F429917

General Info

Members Datasets Scaffolds Average Seq Length
384 232 768 121

Family's Representative Sequence

Representative Sequence 3300025942|Ga0207689_10199727|Ga0207689_101997272
Length 149
Sequence MKTLNEQISDVIQQEPVAVFMKGTPQMIMCGNSHRALQALQAAGAPITAVDILPDPRIRRELSSISGWPTIPQVFVRGELVGGADITEELASSGELQQKLDDVEPSPCARKLKSRLQLPSIRLPFQPSIRIEESLDDIEAAHPGCTFEI

Samples

Sample ID Description Type Environment
1 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
11 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
12 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
33 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
37 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
38 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
39 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
40 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
41 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
44 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
45 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
46 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
49 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
50 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
51 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
52 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
53 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
54 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
55 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
59 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
60 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
61 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
62 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
63 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
64 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
65 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
72 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
73 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
76 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
114 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
118 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
119 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
120 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
121 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
122 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
123 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
124 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
125 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
126 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
127 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
128 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
129 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
130 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
131 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
132 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
133 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
134 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
135 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
136 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
137 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
138 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
139 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
140 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
141 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
142 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
143 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
144 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
145 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
146 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
147 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
148 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
152 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
153 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
154 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
155 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
156 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
157 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
158 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
159 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
160 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
161 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
162 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
168 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
169 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
170 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
173 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
174 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
175 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
176 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
177 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
178 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
179 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
180 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
191 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
192 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
193 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
194 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
200 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
201 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
202 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
203 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 2.34
Rhizosphere 97.66
Stem 0
Stem Tuber 0
Unclassified 13.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207689_10199727 3300025942 Bacteria 1650
2 JGI24751J29686_10022965 3300002459 Bacteria 1293
3 Ga0070676_10248989 3300005328 Bacteria 1185
4 Ga0070683_100229209 3300005329 Bacteria 1766
5 Ga0070690_100508666 3300005330 Unclassified 902
6 Ga0070670_100031437 3300005331 Bacteria 4572
7 Ga0068869_100233596 3300005334 Unclassified 1462
8 Ga0070682_100804321 3300005337 Bacteria 764
9 Ga0068868_100183961 3300005338 Bacteria 1735
10 Ga0070660_100855286 3300005339 Unclassified 766
11 Ga0070689_100021672 3300005340 Bacteria 4788
12 Ga0070687_100249154 3300005343 Bacteria 1103
13 Ga0070692_10240275 3300005345 Bacteria 1079
14 Ga0070668_100204062 3300005347 Bacteria 1624
15 Ga0070668_100411860 3300005347 Unclassified 1156
16 Ga0070668_100748326 3300005347 Bacteria 865
17 Ga0070669_100526586 3300005353 Bacteria 983
18 Ga0070674_100003871 3300005356 Bacteria 8470
19 Ga0070674_100028131 3300005356 Bacteria 3690
20 Ga0070674_100171226 3300005356 Bacteria 1656
21 Ga0070673_100456984 3300005364 Bacteria 1149
22 Ga0070688_100024161 3300005365 Bacteria 3582
23 Ga0070714_100001543 3300005435 Bacteria 16791
24 Ga0070714_102361999 3300005435 Unclassified 517
25 Ga0070711_100978594 3300005439 Bacteria 725
26 Ga0070705_100076754 3300005440 Bacteria 2038
27 Ga0070700_100006301 3300005441 Bacteria 6334
28 Ga0070694_100913447 3300005444 Bacteria 725
29 Ga0070708_100373742 3300005445 Bacteria 1344
30 Ga0070663_100222025 3300005455 Bacteria 1484
31 Ga0070678_100013698 3300005456 Bacteria 5096
32 Ga0068867_100489652 3300005459 Bacteria 1055
33 Ga0070685_10009922 3300005466 Bacteria 4938
34 Ga0070698_100078309 3300005471 Bacteria 3304
35 Ga0070699_100087771 3300005518 Bacteria 2716
36 Ga0070684_100296979 3300005535 Bacteria 1482
37 Ga0070672_100089096 3300005543 Unclassified 2485
38 Ga0070672_101810499 3300005543 Unclassified 549
39 Ga0070686_100008711 3300005544 Bacteria 5685
40 Ga0070665_100050450 3300005548 Bacteria 4175
41 Ga0070704_100904337 3300005549 Bacteria 794
42 Ga0070664_100308833 3300005564 Bacteria 1431
43 Ga0070664_100829794 3300005564 Unclassified 865
44 Ga0070664_101133661 3300005564 Unclassified 737
45 Ga0068857_100165964 3300005577 Bacteria 2005
46 Ga0068857_101059824 3300005577 Bacteria 782
47 Ga0070702_100685197 3300005615 Bacteria 779
48 Ga0068864_100006769 3300005618 Bacteria 9382
49 Ga0068866_10286887 3300005718 Bacteria 1022
50 Ga0068866_10296685 3300005718 Bacteria 1008
51 Ga0068870_10034310 3300005840 Bacteria 2596
52 Ga0068870_10068305 3300005840 Unclassified 1930
53 Ga0068870_10103833 3300005840 Archaea 1611
54 Ga0068858_100867228 3300005842 Unclassified 882
55 Ga0068862_100318527 3300005844 Bacteria 1435
56 Ga0081455_10011181 3300005937 Bacteria 9032
57 Ga0081455_10054244 3300005937 Bacteria 3418
58 Ga0081455_10642566 3300005937 Bacteria 685
59 Ga0081538_10104654 3300005981 Bacteria 1411
60 Ga0075432_10566777 3300006058 Bacteria 515
61 Ga0070712_100326804 3300006175 Bacteria 1248
62 Ga0070712_100625682 3300006175 Bacteria 913
63 Ga0070712_100956979 3300006175 Bacteria 740
64 Ga0068871_100295268 3300006358 Unclassified 1421
65 Ga0075428_100993230 3300006844 Bacteria 889
66 Ga0075430_100568984 3300006846 Bacteria 935
67 Ga0075431_100447668 3300006847 Unclassified 1287
68 Ga0075431_101624780 3300006847 Unclassified 604
69 Ga0075434_100366062 3300006871 Bacteria 1462
70 Ga0075434_100971521 3300006871 Bacteria 863
71 Ga0075429_100236487 3300006880 Bacteria 1600
72 Ga0068865_100134320 3300006881 Bacteria 1857
73 Ga0068865_101588590 3300006881 Unclassified 588
74 Ga0075436_101351150 3300006914 Bacteria 540
75 Ga0105240_10351138 3300009093 Bacteria 1673
76 Ga0111539_10151520 3300009094 Bacteria 2714
77 Ga0111539_10242231 3300009094 Bacteria 2100
78 Ga0111539_10429916 3300009094 Bacteria 1537
79 Ga0111539_10656871 3300009094 Bacteria 1221
80 Ga0105245_10305187 3300009098 Bacteria 1563
81 Ga0105245_11616207 3300009098 Bacteria 700
82 Ga0114129_10063612 3300009147 Bacteria 5151
83 Ga0114129_10070445 3300009147 Bacteria 4876
84 Ga0114129_10132862 3300009147 Bacteria 3417
85 Ga0114129_10282796 3300009147 Bacteria 2216
86 Ga0114129_10340456 3300009147 Bacteria 1989
87 Ga0114129_10490863 3300009147 Bacteria 1605
88 Ga0114129_10784571 3300009147 Unclassified 1217
89 Ga0114129_11540721 3300009147 Bacteria 815
90 Ga0105243_10052297 3300009148 Bacteria 3235
91 Ga0105243_10683054 3300009148 Bacteria 999
92 Ga0105243_12120016 3300009148 Bacteria 598
93 Ga0105242_10397245 3300009176 Bacteria 1286
94 Ga0105242_10949395 3300009176 Bacteria 864
95 Ga0105242_12293290 3300009176 Bacteria 586
96 Ga0105239_13187500 3300010375 Bacteria 534
97 Ga0105246_10028345 3300011119 Bacteria 3678
98 Ga0105246_10161218 3300011119 Bacteria 1708
99 Ga0105246_12214119 3300011119 Bacteria 535
100 Ga0157374_11061556 3300013296 Bacteria 830
101 Ga0157378_10193515 3300013297 Unclassified 1920
102 Ga0157378_10645010 3300013297 Bacteria 1074
103 Ga0157375_10004686 3300013308 Bacteria 11898
104 Ga0157375_10925471 3300013308 Bacteria 1015
105 Ga0163163_10008112 3300014325 Bacteria 9306
106 Ga0163163_11353177 3300014325 Bacteria 774
107 Ga0157380_11190667 3300014326 Bacteria 805
108 Ga0157380_11816117 3300014326 Bacteria 669
109 Ga0157377_10021149 3300014745 Bacteria 3418
110 Ga0157379_10369215 3300014968 Bacteria 1316
111 Ga0157376_10161554 3300014969 Bacteria 2031
112 Ga0163161_10251308 3300017792 Bacteria 1378
113 Ga0206356_11596920 3300020070 Bacteria 770
114 Ga0206352_11030673 3300020078 Bacteria 820
115 Ga0224712_10318702 3300022467 Bacteria 730
116 Ga0207697_10465511 3300025315 Unclassified 560
117 Ga0207642_10022841 3300025899 Bacteria 2488
118 Ga0207642_10344111 3300025899 Unclassified 878
119 Ga0207642_10344963 3300025899 Bacteria 877
120 Ga0207688_10001622 3300025901 Bacteria 11875
121 Ga0207688_10082165 3300025901 Bacteria 1841
122 Ga0207647_10313356 3300025904 Unclassified 892
123 Ga0207645_10238417 3300025907 Bacteria 1201
124 Ga0207645_10965762 3300025907 Bacteria 578
125 Ga0207643_10003417 3300025908 Bacteria 8559
126 Ga0207643_10020962 3300025908 Bacteria 3588
127 Ga0207643_10053295 3300025908 Bacteria 2298
128 Ga0207684_10593050 3300025910 Bacteria 947
129 Ga0207707_10500414 3300025912 Unclassified 1036
130 Ga0207693_10037141 3300025915 Bacteria 3839
131 Ga0207660_10410747 3300025917 Bacteria 1091
132 Ga0207662_10468722 3300025918 Bacteria 863
133 Ga0207657_11174232 3300025919 Bacteria 584
134 Ga0207646_11147808 3300025922 Bacteria 682
135 Ga0207681_10687687 3300025923 Bacteria 850
136 Ga0207650_10004264 3300025925 Bacteria 9758
137 Ga0207650_10914712 3300025925 Bacteria 745
138 Ga0207659_10263042 3300025926 Bacteria 1404
139 Ga0207659_10809316 3300025926 Bacteria 805
140 Ga0207706_10360937 3300025933 Bacteria 1262
141 Ga0207686_10268318 3300025934 Bacteria 1254
142 Ga0207686_10480636 3300025934 Unclassified 961
143 Ga0207709_10046266 3300025935 Bacteria 2640
144 Ga0207709_10195115 3300025935 Bacteria 1442
145 Ga0207670_10434087 3300025936 Bacteria 1056
146 Ga0207669_10050219 3300025937 Bacteria 2492
147 Ga0207669_10093079 3300025937 Bacteria 1968
148 Ga0207669_10107915 3300025937 Unclassified 1858
149 Ga0207669_10876490 3300025937 Bacteria 748
150 Ga0207704_10115697 3300025938 Bacteria 1823
151 Ga0207704_10842197 3300025938 Bacteria 768
152 Ga0207691_10177841 3300025940 Bacteria 1860
153 Ga0207661_10221837 3300025944 Bacteria 1671
154 Ga0207679_10351429 3300025945 Bacteria 1285
155 Ga0207651_10041886 3300025960 Bacteria 3044
156 Ga0207651_10258376 3300025960 Unclassified 1429
157 Ga0207668_10207075 3300025972 Bacteria 1566
158 Ga0207668_10468072 3300025972 Unclassified 1079
159 Ga0207658_11692552 3300025986 Unclassified 578
160 Ga0207677_10096175 3300026023 Bacteria 2166
161 Ga0207703_10629501 3300026035 Bacteria 1016
162 Ga0207678_10100489 3300026067 Bacteria 2471
163 Ga0207708_10013066 3300026075 Bacteria 6195
164 Ga0207708_10013868 3300026075 Bacteria 6023
165 Ga0207708_10163073 3300026075 Bacteria 1761
166 Ga0207708_10300178 3300026075 Bacteria 1306
167 Ga0207708_10521139 3300026075 Unclassified 999
168 Ga0207648_10107088 3300026089 Bacteria 2453
169 Ga0207648_10594380 3300026089 Bacteria 1019
170 Ga0207676_10026915 3300026095 Bacteria 4278
171 Ga0207674_10185259 3300026116 Bacteria 2032
172 Ga0207674_10861469 3300026116 Bacteria 874
173 Ga0207675_100117096 3300026118 Unclassified 2519
174 Ga0207683_10029459 3300026121 Bacteria 4753
175 Ga0207683_10406586 3300026121 Bacteria 1253
176 Ga0207683_10748562 3300026121 Bacteria 907
177 Ga0207428_10329849 3300027907 Bacteria 1125
178 Ga0207428_10406332 3300027907 Bacteria 996
179 Ga0207428_10817156 3300027907 Bacteria 662
180 Ga0268266_10060288 3300028379 Bacteria 3271
181 Ga0268265_10869552 3300028380 Bacteria 883
182 Ga0268264_10430209 3300028381 Unclassified 1275
183 Ga0265319_1001334 3300028563 Bacteria 14893
184 Ga0265318_10005443 3300028577 Bacteria 5979
185 Ga0265322_10002108 3300028654 Bacteria 6229
186 Ga0265338_10006995 3300028800 Bacteria 14168
187 Ga0265330_10031370 3300031235 Unclassified 2382
188 Ga0265332_10047516 3300031238 Unclassified 1847
189 Ga0265328_10063303 3300031239 Bacteria 1358
190 Ga0265320_10028343 3300031240 Bacteria 2908
191 Ga0265325_10063780 3300031241 Unclassified 1864
192 Ga0265329_10021418 3300031242 Bacteria 2172
193 Ga0265340_10012083 3300031247 Bacteria 4567
194 Ga0265339_10071585 3300031249 Bacteria 1847
195 Ga0265331_10061110 3300031250 Bacteria 1779
196 Ga0265327_10044043 3300031251 Bacteria 2382
197 Ga0265316_10017801 3300031344 Bacteria 6125
198 Ga0265314_10002715 3300031711 Bacteria 17709
199 Ga0265342_10041110 3300031712 Bacteria 2801
200 Ga0316583_10146558 3300032133 Bacteria 822
201 Ga0373923_0204967 3300035111 Bacteria 913
202 Ga0373955_0090441 3300035172 Bacteria 1744
203 Ga0395900_0098964 3300037418 Unclassified 2996
204 Ga0395898_0333649 3300037466 Unclassified 1446
205 Ga0395898_0563213 3300037466 Bacteria 1082
206 Ga0395905_0501403 3300037471 Unclassified 1114
207 Ga0395901_0656031 3300038443 Bacteria 1052
208 Ga0395901_0904548 3300038443 Bacteria 864
209 Ga0395901_1273966 3300038443 Bacteria 698
210 Ga0395901_1778378 3300038443 Bacteria 566
211 Ga0439451_037452 3300042009 Bacteria 974
212 Ga0450920_035576 3300042122 Bacteria 986
213 Ga0450907_003268 3300042146 Bacteria 2917
214 Ga0450910_034487 3300042147 Bacteria 803
215 Ga0439435_0027731 3300042436 Bacteria 1517
216 Ga0466966_0020758 3300044684 Bacteria 4318
217 Ga0466961_0117896 3300044693 Bacteria 1668
218 Ga0466959_0004959 3300045049 Bacteria 9021
219 Ga0495603_0159653 3300046455 Unclassified 1308
220 Ga0495629_0941111 3300046459 Bacteria 565
221 Ga0495653_0076390 3300046463 Bacteria 2490
222 Ga0495584_0486186 3300046491 Bacteria 629
223 Ga0495607_0556606 3300046501 Bacteria 503
224 Ga0495608_0042395 3300046511 Bacteria 3044
225 Ga0495618_0132764 3300046514 Bacteria 1593
226 Ga0495628_0234820 3300046516 Bacteria 1373
227 Ga0495628_0832815 3300046516 Bacteria 644
228 Ga0495630_0055846 3300046517 Bacteria 2959
229 Ga0495630_0526273 3300046517 Bacteria 907
230 Ga0495644_0256333 3300046523 Unclassified 680
231 Ga0495663_0306321 3300046525 Bacteria 573
232 Ga0495652_0359697 3300046529 Bacteria 1040
233 Ga0495652_0898903 3300046529 Bacteria 584
234 Ga0495640_0232168 3300046533 Bacteria 1160
235 Ga0495640_0358204 3300046533 Bacteria 900
236 Ga0495587_0021592 3300046536 Bacteria 3971
237 Ga0495609_0067973 3300046538 Bacteria 1569
238 Ga0495645_0246166 3300046543 Bacteria 1190
239 Ga0495667_0357287 3300046559 Unclassified 922
240 Ga0495667_0882472 3300046559 Bacteria 549
241 Ga0495656_0647951 3300046615 Unclassified 567
242 Ga0495634_0339551 3300046642 Bacteria 901
243 Ga0495635_0159210 3300046663 Bacteria 1536
244 Ga0495659_0155485 3300046664 Bacteria 921
245 Ga0495599_0069699 3300046678 Bacteria 2194
246 Ga0495647_0256097 3300046681 Bacteria 780
247 Ga0495649_0200091 3300046694 Bacteria 1038
248 Ga0495600_0085567 3300046809 Bacteria 2057
249 Ga0495604_0045783 3300047317 Bacteria 3413
250 Ga0495674_0049393 3300047319 Bacteria 3718
251 Ga0495680_0196753 3300047322 Unclassified 1448
252 Ga0495680_0290462 3300047322 Bacteria 1150
253 Ga0495680_0577445 3300047322 Bacteria 754
254 Ga0495675_0436589 3300047444 Bacteria 759
255 Ga0495684_0112574 3300047471 Bacteria 2052
256 Ga0495602_0354990 3300048088 Bacteria 1057
257 Ga0495602_0579558 3300048088 Bacteria 774
258 Ga0496104_1599530 3300048907 Bacteria 554
259 Ga0496107_1136554 3300048910 Bacteria 563
260 Ga0496108_0395322 3300048911 Bacteria 1207
261 Ga0496108_1036048 3300048911 Bacteria 700
262 Ga0496109_0281446 3300048912 Bacteria 1567
263 Ga0496110_0311178 3300048913 Bacteria 1434
264 Ga0496111_0048545 3300048914 Bacteria 3058
265 Ga0496113_0618251 3300048916 Bacteria 867
266 Ga0496113_1118655 3300048916 Unclassified 617
267 Ga0501031_0021108 3300049568 Bacteria 4247
268 Ga0501031_0221562 3300049568 Bacteria 1232
269 Ga0501031_0296684 3300049568 Bacteria 1048
270 Ga0501032_0317116 3300049569 Bacteria 1006
271 Ga0501032_0456754 3300049569 Bacteria 818
272 Ga0501033_0093728 3300049570 Bacteria 2196
273 Ga0501033_0859834 3300049570 Bacteria 611
274 Ga0501033_0892829 3300049570 Unclassified 598
275 Ga0501033_0930532 3300049570 Bacteria 583
276 Ga0501037_0031808 3300049573 Bacteria 3896
277 Ga0501038_0004173 3300049574 Bacteria 13436
278 Ga0501039_0140833 3300049575 Bacteria 1895
279 Ga0501039_0246960 3300049575 Bacteria 1403
280 Ga0501040_0038220 3300049576 Bacteria 3262
281 Ga0501040_0040991 3300049576 Bacteria 3153
282 Ga0501040_0251006 3300049576 Bacteria 1262
283 Ga0501040_0704842 3300049576 Bacteria 730
284 Ga0501041_0001608 3300049577 Bacteria 12602
285 Ga0501041_0266222 3300049577 Bacteria 1078
286 Ga0501042_0073729 3300049578 Bacteria 2441
287 Ga0501042_0742583 3300049578 Bacteria 714
288 Ga0501042_0954887 3300049578 Bacteria 625
289 Ga0501042_1279993 3300049578 Bacteria 535
290 Ga0501043_0083215 3300049579 Bacteria 2516
291 Ga0501046_0032094 3300049580 Bacteria 4254
292 Ga0501046_0377149 3300049580 Bacteria 1027
293 Ga0501046_0452044 3300049580 Bacteria 924
294 Ga0501047_0081970 3300049581 Bacteria 3101
295 Ga0501048_0187790 3300049582 Bacteria 1464
296 Ga0501048_0886291 3300049582 Bacteria 642
297 Ga0501067_0006397 3300049583 Bacteria 6525
298 Ga0501067_0661240 3300049583 Unclassified 587
299 Ga0501068_0023226 3300049584 Bacteria 3632
300 Ga0501068_0465758 3300049584 Unclassified 818
301 Ga0501069_0003283 3300049585 Bacteria 8301
302 Ga0501069_0016674 3300049585 Bacteria 3948
303 Ga0501069_0073286 3300049585 Bacteria 1920
304 Ga0501069_0117377 3300049585 Bacteria 1518
305 Ga0501069_0564749 3300049585 Bacteria 681
306 Ga0501069_0660968 3300049585 Bacteria 629
307 Ga0501070_0149594 3300049586 Bacteria 1926
308 Ga0501070_1169246 3300049586 Bacteria 591
309 Ga0501071_0003767 3300049587 Bacteria 9520
310 Ga0501071_0155063 3300049587 Bacteria 1710
311 Ga0501071_1115541 3300049587 Bacteria 609
312 Ga0501071_1174257 3300049587 Bacteria 593
313 Ga0501071_1458559 3300049587 Bacteria 528
314 Ga0501071_1534352 3300049587 Bacteria 514
315 Ga0501072_0249772 3300049588 Bacteria 1412
316 Ga0501072_1228031 3300049588 Unclassified 582
317 Ga0501073_0195212 3300049589 Bacteria 1400
318 Ga0501073_1013199 3300049589 Bacteria 571
319 Ga0501074_0003722 3300049590 Bacteria 10820
320 Ga0501074_0324227 3300049590 Bacteria 1094
321 Ga0501075_0052797 3300049591 Bacteria 3056
322 Ga0501075_0177238 3300049591 Bacteria 1627
323 Ga0501075_0257376 3300049591 Bacteria 1330
324 Ga0501076_0004993 3300049592 Bacteria 9497
325 Ga0501076_0111138 3300049592 Unclassified 2215
326 Ga0501076_0752241 3300049592 Bacteria 804
327 Ga0501076_1265590 3300049592 Bacteria 607
328 Ga0501077_0038292 3300049593 Bacteria 3052
329 Ga0501077_0103335 3300049593 Bacteria 1805
330 Ga0501077_0632680 3300049593 Bacteria 687
331 Ga0501079_0004160 3300049741 Bacteria 10720
332 Ga0501079_0040025 3300049741 Bacteria 3616
333 Ga0501080_0012608 3300049742 Bacteria 7750
334 Ga0501081_0031859 3300049743 Bacteria 3573
335 Ga0501081_0384583 3300049743 Bacteria 1037
336 Ga0501081_1504410 3300049743 Bacteria 511
337 Ga0501083_0017666 3300049744 Bacteria 4973
338 Ga0501035_0015269 3300049822 Bacteria 7088
339 Ga0501035_0091199 3300049822 Bacteria 2682
340 Ga0501044_0124942 3300049823 Bacteria 2571
341 Ga0501045_0011653 3300049824 Bacteria 6173
342 Ga0501045_0495307 3300049824 Bacteria 907
343 Ga0501045_1021548 3300049824 Bacteria 606
344 nmdc:mga05p37_238569_c1 3300050507 Bacteria 2187
345 nmdc:mga05p37_34092_c1 3300050507 Bacteria 6235
346 nmdc:mga05p37_69512_c1 3300050507 Bacteria 4331
347 nmdc:mga05p37_803917_c1 3300050507 Bacteria 1028
348 nmdc:mga05p37_804742_c1 3300050507 Bacteria 1028
349 nmdc:mga05p37_821702_c1 3300050507 Unclassified 1013
350 nmdc:mga05p37_89158_c1 3300050507 Bacteria 3801
351 nmdc:mga09592_493485_c1 3300050508 Bacteria 1054
352 nmdc:mga09592_535910_c1 3300050508 Bacteria 1006
353 nmdc:mga0qj67_537356_c1 3300050509 Bacteria 938
354 nmdc:mga06r32_350246_c1 3300050510 Unclassified 1461
355 nmdc:mga06r32_803494_c1 3300050510 Unclassified 901
356 nmdc:mga08y16_305175_c1 3300050511 Bacteria 1640
357 nmdc:mga08y16_830467_c1 3300050511 Bacteria 915
358 nmdc:mga08y16_96165_c1 3300050511 Bacteria 3084
359 nmdc:mga0n895_1548437_c1 3300050512 Bacteria 628
360 nmdc:mga0n895_155094_c1 3300050512 Bacteria 2320
361 nmdc:mga0n895_1790359_c1 3300050512 Bacteria 575
362 nmdc:mga08x19_91565_c1 3300050514 Bacteria 2007
363 nmdc:mga0a205_679161_c1 3300050515 Unclassified 880
364 Ga0495601_0047326 3300053077 Bacteria 2707
365 Ga0495601_0435700 3300053077 Unclassified 848
366 Ga0495612_0042804 3300053078 Bacteria 1849
367 Ga0495612_0044158 3300053078 Bacteria 1823
368 Ga0495595_0009500 3300053084 Bacteria 4025
369 Ga0495619_0470584 3300053085 Bacteria 865
370 Ga0501084_0025797 3300054114 Bacteria 4901
371 Ga0501084_0173693 3300054114 Bacteria 1819
372 Ga0501084_0360462 3300054114 Bacteria 1228
373 Ga0501084_0432140 3300054114 Bacteria 1113
374 Ga0501082_0002605 3300060353 Bacteria 15764
375 Ga0501082_0035809 3300060353 Bacteria 4278
376 Ga0501082_0205203 3300060353 Bacteria 1715
377 Ga0501082_0822224 3300060353 Bacteria 813
378 Ga0501082_1048190 3300060353 Bacteria 713
379 Ga0530510_0022915 3300061734 Bacteria 4449
380 Ga0530510_0076114 3300061734 Bacteria 2438
381 Ga0530510_0171348 3300061734 Bacteria 1608
382 Ga0530510_0323737 3300061734 Bacteria 1156
383 Ga0530510_0518220 3300061734 Bacteria 904
384 Ga0530510_0578924 3300061734 Bacteria 853
385 Ga0207689_10199727
386 JGI24751J29686_10022965
387 Ga0070676_10248989
388 Ga0070683_100229209
389 Ga0070690_100508666
390 Ga0070670_100031437
391 Ga0068869_100233596
392 Ga0070682_100804321
393 Ga0068868_100183961
394 Ga0070660_100855286
395 Ga0070689_100021672
396 Ga0070687_100249154
397 Ga0070692_10240275
398 Ga0070668_100204062
399 Ga0070668_100411860
400 Ga0070668_100748326
401 Ga0070669_100526586
402 Ga0070674_100003871
403 Ga0070674_100028131
404 Ga0070674_100171226
405 Ga0070673_100456984
406 Ga0070688_100024161
407 Ga0070714_100001543
408 Ga0070714_102361999
409 Ga0070711_100978594
410 Ga0070705_100076754
411 Ga0070700_100006301
412 Ga0070694_100913447
413 Ga0070708_100373742
414 Ga0070663_100222025
415 Ga0070678_100013698
416 Ga0068867_100489652
417 Ga0070685_10009922
418 Ga0070698_100078309
419 Ga0070699_100087771
420 Ga0070684_100296979
421 Ga0070672_100089096
422 Ga0070672_101810499
423 Ga0070686_100008711
424 Ga0070665_100050450
425 Ga0070704_100904337
426 Ga0070664_100308833
427 Ga0070664_100829794
428 Ga0070664_101133661
429 Ga0068857_100165964
430 Ga0068857_101059824
431 Ga0070702_100685197
432 Ga0068864_100006769
433 Ga0068866_10286887
434 Ga0068866_10296685
435 Ga0068870_10034310
436 Ga0068870_10068305
437 Ga0068870_10103833
438 Ga0068858_100867228
439 Ga0068862_100318527
440 Ga0081455_10011181
441 Ga0081455_10054244
442 Ga0081455_10642566
443 Ga0081538_10104654
444 Ga0075432_10566777
445 Ga0070712_100326804
446 Ga0070712_100625682
447 Ga0070712_100956979
448 Ga0068871_100295268
449 Ga0075428_100993230
450 Ga0075430_100568984
451 Ga0075431_100447668
452 Ga0075431_101624780
453 Ga0075434_100366062
454 Ga0075434_100971521
455 Ga0075429_100236487
456 Ga0068865_100134320
457 Ga0068865_101588590
458 Ga0075436_101351150
459 Ga0105240_10351138
460 Ga0111539_10151520
461 Ga0111539_10242231
462 Ga0111539_10429916
463 Ga0111539_10656871
464 Ga0105245_10305187
465 Ga0105245_11616207
466 Ga0114129_10063612
467 Ga0114129_10070445
468 Ga0114129_10132862
469 Ga0114129_10282796
470 Ga0114129_10340456
471 Ga0114129_10490863
472 Ga0114129_10784571
473 Ga0114129_11540721
474 Ga0105243_10052297
475 Ga0105243_10683054
476 Ga0105243_12120016
477 Ga0105242_10397245
478 Ga0105242_10949395
479 Ga0105242_12293290
480 Ga0105239_13187500
481 Ga0105246_10028345
482 Ga0105246_10161218
483 Ga0105246_12214119
484 Ga0157374_11061556
485 Ga0157378_10193515
486 Ga0157378_10645010
487 Ga0157375_10004686
488 Ga0157375_10925471
489 Ga0163163_10008112
490 Ga0163163_11353177
491 Ga0157380_11190667
492 Ga0157380_11816117
493 Ga0157377_10021149
494 Ga0157379_10369215
495 Ga0157376_10161554
496 Ga0163161_10251308
497 Ga0206356_11596920
498 Ga0206352_11030673
499 Ga0224712_10318702
500 Ga0207697_10465511
501 Ga0207642_10022841
502 Ga0207642_10344111
503 Ga0207642_10344963
504 Ga0207688_10001622
505 Ga0207688_10082165
506 Ga0207647_10313356
507 Ga0207645_10238417
508 Ga0207645_10965762
509 Ga0207643_10003417
510 Ga0207643_10020962
511 Ga0207643_10053295
512 Ga0207684_10593050
513 Ga0207707_10500414
514 Ga0207693_10037141
515 Ga0207660_10410747
516 Ga0207662_10468722
517 Ga0207657_11174232
518 Ga0207646_11147808
519 Ga0207681_10687687
520 Ga0207650_10004264
521 Ga0207650_10914712
522 Ga0207659_10263042
523 Ga0207659_10809316
524 Ga0207706_10360937
525 Ga0207686_10268318
526 Ga0207686_10480636
527 Ga0207709_10046266
528 Ga0207709_10195115
529 Ga0207670_10434087
530 Ga0207669_10050219
531 Ga0207669_10093079
532 Ga0207669_10107915
533 Ga0207669_10876490
534 Ga0207704_10115697
535 Ga0207704_10842197
536 Ga0207691_10177841
537 Ga0207661_10221837
538 Ga0207679_10351429
539 Ga0207651_10041886
540 Ga0207651_10258376
541 Ga0207668_10207075
542 Ga0207668_10468072
543 Ga0207658_11692552
544 Ga0207677_10096175
545 Ga0207703_10629501
546 Ga0207678_10100489
547 Ga0207708_10013066
548 Ga0207708_10013868
549 Ga0207708_10163073
550 Ga0207708_10300178
551 Ga0207708_10521139
552 Ga0207648_10107088
553 Ga0207648_10594380
554 Ga0207676_10026915
555 Ga0207674_10185259
556 Ga0207674_10861469
557 Ga0207675_100117096
558 Ga0207683_10029459
559 Ga0207683_10406586
560 Ga0207683_10748562
561 Ga0207428_10329849
562 Ga0207428_10406332
563 Ga0207428_10817156
564 Ga0268266_10060288
565 Ga0268265_10869552
566 Ga0268264_10430209
567 Ga0265319_1001334
568 Ga0265318_10005443
569 Ga0265322_10002108
570 Ga0265338_10006995
571 Ga0265330_10031370
572 Ga0265332_10047516
573 Ga0265328_10063303
574 Ga0265320_10028343
575 Ga0265325_10063780
576 Ga0265329_10021418
577 Ga0265340_10012083
578 Ga0265339_10071585
579 Ga0265331_10061110
580 Ga0265327_10044043
581 Ga0265316_10017801
582 Ga0265314_10002715
583 Ga0265342_10041110
584 Ga0316583_10146558
585 Ga0373923_0204967
586 Ga0373955_0090441
587 Ga0395900_0098964
588 Ga0395898_0333649
589 Ga0395898_0563213
590 Ga0395905_0501403
591 Ga0395901_0656031
592 Ga0395901_0904548
593 Ga0395901_1273966
594 Ga0395901_1778378
595 Ga0439451_037452
596 Ga0450920_035576
597 Ga0450907_003268
598 Ga0450910_034487
599 Ga0439435_0027731
600 Ga0466966_0020758
601 Ga0466961_0117896
602 Ga0466959_0004959
603 Ga0495603_0159653
604 Ga0495629_0941111
605 Ga0495653_0076390
606 Ga0495584_0486186
607 Ga0495607_0556606
608 Ga0495608_0042395
609 Ga0495618_0132764
610 Ga0495628_0234820
611 Ga0495628_0832815
612 Ga0495630_0055846
613 Ga0495630_0526273
614 Ga0495644_0256333
615 Ga0495663_0306321
616 Ga0495652_0359697
617 Ga0495652_0898903
618 Ga0495640_0232168
619 Ga0495640_0358204
620 Ga0495587_0021592
621 Ga0495609_0067973
622 Ga0495645_0246166
623 Ga0495667_0357287
624 Ga0495667_0882472
625 Ga0495656_0647951
626 Ga0495634_0339551
627 Ga0495635_0159210
628 Ga0495659_0155485
629 Ga0495599_0069699
630 Ga0495647_0256097
631 Ga0495649_0200091
632 Ga0495600_0085567
633 Ga0495604_0045783
634 Ga0495674_0049393
635 Ga0495680_0196753
636 Ga0495680_0290462
637 Ga0495680_0577445
638 Ga0495675_0436589
639 Ga0495684_0112574
640 Ga0495602_0354990
641 Ga0495602_0579558
642 Ga0496104_1599530
643 Ga0496107_1136554
644 Ga0496108_0395322
645 Ga0496108_1036048
646 Ga0496109_0281446
647 Ga0496110_0311178
648 Ga0496111_0048545
649 Ga0496113_0618251
650 Ga0496113_1118655
651 Ga0501031_0021108
652 Ga0501031_0221562
653 Ga0501031_0296684
654 Ga0501032_0317116
655 Ga0501032_0456754
656 Ga0501033_0093728
657 Ga0501033_0859834
658 Ga0501033_0892829
659 Ga0501033_0930532
660 Ga0501037_0031808
661 Ga0501038_0004173
662 Ga0501039_0140833
663 Ga0501039_0246960
664 Ga0501040_0038220
665 Ga0501040_0040991
666 Ga0501040_0251006
667 Ga0501040_0704842
668 Ga0501041_0001608
669 Ga0501041_0266222
670 Ga0501042_0073729
671 Ga0501042_0742583
672 Ga0501042_0954887
673 Ga0501042_1279993
674 Ga0501043_0083215
675 Ga0501046_0032094
676 Ga0501046_0377149
677 Ga0501046_0452044
678 Ga0501047_0081970
679 Ga0501048_0187790
680 Ga0501048_0886291
681 Ga0501067_0006397
682 Ga0501067_0661240
683 Ga0501068_0023226
684 Ga0501068_0465758
685 Ga0501069_0003283
686 Ga0501069_0016674
687 Ga0501069_0073286
688 Ga0501069_0117377
689 Ga0501069_0564749
690 Ga0501069_0660968
691 Ga0501070_0149594
692 Ga0501070_1169246
693 Ga0501071_0003767
694 Ga0501071_0155063
695 Ga0501071_1115541
696 Ga0501071_1174257
697 Ga0501071_1458559
698 Ga0501071_1534352
699 Ga0501072_0249772
700 Ga0501072_1228031
701 Ga0501073_0195212
702 Ga0501073_1013199
703 Ga0501074_0003722
704 Ga0501074_0324227
705 Ga0501075_0052797
706 Ga0501075_0177238
707 Ga0501075_0257376
708 Ga0501076_0004993
709 Ga0501076_0111138
710 Ga0501076_0752241
711 Ga0501076_1265590
712 Ga0501077_0038292
713 Ga0501077_0103335
714 Ga0501077_0632680
715 Ga0501079_0004160
716 Ga0501079_0040025
717 Ga0501080_0012608
718 Ga0501081_0031859
719 Ga0501081_0384583
720 Ga0501081_1504410
721 Ga0501083_0017666
722 Ga0501035_0015269
723 Ga0501035_0091199
724 Ga0501044_0124942
725 Ga0501045_0011653
726 Ga0501045_0495307
727 Ga0501045_1021548
728 nmdc:mga05p37_238569_c1
729 nmdc:mga05p37_34092_c1
730 nmdc:mga05p37_69512_c1
731 nmdc:mga05p37_803917_c1
732 nmdc:mga05p37_804742_c1
733 nmdc:mga05p37_821702_c1
734 nmdc:mga05p37_89158_c1
735 nmdc:mga09592_493485_c1
736 nmdc:mga09592_535910_c1
737 nmdc:mga0qj67_537356_c1
738 nmdc:mga06r32_350246_c1
739 nmdc:mga06r32_803494_c1
740 nmdc:mga08y16_305175_c1
741 nmdc:mga08y16_830467_c1
742 nmdc:mga08y16_96165_c1
743 nmdc:mga0n895_1548437_c1
744 nmdc:mga0n895_155094_c1
745 nmdc:mga0n895_1790359_c1
746 nmdc:mga08x19_91565_c1
747 nmdc:mga0a205_679161_c1
748 Ga0495601_0047326
749 Ga0495601_0435700
750 Ga0495612_0042804
751 Ga0495612_0044158
752 Ga0495595_0009500
753 Ga0495619_0470584
754 Ga0501084_0025797
755 Ga0501084_0173693
756 Ga0501084_0360462
757 Ga0501084_0432140
758 Ga0501082_0002605
759 Ga0501082_0035809
760 Ga0501082_0205203
761 Ga0501082_0822224
762 Ga0501082_1048190
763 Ga0530510_0022915
764 Ga0530510_0076114
765 Ga0530510_0171348
766 Ga0530510_0323737
767 Ga0530510_0518220
768 Ga0530510_0578924

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00462

Glutaredoxin

Glutaredoxin

17

81

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2wul-assembly1.cif.gz_D crystal structure of the human glutaredoxin 5 with bound glutathione in an fes cluster 0.9334 5 102
3gx8-assembly1.cif.gz_A structural and biochemical characterization of yeast monothiol glutaredoxin grx5 0.93 4 103
2mma-assembly1.cif.gz_A nmr-based docking model of grxs14-bola2 apo-heterodimer from arabidopsis thaliana 0.9258 4 104
3zyw-assembly1.cif.gz_A crystal structure of the first glutaredoxin domain of human glutaredoxin 3 (glrx3) 0.9089 3 98
2yan-assembly2.cif.gz_B crystal structure of the second glutaredoxin domain of human txnl2 0.9029 4 102
ID Description Score Start End Superfamily
af_Q555C8_40_141_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9688 8 103 3.40.30.10
af_K7UQQ8_80_167_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9659 9 93 3.40.30.10
af_Q8IBZ7_179_272_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9502 10 98 3.40.30.10
2wemC01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9491 7 102 3.40.30.10
af_B6TEC7_84_191_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.9487 8 102 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1F2XR86-F1-model_v4 Glutaredoxin 1.003 1 120 GO:0015036
GO:0046872
GO:0051537
AF-A0A7W0NJB2-F1-model_v4 Glutaredoxin 0.999 21 118
AF-A0A538FHJ8-F1-model_v4 Glutaredoxin domain-containing protein 0.9898 21 118
AF-A0A7W0NJB2-F1-model_v4 Glutaredoxin 0.9889 21 118
AF-A0A1Q7WX43-F1-model_v4 Glutaredoxin 0.9883 1 116 GO:0015036
GO:0046872
GO:0051537

Map