Sample ID Description Type Environment
1 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
47 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
48 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
49 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
50 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
51 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
52 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
56 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
57 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
59 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
62 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
63 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
64 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
65 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
66 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
67 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
68 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
69 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
70 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
71 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
72 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
73 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
76 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
77 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
78 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
79 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
80 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
81 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
82 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
83 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
127 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
128 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
129 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
132 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
133 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
134 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
135 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
136 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
137 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
138 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
139 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
140 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
141 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
142 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
143 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
146 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
147 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
148 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
149 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
150 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
151 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
152 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
153 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
154 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
155 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 7.29
Rhizosphere 92.45
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24752J21851_1004059 3300001976 Bacteria 1923
2 JGI24739J22299_10010073 3300001989 Bacteria 3513
3 JGI24737J22298_10000172 3300001990 Bacteria 20869
4 JGI24737J22298_10001166 3300001990 Bacteria 9251
5 JGI24737J22298_10032463 3300001990 Bacteria 1625
6 JGI24745J21846_1001435 3300002073 Bacteria 2314
7 JGI24744J21845_10019765 3300002077 Bacteria 1331
8 JGI24034J26672_10006866 3300002239 Bacteria 1649
9 Ga0065715_10165652 3300005293 Bacteria 1589
10 Ga0070658_10036686 3300005327 Bacteria 3951
11 Ga0070658_10038193 3300005327 Bacteria 3873
12 Ga0070658_10048204 3300005327 Bacteria 3448
13 Ga0070676_10021919 3300005328 Bacteria 3579
14 Ga0070683_100037821 3300005329 Bacteria 4419
15 Ga0070670_100013595 3300005331 Bacteria 6976
16 Ga0070670_100018265 3300005331 Bacteria 6016
17 Ga0070677_10076351 3300005333 Bacteria 1422
18 Ga0068869_100506333 3300005334 Bacteria 1009
19 Ga0070666_10015985 3300005335 Bacteria 4794
20 Ga0070666_10017759 3300005335 Bacteria 4564
21 Ga0070666_10052317 3300005335 Bacteria 2752
22 Ga0068868_100031808 3300005338 Bacteria 4057
23 Ga0068868_100178990 3300005338 Bacteria 1758
24 Ga0070660_100001509 3300005339 Bacteria 15957
25 Ga0070660_100023985 3300005339 Bacteria 4523
26 Ga0070660_100078800 3300005339 Bacteria 2583
27 Ga0070660_100195111 3300005339 Bacteria 1641
28 Ga0070660_100217484 3300005339 Bacteria 1552
29 Ga0070660_100284758 3300005339 Bacteria 1353
30 Ga0070691_10000966 3300005341 Bacteria 11743
31 Ga0070661_100003586 3300005344 Bacteria 10685
32 Ga0070661_100004643 3300005344 Bacteria 9459
33 Ga0070661_100027778 3300005344 Bacteria 4077
34 Ga0070675_100116381 3300005354 Bacteria 2267
35 Ga0070675_100119850 3300005354 Bacteria 2235
36 Ga0070675_100479898 3300005354 Bacteria 1118
37 Ga0070671_100002442 3300005355 Bacteria 14371
38 Ga0070671_100043168 3300005355 Bacteria 3747
39 Ga0070671_100066503 3300005355 Bacteria 3004
40 Ga0070671_100153832 3300005355 Bacteria 1943
41 Ga0070674_100067354 3300005356 Bacteria 2518
42 Ga0070674_100161997 3300005356 Bacteria 1698
43 Ga0070673_100024424 3300005364 Bacteria 4432
44 Ga0070673_100028540 3300005364 Bacteria 4151
45 Ga0070673_100057079 3300005364 Bacteria 3084
46 Ga0070673_100284590 3300005364 Bacteria 1451
47 Ga0070673_100484852 3300005364 Bacteria 1116
48 Ga0070659_100001907 3300005366 Bacteria 14906
49 Ga0070659_100012067 3300005366 Bacteria 6397
50 Ga0070659_100022212 3300005366 Bacteria 4840
51 Ga0070659_100140310 3300005366 Bacteria 1967
52 Ga0070659_100268711 3300005366 Bacteria 1416
53 Ga0070667_100001032 3300005367 Bacteria 25440
54 Ga0070667_100002148 3300005367 Bacteria 17364
55 Ga0070667_100203105 3300005367 Bacteria 1759
56 Ga0070709_10065820 3300005434 Bacteria 2322
57 Ga0070714_100049213 3300005435 Bacteria 3587
58 Ga0070714_100219667 3300005435 Bacteria 1746
59 Ga0070713_100108444 3300005436 Bacteria 2417
60 Ga0070711_100394312 3300005439 Bacteria 1122
61 Ga0070663_100031587 3300005455 Bacteria 3640
62 Ga0070663_100350692 3300005455 Bacteria 1195
63 Ga0070678_100000889 3300005456 Bacteria 15354
64 Ga0070678_100013061 3300005456 Bacteria 5191
65 Ga0070662_100009181 3300005457 Bacteria 6456
66 Ga0070662_100017631 3300005457 Bacteria 4818
67 Ga0070662_100018296 3300005457 Bacteria 4738
68 Ga0070662_100087124 3300005457 Bacteria 2337
69 Ga0070662_100227704 3300005457 Bacteria 1490
70 Ga0068867_100010099 3300005459 Bacteria 6653
71 Ga0068867_100191501 3300005459 Bacteria 1632
72 Ga0070684_100030763 3300005535 Bacteria 4565
73 Ga0068853_100047060 3300005539 Bacteria 3701
74 Ga0068853_100164153 3300005539 Bacteria 2006
75 Ga0068853_100258520 3300005539 Bacteria 1600
76 Ga0070672_100002340 3300005543 Bacteria 11982
77 Ga0070672_100002525 3300005543 Bacteria 11648
78 Ga0070672_100254720 3300005543 Bacteria 1479
79 Ga0070665_100053988 3300005548 Bacteria 4030
80 Ga0070665_100570603 3300005548 Bacteria 1144
81 Ga0070664_100010612 3300005564 Bacteria 7465
82 Ga0070664_100020123 3300005564 Bacteria 5494
83 Ga0070664_100030014 3300005564 Bacteria 4534
84 Ga0070664_100042361 3300005564 Bacteria 3844
85 Ga0068857_100002400 3300005577 Bacteria 15273
86 Ga0068857_100006185 3300005577 Bacteria 10233
87 Ga0068857_100061045 3300005577 Bacteria 3349
88 Ga0068857_100180735 3300005577 Bacteria 1920
89 Ga0068854_100021395 3300005578 Bacteria 4389
90 Ga0068854_100063130 3300005578 Bacteria 2688
91 Ga0068854_100066983 3300005578 Bacteria 2615
92 Ga0068854_100181209 3300005578 Bacteria 1645
93 Ga0068856_100548076 3300005614 Bacteria 1178
94 Ga0068852_100001822 3300005616 Bacteria 14491
95 Ga0068852_100015269 3300005616 Bacteria 5948
96 Ga0068852_100033274 3300005616 Bacteria 4278
97 Ga0068852_100265524 3300005616 Bacteria 1650
98 Ga0068852_100369145 3300005616 Bacteria 1405
99 Ga0068859_100033630 3300005617 Bacteria 5149
100 Ga0068859_100201486 3300005617 Bacteria 2075
101 Ga0068864_100002309 3300005618 Bacteria 15778
102 Ga0068864_100003157 3300005618 Bacteria 13623
103 Ga0068864_100010134 3300005618 Bacteria 7781
104 Ga0068866_10062190 3300005718 Bacteria 1942
105 Ga0068866_10076974 3300005718 Bacteria 1780
106 Ga0068861_100363858 3300005719 Bacteria 1273
107 Ga0068851_10020093 3300005834 Bacteria 3230
108 Ga0068851_10048310 3300005834 Bacteria 2156
109 Ga0068851_10088731 3300005834 Bacteria 1625
110 Ga0068863_100008753 3300005841 Bacteria 9883
111 Ga0068863_100014029 3300005841 Bacteria 7719
112 Ga0068858_100016866 3300005842 Bacteria 6858
113 Ga0068858_100020431 3300005842 Bacteria 6192
114 Ga0068860_100115768 3300005843 Bacteria 2564
115 Ga0068862_100060368 3300005844 Bacteria 3257
116 Ga0081539_10128831 3300005985 Bacteria 1246
117 Ga0070717_10146343 3300006028 Bacteria 2041
118 Ga0075362_10117539 3300006177 Bacteria 1256
119 Ga0097621_100011743 3300006237 Bacteria 6468
120 Ga0097621_100025728 3300006237 Bacteria 4607
121 Ga0097621_100131998 3300006237 Bacteria 2127
122 Ga0097621_100406458 3300006237 Bacteria 1220
123 Ga0068871_100003418 3300006358 Bacteria 10915
124 Ga0068865_100002786 3300006881 Bacteria 10384
125 Ga0068865_100003011 3300006881 Bacteria 10063
126 Ga0068865_100064471 3300006881 Bacteria 2579
127 Ga0097620_100033627 3300006931 Bacteria 5149
128 Ga0097620_100201498 3300006931 Bacteria 2075
129 Ga0105240_10052853 3300009093 Bacteria 5104
130 Ga0105240_10243482 3300009093 Bacteria 2084
131 Ga0105245_10012462 3300009098 Bacteria 7399
132 Ga0105245_10088412 3300009098 Bacteria 2846
133 Ga0105243_10199044 3300009148 Bacteria 1755
134 Ga0105241_10154871 3300009174 Bacteria 1878
135 Ga0105242_10003308 3300009176 Bacteria 12547
136 Ga0105248_10001494 3300009177 Bacteria 26021
137 Ga0105248_10006331 3300009177 Bacteria 12988
138 Ga0105248_10161260 3300009177 Bacteria 2529
139 Ga0105248_10180586 3300009177 Bacteria 2378
140 Ga0105248_10316452 3300009177 Bacteria 1758
141 Ga0105237_10027805 3300009545 Bacteria 5764
142 Ga0105238_10008144 3300009551 Bacteria 10483
143 Ga0105238_10038697 3300009551 Bacteria 4843
144 Ga0105249_10647977 3300009553 Bacteria 1114
145 Ga0105239_10087185 3300010375 Bacteria 3441
146 Ga0105246_10052609 3300011119 Bacteria 2799
147 Ga0105246_10505630 3300011119 Bacteria 1027
148 Ga0157373_10009371 3300013100 Bacteria 7235
149 Ga0157373_10028733 3300013100 Bacteria 4010
150 Ga0157373_10071924 3300013100 Bacteria 2442
151 Ga0157373_10167732 3300013100 Bacteria 1545
152 Ga0157371_10121181 3300013102 Bacteria 1860
153 Ga0157371_10126062 3300013102 Bacteria 1821
154 Ga0157371_10262186 3300013102 Bacteria 1246
155 Ga0157370_10002132 3300013104 Bacteria 24152
156 Ga0157369_10010201 3300013105 Bacteria 10718
157 Ga0157369_10133344 3300013105 Bacteria 2631
158 Ga0157374_10019892 3300013296 Bacteria 5949
159 Ga0157374_10082739 3300013296 Bacteria 3048
160 Ga0157374_10115702 3300013296 Bacteria 2583
161 Ga0157374_10131984 3300013296 Bacteria 2418
162 Ga0157378_10009310 3300013297 Bacteria 8556
163 Ga0157378_10048255 3300013297 Bacteria 3786
164 Ga0157378_10086697 3300013297 Bacteria 2838
165 Ga0157378_10317195 3300013297 Bacteria 1513
166 Ga0163162_10019478 3300013306 Bacteria 6657
167 Ga0163162_10024015 3300013306 Bacteria 6016
168 Ga0163162_10032880 3300013306 Bacteria 5151
169 Ga0163162_10129364 3300013306 Bacteria 2633
170 Ga0157372_10021307 3300013307 Bacteria 7001
171 Ga0157372_10221918 3300013307 Bacteria 2191
172 Ga0157372_10618803 3300013307 Bacteria 1262
173 Ga0157375_10007721 3300013308 Bacteria 9415
174 Ga0157375_10018918 3300013308 Bacteria 6253
175 Ga0157375_10059996 3300013308 Bacteria 3770
176 Ga0157375_10090337 3300013308 Bacteria 3121
177 Ga0163163_10002645 3300014325 Bacteria 15158
178 Ga0163163_10028520 3300014325 Bacteria 5361
179 Ga0163163_10109588 3300014325 Bacteria 2788
180 Ga0182008_10088237 3300014497 Bacteria 1528
181 Ga0157377_10202175 3300014745 Bacteria 1262
182 Ga0157379_10010111 3300014968 Bacteria 8225
183 Ga0157376_10002926 3300014969 Bacteria 11717
184 Ga0207697_10013441 3300025315 Bacteria 3416
185 Ga0207697_10052158 3300025315 Bacteria 1692
186 Ga0207682_10020124 3300025893 Bacteria 2618
187 Ga0207642_10075690 3300025899 Bacteria 1617
188 Ga0207688_10004520 3300025901 Bacteria 7572
189 Ga0207647_10001452 3300025904 Bacteria 18194
190 Ga0207647_10007265 3300025904 Bacteria 8018
191 Ga0207647_10015410 3300025904 Bacteria 5241
192 Ga0207643_10022846 3300025908 Bacteria 3446
193 Ga0207705_10000475 3300025909 Bacteria 34403
194 Ga0207705_10011041 3300025909 Bacteria 6550
195 Ga0207705_10205409 3300025909 Bacteria 1493
196 Ga0207695_10063623 3300025913 Bacteria 3803
197 Ga0207671_10078157 3300025914 Bacteria 2478
198 Ga0207660_10154733 3300025917 Bacteria 1764
199 Ga0207657_10000919 3300025919 Bacteria 31133
200 Ga0207657_10005161 3300025919 Bacteria 13700
201 Ga0207657_10005933 3300025919 Bacteria 12714
202 Ga0207657_10006910 3300025919 Bacteria 11706
203 Ga0207657_10039871 3300025919 Bacteria 4168
204 Ga0207657_10121244 3300025919 Bacteria 2151
205 Ga0207657_10181146 3300025919 Bacteria 1703
206 Ga0207649_10002717 3300025920 Bacteria 9805
207 Ga0207649_10022408 3300025920 Bacteria 3649
208 Ga0207649_10040650 3300025920 Bacteria 2828
209 Ga0207649_10100025 3300025920 Bacteria 1917
210 Ga0207694_10046515 3300025924 Bacteria 3354
211 Ga0207650_10003728 3300025925 Bacteria 10424
212 Ga0207650_10007235 3300025925 Bacteria 7559
213 Ga0207650_10176106 3300025925 Bacteria 1702
214 Ga0207659_10113403 3300025926 Bacteria 2064
215 Ga0207659_10132070 3300025926 Bacteria 1928
216 Ga0207687_10004771 3300025927 Bacteria 9017
217 Ga0207700_10148085 3300025928 Bacteria 1937
218 Ga0207644_10000522 3300025931 Bacteria 24894
219 Ga0207644_10000744 3300025931 Bacteria 20651
220 Ga0207644_10001113 3300025931 Bacteria 17260
221 Ga0207644_10001832 3300025931 Bacteria 13807
222 Ga0207644_10140228 3300025931 Bacteria 1861
223 Ga0207690_10007049 3300025932 Bacteria 6669
224 Ga0207690_10022770 3300025932 Bacteria 3901
225 Ga0207690_10023595 3300025932 Bacteria 3841
226 Ga0207690_10092431 3300025932 Bacteria 2141
227 Ga0207706_10001627 3300025933 Bacteria 22270
228 Ga0207706_10001832 3300025933 Bacteria 20857
229 Ga0207706_10003071 3300025933 Bacteria 16064
230 Ga0207706_10033298 3300025933 Bacteria 4588
231 Ga0207706_10057532 3300025933 Bacteria 3425
232 Ga0207706_10289534 3300025933 Bacteria 1428
233 Ga0207709_10261299 3300025935 Bacteria 1270
234 Ga0207669_10016112 3300025937 Bacteria 3789
235 Ga0207669_10130394 3300025937 Bacteria 1726
236 Ga0207669_10186247 3300025937 Bacteria 1493
237 Ga0207704_10007755 3300025938 Bacteria 5094
238 Ga0207704_10085824 3300025938 Bacteria 2051
239 Ga0207691_10001381 3300025940 Bacteria 24252
240 Ga0207691_10001970 3300025940 Bacteria 20068
241 Ga0207691_10051372 3300025940 Bacteria 3769
242 Ga0207691_10199652 3300025940 Bacteria 1741
243 Ga0207711_10004917 3300025941 Bacteria 11345
244 Ga0207711_10010222 3300025941 Bacteria 7792
245 Ga0207711_10015974 3300025941 Bacteria 6227
246 Ga0207711_10244844 3300025941 Bacteria 1645
247 Ga0207689_10495128 3300025942 Bacteria 1024
248 Ga0207661_10038477 3300025944 Bacteria 3749
249 Ga0207679_10013960 3300025945 Bacteria 5267
250 Ga0207679_10016870 3300025945 Bacteria 4856
251 Ga0207679_10041905 3300025945 Bacteria 3286
252 Ga0207679_10205790 3300025945 Bacteria 1647
253 Ga0207667_10002705 3300025949 Bacteria 21934
254 Ga0207667_10122628 3300025949 Bacteria 2678
255 Ga0207651_10212729 3300025960 Bacteria 1557
256 Ga0207651_10346303 3300025960 Bacteria 1250
257 Ga0207640_10031644 3300025981 Bacteria 3272
258 Ga0207640_10061097 3300025981 Bacteria 2494
259 Ga0207640_10203250 3300025981 Bacteria 1503
260 Ga0207658_10020918 3300025986 Bacteria 4534
261 Ga0207658_10061395 3300025986 Bacteria 2809
262 Ga0207658_10174739 3300025986 Bacteria 1773
263 Ga0207677_10005869 3300026023 Bacteria 6681
264 Ga0207677_10044849 3300026023 Bacteria 2949
265 Ga0207677_10127337 3300026023 Bacteria 1927
266 Ga0207639_10023082 3300026041 Bacteria 4488
267 Ga0207639_10159567 3300026041 Bacteria 1899
268 Ga0207678_10079449 3300026067 Bacteria 2809
269 Ga0207678_10094600 3300026067 Bacteria 2553
270 Ga0207678_10304147 3300026067 Bacteria 1371
271 Ga0207641_10008123 3300026088 Bacteria 8690
272 Ga0207641_10018468 3300026088 Bacteria 5717
273 Ga0207641_10065329 3300026088 Bacteria 3112
274 Ga0207648_10002294 3300026089 Bacteria 20667
275 Ga0207648_10056491 3300026089 Bacteria 3425
276 Ga0207648_10193606 3300026089 Bacteria 1803
277 Ga0207676_10006903 3300026095 Bacteria 8046
278 Ga0207676_10017039 3300026095 Bacteria 5263
279 Ga0207676_10037630 3300026095 Bacteria 3688
280 Ga0207674_10000725 3300026116 Bacteria 43126
281 Ga0207674_10005100 3300026116 Bacteria 15681
282 Ga0207674_10005725 3300026116 Bacteria 14735
283 Ga0207683_10006429 3300026121 Bacteria 10062
284 Ga0207683_10013889 3300026121 Bacteria 6867
285 Ga0207683_10024585 3300026121 Bacteria 5189
286 Ga0207683_10053751 3300026121 Bacteria 3532
287 Ga0207698_10011182 3300026142 Bacteria 5807
288 Ga0207698_10022529 3300026142 Bacteria 4380
289 Ga0207698_10040484 3300026142 Bacteria 3463
290 Ga0207698_10048912 3300026142 Bacteria 3214
291 Ga0207698_10165106 3300026142 Bacteria 1942
292 Ga0268266_10014788 3300028379 Bacteria 6704
293 Ga0268266_10075571 3300028379 Bacteria 2926
294 Ga0268265_10083771 3300028380 Bacteria 2526
295 Ga0307405_10008360 3300031731 Bacteria 5239
296 Ga0307410_10501772 3300031852 Bacteria 998
297 Ga0307416_100000569 3300032002 Bacteria 18881
298 Ga0307416_100160099 3300032002 Bacteria 2079
299 Ga0307414_10020146 3300032004 Bacteria 4151
300 Ga0373937_0254875 3300036401 Bacteria 1654
301 Ga0395899_0000432 3300037312 Bacteria 48281
302 Ga0395899_0016019 3300037312 Bacteria 5717
303 Ga0395899_0030225 3300037312 Bacteria 4075
304 Ga0395899_0055079 3300037312 Bacteria 2942
305 Ga0395900_0000432 3300037418 Bacteria 60134
306 Ga0395900_0001148 3300037418 Bacteria 33301
307 Ga0395900_0039357 3300037418 Bacteria 4871
308 Ga0395900_0069601 3300037418 Bacteria 3617
309 Ga0395900_0088568 3300037418 Bacteria 3182
310 Ga0395900_0090486 3300037418 Bacteria 3145
311 Ga0395900_0091093 3300037418 Bacteria 3133
312 Ga0395900_0094463 3300037418 Bacteria 3072
313 Ga0395900_0100303 3300037418 Bacteria 2974
314 Ga0395900_0115288 3300037418 Bacteria 2757
315 Ga0395900_0197491 3300037418 Bacteria 2037
316 Ga0395900_0239121 3300037418 Bacteria 1822
317 Ga0395900_0328462 3300037418 Bacteria 1508
318 Ga0395898_0000021 3300037466 Bacteria 393971
319 Ga0395898_0034924 3300037466 Bacteria 5003
320 Ga0395898_0086129 3300037466 Bacteria 3028
321 Ga0395898_0111778 3300037466 Bacteria 2618
322 Ga0395898_0194394 3300037466 Bacteria 1938
323 Ga0395905_0000413 3300037471 Bacteria 60132
324 Ga0395905_0000649 3300037471 Bacteria 46291
325 Ga0395905_0004444 3300037471 Bacteria 14575
326 Ga0395905_0005169 3300037471 Bacteria 13387
327 Ga0395905_0017192 3300037471 Bacteria 6870
328 Ga0395905_0041687 3300037471 Bacteria 4308
329 Ga0395905_0045062 3300037471 Bacteria 4137
330 Ga0395905_0047289 3300037471 Bacteria 4033
331 Ga0395905_0056746 3300037471 Bacteria 3663
332 Ga0395905_0086870 3300037471 Bacteria 2932
333 Ga0395905_0102455 3300037471 Bacteria 2687
334 Ga0395905_0169216 3300037471 Bacteria 2052
335 Ga0395905_0531097 3300037471 Bacteria 1077
336 Ga0395905_0594611 3300037471 Bacteria 1008
337 Ga0395901_0000476 3300038443 Bacteria 46589
338 Ga0395901_0010511 3300038443 Bacteria 9374
339 Ga0395901_0036122 3300038443 Bacteria 5105
340 Ga0395901_0076546 3300038443 Bacteria 3491
341 Ga0395901_0085249 3300038443 Bacteria 3302
342 Ga0395901_0178303 3300038443 Bacteria 2228
343 Ga0395901_0259943 3300038443 Bacteria 1807
344 Ga0395901_0302073 3300038443 Bacteria 1659
345 Ga0395901_0324837 3300038443 Bacteria 1591
346 Ga0395901_0330754 3300038443 Bacteria 1575
347 Ga0439458_0000231 3300042157 Bacteria 13292
348 Ga0439458_0000814 3300042157 Bacteria 8018
349 Ga0439458_0038029 3300042157 Bacteria 1161
350 Ga0466969_0035024 3300044656 Bacteria 2542
351 Ga0466959_0103248 3300045049 Bacteria 2039
352 Ga0466967_0294927 3300045976 Bacteria 1559
353 Ga0495663_0003568 3300046525 Bacteria 4474
354 Ga0495621_0003418 3300046539 Bacteria 4386
355 Ga0495677_0001639 3300047445 Bacteria 8998
356 Ga0496100_0035259 3300048903 Bacteria 3145
357 Ga0496100_0142320 3300048903 Bacteria 1701
358 Ga0496101_0009079 3300048904 Bacteria 6521
359 Ga0496102_0020465 3300048905 Bacteria 5847
360 Ga0496102_0058000 3300048905 Bacteria 3537
361 Ga0496106_0444978 3300048909 Bacteria 1041
362 Ga0496107_0001637 3300048910 Bacteria 13959
363 Ga0496107_0041492 3300048910 Bacteria 3304
364 Ga0496107_0060236 3300048910 Bacteria 2747
365 Ga0496107_0140674 3300048910 Bacteria 1784
366 Ga0496108_0002271 3300048911 Bacteria 15400
367 Ga0496108_0115054 3300048911 Bacteria 2303
368 Ga0496109_0014399 3300048912 Bacteria 6882
369 Ga0496109_0132111 3300048912 Bacteria 2331
370 Ga0496109_0143709 3300048912 Bacteria 2231
371 Ga0496110_0007769 3300048913 Bacteria 8589
372 Ga0496110_0016392 3300048913 Bacteria 6186
373 Ga0496110_0064923 3300048913 Bacteria 3227
374 Ga0496111_0058138 3300048914 Bacteria 2799
375 Ga0496111_0329983 3300048914 Bacteria 1130
376 Ga0496112_0010155 3300048915 Bacteria 8530
377 Ga0496112_0021670 3300048915 Bacteria 6112
378 Ga0496112_0047822 3300048915 Bacteria 4196
379 Ga0496113_0002378 3300048916 Bacteria 10913
380 Ga0496113_0006537 3300048916 Bacteria 7400
381 Ga0496113_0025766 3300048916 Bacteria 4196
382 Ga0496113_0042922 3300048916 Bacteria 3343
383 Ga0496114_0000023 3300048917 Bacteria 219092
384 Ga0501069_0130466 3300049585 Bacteria 1439

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005366 Ga0070659_100140310 Ga0070659_1001403102 231
2 3300005434 Ga0070709_10065820 Ga0070709_100658203 247
3 3300005435 Ga0070714_100049213 Ga0070714_1000492133 247
4 3300005436 Ga0070713_100108444 Ga0070713_1001084443 247
5 3300005439 Ga0070711_100394312 Ga0070711_1003943121 247
6 3300006028 Ga0070717_10146343 Ga0070717_101463433 247
7 3300025928 Ga0207700_10148085 Ga0207700_101480852 247
8 3300005985 Ga0081539_10128831 Ga0081539_101288312 253
9 3300038443 Ga0395901_0259943 Ga0395901_0259943_692_1555 253
10 3300014497 Ga0182008_10088237 Ga0182008_100882372 257
11 3300025981 Ga0207640_10031644 Ga0207640_100316445 257
12 3300005339 Ga0070660_100195111 Ga0070660_1001951112 258
13 3300005354 Ga0070675_100119850 Ga0070675_1001198502 258
14 3300005356 Ga0070674_100161997 Ga0070674_1001619971 258
15 3300005364 Ga0070673_100484852 Ga0070673_1004848522 258
16 3300005367 Ga0070667_100203105 Ga0070667_1002031052 258
17 3300005548 Ga0070665_100053988 Ga0070665_1000539883 258
18 3300006237 Ga0097621_100131998 Ga0097621_1001319982 258
19 3300009177 Ga0105248_10316452 Ga0105248_103164523 258
20 3300011119 Ga0105246_10505630 Ga0105246_105056301 258
21 3300013296 Ga0157374_10115702 Ga0157374_101157023 258
22 3300013306 Ga0163162_10129364 Ga0163162_101293642 258
23 3300013308 Ga0157375_10090337 Ga0157375_100903373 258
24 3300025315 Ga0207697_10052158 Ga0207697_100521582 258
25 3300025919 Ga0207657_10181146 Ga0207657_101811462 258
26 3300025926 Ga0207659_10113403 Ga0207659_101134032 258
27 3300025937 Ga0207669_10130394 Ga0207669_101303942 258
28 3300025941 Ga0207711_10244844 Ga0207711_102448441 258
29 3300025960 Ga0207651_10212729 Ga0207651_102127292 258
30 3300028379 Ga0268266_10075571 Ga0268266_100755712 258
31 3300001976 JGI24752J21851_1004059 JGI24752J21851_10040593 259
32 3300001989 JGI24739J22299_10010073 JGI24739J22299_100100735 259
33 3300001990 JGI24737J22298_10000172 JGI24737J22298_1000017220 259
34 3300001990 JGI24737J22298_10001166 JGI24737J22298_100011664 259
35 3300001990 JGI24737J22298_10032463 JGI24737J22298_100324632 259
36 3300002073 JGI24745J21846_1001435 JGI24745J21846_10014353 259
37 3300002077 JGI24744J21845_10019765 JGI24744J21845_100197652 259
38 3300002239 JGI24034J26672_10006866 JGI24034J26672_100068662 259
39 3300005293 Ga0065715_10165652 Ga0065715_101656521 259
40 3300005327 Ga0070658_10036686 Ga0070658_100366864 259
41 3300005327 Ga0070658_10038193 Ga0070658_100381935 259
42 3300005327 Ga0070658_10048204 Ga0070658_100482043 259
43 3300005328 Ga0070676_10021919 Ga0070676_100219193 259
44 3300005329 Ga0070683_100037821 Ga0070683_1000378213 259
45 3300005331 Ga0070670_100013595 Ga0070670_1000135954 259
46 3300005331 Ga0070670_100018265 Ga0070670_1000182654 259
47 3300005333 Ga0070677_10076351 Ga0070677_100763512 259
48 3300005334 Ga0068869_100506333 Ga0068869_1005063331 259
49 3300005335 Ga0070666_10015985 Ga0070666_100159853 259
50 3300005335 Ga0070666_10017759 Ga0070666_100177595 259
51 3300005335 Ga0070666_10052317 Ga0070666_100523172 259
52 3300005338 Ga0068868_100031808 Ga0068868_1000318083 259
53 3300005338 Ga0068868_100178990 Ga0068868_1001789902 259
54 3300005339 Ga0070660_100001509 Ga0070660_1000015097 259
55 3300005339 Ga0070660_100023985 Ga0070660_1000239853 259
56 3300005339 Ga0070660_100078800 Ga0070660_1000788002 259
57 3300005339 Ga0070660_100217484 Ga0070660_1002174842 259
58 3300005339 Ga0070660_100284758 Ga0070660_1002847582 259
59 3300005341 Ga0070691_10000966 Ga0070691_1000096612 259
60 3300005344 Ga0070661_100003586 Ga0070661_1000035865 259
61 3300005344 Ga0070661_100004643 Ga0070661_1000046435 259
62 3300005344 Ga0070661_100027778 Ga0070661_1000277783 259
63 3300005354 Ga0070675_100116381 Ga0070675_1001163812 259
64 3300005354 Ga0070675_100479898 Ga0070675_1004798982 259
65 3300005355 Ga0070671_100002442 Ga0070671_1000024424 259
66 3300005355 Ga0070671_100043168 Ga0070671_1000431683 259
67 3300005355 Ga0070671_100066503 Ga0070671_1000665033 259
68 3300005355 Ga0070671_100153832 Ga0070671_1001538322 259
69 3300005356 Ga0070674_100067354 Ga0070674_1000673543 259
70 3300005364 Ga0070673_100024424 Ga0070673_1000244243 259
71 3300005364 Ga0070673_100028540 Ga0070673_1000285402 259
72 3300005364 Ga0070673_100057079 Ga0070673_1000570792 259
73 3300005364 Ga0070673_100284590 Ga0070673_1002845902 259
74 3300005366 Ga0070659_100001907 Ga0070659_1000019072 259
75 3300005366 Ga0070659_100012067 Ga0070659_1000120674 259
76 3300005366 Ga0070659_100022212 Ga0070659_1000222124 259
77 3300005366 Ga0070659_100268711 Ga0070659_1002687111 259
78 3300005367 Ga0070667_100001032 Ga0070667_1000010328 259
79 3300005367 Ga0070667_100002148 Ga0070667_10000214811 259
80 3300005435 Ga0070714_100219667 Ga0070714_1002196672 259
81 3300005455 Ga0070663_100031587 Ga0070663_1000315874 259
82 3300005455 Ga0070663_100350692 Ga0070663_1003506921 259
83 3300005456 Ga0070678_100000889 Ga0070678_1000008893 259
84 3300005456 Ga0070678_100013061 Ga0070678_1000130614 259
85 3300005457 Ga0070662_100009181 Ga0070662_1000091816 259
86 3300005457 Ga0070662_100017631 Ga0070662_1000176316 259
87 3300005457 Ga0070662_100018296 Ga0070662_1000182963 259
88 3300005457 Ga0070662_100087124 Ga0070662_1000871242 259
89 3300005457 Ga0070662_100227704 Ga0070662_1002277042 259
90 3300005459 Ga0068867_100010099 Ga0068867_1000100993 259
91 3300005459 Ga0068867_100191501 Ga0068867_1001915012 259
92 3300005535 Ga0070684_100030763 Ga0070684_1000307633 259
93 3300005539 Ga0068853_100047060 Ga0068853_1000470603 259
94 3300005539 Ga0068853_100164153 Ga0068853_1001641532 259
95 3300005539 Ga0068853_100258520 Ga0068853_1002585202 259
96 3300005543 Ga0070672_100002340 Ga0070672_10000234010 259
97 3300005543 Ga0070672_100002525 Ga0070672_1000025258 259
98 3300005543 Ga0070672_100254720 Ga0070672_1002547202 259
99 3300005548 Ga0070665_100570603 Ga0070665_1005706032 259
100 3300005564 Ga0070664_100010612 Ga0070664_1000106127 259
101 3300005564 Ga0070664_100020123 Ga0070664_1000201234 259
102 3300005564 Ga0070664_100030014 Ga0070664_1000300144 259
103 3300005564 Ga0070664_100042361 Ga0070664_1000423614 259
104 3300005577 Ga0068857_100002400 Ga0068857_10000240011 259
105 3300005577 Ga0068857_100006185 Ga0068857_1000061852 259
106 3300005577 Ga0068857_100061045 Ga0068857_1000610453 259
107 3300005577 Ga0068857_100180735 Ga0068857_1001807352 259
108 3300005578 Ga0068854_100021395 Ga0068854_1000213955 259
109 3300005578 Ga0068854_100063130 Ga0068854_1000631302 259
110 3300005578 Ga0068854_100066983 Ga0068854_1000669832 259
111 3300005578 Ga0068854_100181209 Ga0068854_1001812092 259
112 3300005614 Ga0068856_100548076 Ga0068856_1005480762 259
113 3300005616 Ga0068852_100001822 Ga0068852_1000018228 259
114 3300005616 Ga0068852_100015269 Ga0068852_1000152693 259
115 3300005616 Ga0068852_100033274 Ga0068852_1000332742 259
116 3300005616 Ga0068852_100265524 Ga0068852_1002655241 259
117 3300005616 Ga0068852_100369145 Ga0068852_1003691452 259
118 3300005617 Ga0068859_100033630 Ga0068859_1000336305 259
119 3300005617 Ga0068859_100201486 Ga0068859_1002014862 259
120 3300005618 Ga0068864_100002309 Ga0068864_1000023095 259
121 3300005618 Ga0068864_100003157 Ga0068864_1000031574 259
122 3300005618 Ga0068864_100010134 Ga0068864_1000101344 259
123 3300005718 Ga0068866_10062190 Ga0068866_100621901 259
124 3300005718 Ga0068866_10076974 Ga0068866_100769742 259
125 3300005719 Ga0068861_100363858 Ga0068861_1003638581 259
126 3300005834 Ga0068851_10020093 Ga0068851_100200933 259
127 3300005834 Ga0068851_10048310 Ga0068851_100483102 259
128 3300005834 Ga0068851_10088731 Ga0068851_100887312 259
129 3300005841 Ga0068863_100008753 Ga0068863_1000087536 259
130 3300005841 Ga0068863_100014029 Ga0068863_1000140296 259
131 3300005842 Ga0068858_100016866 Ga0068858_1000168663 259
132 3300005842 Ga0068858_100020431 Ga0068858_1000204315 259
133 3300005843 Ga0068860_100115768 Ga0068860_1001157682 259
134 3300005844 Ga0068862_100060368 Ga0068862_1000603682 259
135 3300006177 Ga0075362_10117539 Ga0075362_101175392 259
136 3300006237 Ga0097621_100011743 Ga0097621_1000117435 259
137 3300006237 Ga0097621_100025728 Ga0097621_1000257283 259
138 3300006237 Ga0097621_100406458 Ga0097621_1004064581 259
139 3300006358 Ga0068871_100003418 Ga0068871_1000034183 259
140 3300006881 Ga0068865_100002786 Ga0068865_1000027862 259
141 3300006881 Ga0068865_100003011 Ga0068865_1000030113 259
142 3300006881 Ga0068865_100064471 Ga0068865_1000644712 259
143 3300006931 Ga0097620_100033627 Ga0097620_1000336275 259
144 3300006931 Ga0097620_100201498 Ga0097620_1002014982 259
145 3300009093 Ga0105240_10052853 Ga0105240_100528532 259
146 3300009093 Ga0105240_10243482 Ga0105240_102434822 259
147 3300009098 Ga0105245_10012462 Ga0105245_100124625 259
148 3300009098 Ga0105245_10088412 Ga0105245_100884122 259
149 3300009148 Ga0105243_10199044 Ga0105243_101990442 259
150 3300009174 Ga0105241_10154871 Ga0105241_101548712 259
151 3300009176 Ga0105242_10003308 Ga0105242_100033089 259
152 3300009177 Ga0105248_10001494 Ga0105248_100014947 259
153 3300009177 Ga0105248_10006331 Ga0105248_100063319 259
154 3300009177 Ga0105248_10161260 Ga0105248_101612602 259
155 3300009177 Ga0105248_10180586 Ga0105248_101805862 259
156 3300009545 Ga0105237_10027805 Ga0105237_100278053 259
157 3300009551 Ga0105238_10008144 Ga0105238_100081449 259
158 3300009551 Ga0105238_10038697 Ga0105238_100386973 259
159 3300009553 Ga0105249_10647977 Ga0105249_106479771 259
160 3300010375 Ga0105239_10087185 Ga0105239_100871853 259
161 3300011119 Ga0105246_10052609 Ga0105246_100526092 259
162 3300013100 Ga0157373_10009371 Ga0157373_100093715 259
163 3300013100 Ga0157373_10028733 Ga0157373_100287332 259
164 3300013100 Ga0157373_10071924 Ga0157373_100719242 259
165 3300013100 Ga0157373_10167732 Ga0157373_101677322 259
166 3300013102 Ga0157371_10121181 Ga0157371_101211813 259
167 3300013102 Ga0157371_10126062 Ga0157371_101260622 259
168 3300013102 Ga0157371_10262186 Ga0157371_102621861 259
169 3300013104 Ga0157370_10002132 Ga0157370_1000213218 259
170 3300013105 Ga0157369_10010201 Ga0157369_100102017 259
171 3300013105 Ga0157369_10133344 Ga0157369_101333442 259
172 3300013296 Ga0157374_10019892 Ga0157374_100198922 259
173 3300013296 Ga0157374_10082739 Ga0157374_100827393 259
174 3300013296 Ga0157374_10131984 Ga0157374_101319842 259
175 3300013297 Ga0157378_10009310 Ga0157378_100093103 259
176 3300013297 Ga0157378_10048255 Ga0157378_100482554 259
177 3300013297 Ga0157378_10086697 Ga0157378_100866971 259
178 3300013297 Ga0157378_10317195 Ga0157378_103171952 259
179 3300013306 Ga0163162_10019478 Ga0163162_100194789 259
180 3300013306 Ga0163162_10024015 Ga0163162_100240153 259
181 3300013306 Ga0163162_10032880 Ga0163162_100328804 259
182 3300013307 Ga0157372_10021307 Ga0157372_100213075 259
183 3300013307 Ga0157372_10221918 Ga0157372_102219183 259
184 3300013307 Ga0157372_10618803 Ga0157372_106188031 259
185 3300013308 Ga0157375_10007721 Ga0157375_1000772111 259
186 3300013308 Ga0157375_10018918 Ga0157375_100189183 259
187 3300013308 Ga0157375_10059996 Ga0157375_100599962 259
188 3300014325 Ga0163163_10002645 Ga0163163_100026452 259
189 3300014325 Ga0163163_10028520 Ga0163163_100285203 259
190 3300014325 Ga0163163_10109588 Ga0163163_101095883 259
191 3300014745 Ga0157377_10202175 Ga0157377_102021752 259
192 3300014968 Ga0157379_10010111 Ga0157379_100101114 259
193 3300014969 Ga0157376_10002926 Ga0157376_100029262 259
194 3300025315 Ga0207697_10013441 Ga0207697_100134414 259
195 3300025893 Ga0207682_10020124 Ga0207682_100201243 259
196 3300025899 Ga0207642_10075690 Ga0207642_100756901 259
197 3300025901 Ga0207688_10004520 Ga0207688_100045205 259
198 3300025904 Ga0207647_10001452 Ga0207647_100014528 259
199 3300025904 Ga0207647_10007265 Ga0207647_100072656 259
200 3300025904 Ga0207647_10015410 Ga0207647_100154105 259
201 3300025908 Ga0207643_10022846 Ga0207643_100228464 259
202 3300025909 Ga0207705_10000475 Ga0207705_1000047523 259
203 3300025909 Ga0207705_10011041 Ga0207705_100110414 259
204 3300025909 Ga0207705_10205409 Ga0207705_102054092 259
205 3300025913 Ga0207695_10063623 Ga0207695_100636233 259
206 3300025914 Ga0207671_10078157 Ga0207671_100781573 259
207 3300025917 Ga0207660_10154733 Ga0207660_101547332 259
208 3300025919 Ga0207657_10000919 Ga0207657_100009193 259
209 3300025919 Ga0207657_10005161 Ga0207657_1000516110 259
210 3300025919 Ga0207657_10005933 Ga0207657_100059339 259
211 3300025919 Ga0207657_10006910 Ga0207657_100069109 259
212 3300025919 Ga0207657_10039871 Ga0207657_100398713 259
213 3300025919 Ga0207657_10121244 Ga0207657_101212442 259
214 3300025920 Ga0207649_10002717 Ga0207649_100027179 259
215 3300025920 Ga0207649_10022408 Ga0207649_100224084 259
216 3300025920 Ga0207649_10040650 Ga0207649_100406502 259
217 3300025920 Ga0207649_10100025 Ga0207649_101000252 259
218 3300025924 Ga0207694_10046515 Ga0207694_100465152 259
219 3300025925 Ga0207650_10003728 Ga0207650_1000372810 259
220 3300025925 Ga0207650_10007235 Ga0207650_100072357 259
221 3300025925 Ga0207650_10176106 Ga0207650_101761062 259
222 3300025926 Ga0207659_10132070 Ga0207659_101320702 259
223 3300025927 Ga0207687_10004771 Ga0207687_100047713 259
224 3300025931 Ga0207644_10000522 Ga0207644_100005225 259
225 3300025931 Ga0207644_10000744 Ga0207644_100007449 259
226 3300025931 Ga0207644_10001113 Ga0207644_100011134 259
227 3300025931 Ga0207644_10001832 Ga0207644_1000183212 259
228 3300025931 Ga0207644_10140228 Ga0207644_101402282 259
229 3300025932 Ga0207690_10007049 Ga0207690_100070494 259
230 3300025932 Ga0207690_10022770 Ga0207690_100227703 259
231 3300025932 Ga0207690_10023595 Ga0207690_100235953 259
232 3300025932 Ga0207690_10092431 Ga0207690_100924312 259
233 3300025933 Ga0207706_10001627 Ga0207706_1000162717 259
234 3300025933 Ga0207706_10001832 Ga0207706_1000183221 259
235 3300025933 Ga0207706_10003071 Ga0207706_1000307112 259
236 3300025933 Ga0207706_10033298 Ga0207706_100332985 259
237 3300025933 Ga0207706_10057532 Ga0207706_100575323 259
238 3300025933 Ga0207706_10289534 Ga0207706_102895341 259
239 3300025935 Ga0207709_10261299 Ga0207709_102612991 259
240 3300025937 Ga0207669_10016112 Ga0207669_100161123 259
241 3300025937 Ga0207669_10186247 Ga0207669_101862472 259
242 3300025938 Ga0207704_10007755 Ga0207704_100077552 259
243 3300025938 Ga0207704_10085824 Ga0207704_100858243 259
244 3300025940 Ga0207691_10001381 Ga0207691_100013817 259
245 3300025940 Ga0207691_10001970 Ga0207691_100019709 259
246 3300025940 Ga0207691_10051372 Ga0207691_100513723 259
247 3300025940 Ga0207691_10199652 Ga0207691_101996522 259
248 3300025941 Ga0207711_10004917 Ga0207711_100049173 259
249 3300025941 Ga0207711_10010222 Ga0207711_100102229 259
250 3300025941 Ga0207711_10015974 Ga0207711_100159744 259
251 3300025942 Ga0207689_10495128 Ga0207689_104951281 259
252 3300025944 Ga0207661_10038477 Ga0207661_100384773 259
253 3300025945 Ga0207679_10013960 Ga0207679_100139604 259
254 3300025945 Ga0207679_10016870 Ga0207679_100168704 259
255 3300025945 Ga0207679_10041905 Ga0207679_100419053 259
256 3300025945 Ga0207679_10205790 Ga0207679_102057902 259
257 3300025949 Ga0207667_10002705 Ga0207667_100027057 259
258 3300025949 Ga0207667_10122628 Ga0207667_101226282 259
259 3300025960 Ga0207651_10346303 Ga0207651_103463031 259
260 3300025981 Ga0207640_10061097 Ga0207640_100610972 259
261 3300025981 Ga0207640_10203250 Ga0207640_102032502 259
262 3300025986 Ga0207658_10020918 Ga0207658_100209183 259
263 3300025986 Ga0207658_10061395 Ga0207658_100613952 259
264 3300025986 Ga0207658_10174739 Ga0207658_101747392 259
265 3300026023 Ga0207677_10005869 Ga0207677_100058692 259
266 3300026023 Ga0207677_10044849 Ga0207677_100448493 259
267 3300026023 Ga0207677_10127337 Ga0207677_101273371 259
268 3300026041 Ga0207639_10023082 Ga0207639_100230823 259
269 3300026041 Ga0207639_10159567 Ga0207639_101595672 259
270 3300026067 Ga0207678_10079449 Ga0207678_100794493 259
271 3300026067 Ga0207678_10094600 Ga0207678_100946003 259
272 3300026067 Ga0207678_10304147 Ga0207678_103041472 259
273 3300026088 Ga0207641_10008123 Ga0207641_100081235 259
274 3300026088 Ga0207641_10018468 Ga0207641_100184684 259
275 3300026088 Ga0207641_10065329 Ga0207641_100653293 259
276 3300026089 Ga0207648_10002294 Ga0207648_100022943 259
277 3300026089 Ga0207648_10056491 Ga0207648_100564912 259
278 3300026089 Ga0207648_10193606 Ga0207648_101936062 259
279 3300026095 Ga0207676_10006903 Ga0207676_100069034 259
280 3300026095 Ga0207676_10017039 Ga0207676_100170392 259
281 3300026095 Ga0207676_10037630 Ga0207676_100376303 259
282 3300026116 Ga0207674_10000725 Ga0207674_1000072510 259
283 3300026116 Ga0207674_10005100 Ga0207674_100051007 259
284 3300026116 Ga0207674_10005725 Ga0207674_1000572516 259
285 3300026121 Ga0207683_10006429 Ga0207683_100064296 259
286 3300026121 Ga0207683_10013889 Ga0207683_100138893 259
287 3300026121 Ga0207683_10024585 Ga0207683_100245853 259
288 3300026121 Ga0207683_10053751 Ga0207683_100537513 259
289 3300026142 Ga0207698_10011182 Ga0207698_100111823 259
290 3300026142 Ga0207698_10022529 Ga0207698_100225293 259
291 3300026142 Ga0207698_10040484 Ga0207698_100404842 259
292 3300026142 Ga0207698_10048912 Ga0207698_100489125 259
293 3300026142 Ga0207698_10165106 Ga0207698_101651063 259
294 3300028379 Ga0268266_10014788 Ga0268266_100147886 259
295 3300028380 Ga0268265_10083771 Ga0268265_100837712 259
296 3300031731 Ga0307405_10008360 Ga0307405_100083604 259
297 3300031852 Ga0307410_10501772 Ga0307410_105017722 259
298 3300032002 Ga0307416_100000569 Ga0307416_10000056920 259
299 3300032002 Ga0307416_100160099 Ga0307416_1001600992 259
300 3300032004 Ga0307414_10020146 Ga0307414_100201464 259
301 3300036401 Ga0373937_0254875 Ga0373937_0254875_225_1085 259
302 3300037312 Ga0395899_0000432 Ga0395899_0000432_18407_19267 259
303 3300037312 Ga0395899_0016019 Ga0395899_0016019_1886_2677 259
304 3300037312 Ga0395899_0030225 Ga0395899_0030225_1396_2256 259
305 3300037312 Ga0395899_0055079 Ga0395899_0055079_916_1776 259
306 3300037418 Ga0395900_0000432 Ga0395900_0000432_31286_32146 259
307 3300037418 Ga0395900_0001148 Ga0395900_0001148_27653_28444 259
308 3300037418 Ga0395900_0039357 Ga0395900_0039357_781_1644 259
309 3300037418 Ga0395900_0069601 Ga0395900_0069601_1782_2642 259
310 3300037418 Ga0395900_0088568 Ga0395900_0088568_1778_2587 259
311 3300037418 Ga0395900_0090486 Ga0395900_0090486_1252_2112 259
312 3300037418 Ga0395900_0091093 Ga0395900_0091093_200_1060 259
313 3300037418 Ga0395900_0094463 Ga0395900_0094463_87_941 259
314 3300037418 Ga0395900_0100303 Ga0395900_0100303_1222_2118 259
315 3300037418 Ga0395900_0115288 Ga0395900_0115288_1857_2720 259
316 3300037418 Ga0395900_0197491 Ga0395900_0197491_824_1633 259
317 3300037418 Ga0395900_0239121 Ga0395900_0239121_610_1470 259
318 3300037418 Ga0395900_0328462 Ga0395900_0328462_154_1017 259
319 3300037466 Ga0395898_0000021 Ga0395898_0000021_365120_365980 259
320 3300037466 Ga0395898_0034924 Ga0395898_0034924_3325_4185 259
321 3300037466 Ga0395898_0086129 Ga0395898_0086129_1884_2675 259
322 3300037466 Ga0395898_0111778 Ga0395898_0111778_1022_1882 259
323 3300037466 Ga0395898_0194394 Ga0395898_0194394_285_1145 259
324 3300037471 Ga0395905_0000413 Ga0395905_0000413_31286_32146 259
325 3300037471 Ga0395905_0000649 Ga0395905_0000649_15923_16714 259
326 3300037471 Ga0395905_0004444 Ga0395905_0004444_1077_1940 259
327 3300037471 Ga0395905_0005169 Ga0395905_0005169_1851_2711 259
328 3300037471 Ga0395905_0017192 Ga0395905_0017192_2505_3368 259
329 3300037471 Ga0395905_0041687 Ga0395905_0041687_3027_3893 259
330 3300037471 Ga0395905_0045062 Ga0395905_0045062_1732_2592 259
331 3300037471 Ga0395905_0047289 Ga0395905_0047289_366_1175 259
332 3300037471 Ga0395905_0056746 Ga0395905_0056746_2633_3448 259
333 3300037471 Ga0395905_0086870 Ga0395905_0086870_1244_2104 259
334 3300037471 Ga0395905_0102455 Ga0395905_0102455_1733_2593 259
335 3300037471 Ga0395905_0169216 Ga0395905_0169216_1031_1894 259
336 3300037471 Ga0395905_0531097 Ga0395905_0531097_74_1033 259
337 3300037471 Ga0395905_0594611 Ga0395905_0594611_96_956 259
338 3300038443 Ga0395901_0000476 Ga0395901_0000476_31326_32186 259
339 3300038443 Ga0395901_0010511 Ga0395901_0010511_8102_8893 259
340 3300038443 Ga0395901_0036122 Ga0395901_0036122_3438_4298 259
341 3300038443 Ga0395901_0076546 Ga0395901_0076546_2220_3083 259
342 3300038443 Ga0395901_0085249 Ga0395901_0085249_716_1525 259
343 3300038443 Ga0395901_0178303 Ga0395901_0178303_272_1132 259
344 3300038443 Ga0395901_0302073 Ga0395901_0302073_47_856 259
345 3300038443 Ga0395901_0324837 Ga0395901_0324837_693_1553 259
346 3300038443 Ga0395901_0330754 Ga0395901_0330754_198_1058 259
347 3300042157 Ga0439458_0000231 Ga0439458_0000231_3852_4712 259
348 3300042157 Ga0439458_0000814 Ga0439458_0000814_1312_2172 259
349 3300042157 Ga0439458_0038029 Ga0439458_0038029_46_906 259
350 3300044656 Ga0466969_0035024 Ga0466969_0035024_67_927 259
351 3300045049 Ga0466959_0103248 Ga0466959_0103248_353_1213 259
352 3300045976 Ga0466967_0294927 Ga0466967_0294927_191_1048 259
353 3300046525 Ga0495663_0003568 Ga0495663_0003568_3572_4429 259
354 3300046539 Ga0495621_0003418 Ga0495621_0003418_2000_2860 259
355 3300047445 Ga0495677_0001639 Ga0495677_0001639_949_1809 259
356 3300048903 Ga0496100_0035259 Ga0496100_0035259_468_1322 259
357 3300048903 Ga0496100_0142320 Ga0496100_0142320_35_814 259
358 3300048904 Ga0496101_0009079 Ga0496101_0009079_4676_5530 259
359 3300048905 Ga0496102_0020465 Ga0496102_0020465_4294_5148 259
360 3300048905 Ga0496102_0058000 Ga0496102_0058000_822_1601 259
361 3300048909 Ga0496106_0444978 Ga0496106_0444978_160_1014 259
362 3300048910 Ga0496107_0001637 Ga0496107_0001637_5382_6236 259
363 3300048910 Ga0496107_0041492 Ga0496107_0041492_2309_3088 259
364 3300048910 Ga0496107_0060236 Ga0496107_0060236_233_1090 259
365 3300048910 Ga0496107_0140674 Ga0496107_0140674_262_1122 259
366 3300048911 Ga0496108_0002271 Ga0496108_0002271_12198_12977 259
367 3300048911 Ga0496108_0115054 Ga0496108_0115054_1063_1923 259
368 3300048912 Ga0496109_0014399 Ga0496109_0014399_1222_2082 259
369 3300048912 Ga0496109_0132111 Ga0496109_0132111_1298_2158 259
370 3300048912 Ga0496109_0143709 Ga0496109_0143709_645_1424 259
371 3300048913 Ga0496110_0007769 Ga0496110_0007769_6443_7297 259
372 3300048913 Ga0496110_0016392 Ga0496110_0016392_2924_3703 259
373 3300048913 Ga0496110_0064923 Ga0496110_0064923_2084_2944 259
374 3300048914 Ga0496111_0058138 Ga0496111_0058138_1418_2272 259
375 3300048914 Ga0496111_0329983 Ga0496111_0329983_209_988 259
376 3300048915 Ga0496112_0010155 Ga0496112_0010155_3397_4254 259
377 3300048915 Ga0496112_0021670 Ga0496112_0021670_2834_3613 259
378 3300048915 Ga0496112_0047822 Ga0496112_0047822_1811_2671 259
379 3300048916 Ga0496113_0002378 Ga0496113_0002378_4824_5684 259
380 3300048916 Ga0496113_0006537 Ga0496113_0006537_5511_6368 259
381 3300048916 Ga0496113_0025766 Ga0496113_0025766_820_1599 259
382 3300048916 Ga0496113_0042922 Ga0496113_0042922_656_1510 259
383 3300048917 Ga0496114_0000023 Ga0496114_0000023_27597_28457 259
384 3300049585 Ga0501069_0130466 Ga0501069_0130466_426_1286 259

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10502

Peptidase_S26

Signal peptidase, peptidase S26

57

287

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7484 18 224
4n31-assembly1.cif.gz_B structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.7444 69 224
4n31-assembly1.cif.gz_A structure and activity of streptococcus pyogenes sipa: a signal peptidase homologue essential for pilus polymerisation 0.6864 18 224
3s04-assembly3.cif.gz_A crystal structure of escherichia coli type i signal peptidase in complex with an arylomycin lipoglycopeptide antibiotic 0.662 18 231
3s04-assembly3.cif.gz_A crystal structure of escherichia coli type i signal peptidase in complex with an arylomycin lipoglycopeptide antibiotic 0.6346 18 231
ID Description Score Start End Superfamily
af_Q54RP1_162_281_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7733 14 220 2.10.109.10
4n31B00 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7444 69 224 2.10.109.10
af_O04348_174_312_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7298 18 220 2.10.109.10
af_O74800_20_156_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7267 14 227 2.10.109.10
af_O04348_174_312_2.10.109.10 Mainly Beta;Ribbon;Umud Fragment, subunit A;Umud Fragment, subunit A 0.7202 18 220 2.10.109.10
ID Description Score Start End GO Terms
AF-A0A443G007-F1-model_v4 deleted 0.8661 71 221
AF-A0A443G007-F1-model_v4 deleted 0.8413 71 221
AF-A4EYM9-F1-model_v4 Signal peptidase I (EC 3.4.21.89) 0.8403 69 220 GO:0004252
GO:0006465
GO:0016020
AF-A0A6F8Q1V6-F1-model_v4 deleted 0.8379 75 227
AF-A0A7U0SZV8-F1-model_v4 deleted 0.8342 88 201

Feature Viewer

pLDDT pTM Quality
64.14 0.69 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map