F429828

General Info

Members Datasets Scaffolds Average Seq Length
384 216 768 161

Family's Representative Sequence

Representative Sequence 3300005543|Ga0070672_100103061|Ga0070672_1001030612
Length 161
Sequence VAIHVVLVHPEIHWNTGNAGRTCLAAGATLHLIKPLGFSLDEREVKRAGLDYWEHVNPRVWPGWDAFERELPSLGEAYFFSTKATRLLWDAQLSLPDVVLVFGRETGGLPPVLHERYRDKFLALPMHSPHVRSLNLSTSVGIALYEVLRQRRAEADAHRAR

Samples

Sample ID Description Type Environment
1 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
11 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
12 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
13 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
14 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
19 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
20 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
21 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
26 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
32 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
33 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
37 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
38 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
39 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
40 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
41 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
42 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
43 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
44 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
45 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
46 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
60 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
61 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
62 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
63 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
64 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
65 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
66 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
68 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
69 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
72 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
73 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
75 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
76 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
77 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
78 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
84 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
85 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
86 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
95 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
141 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
144 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
145 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
146 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
147 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
148 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
149 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
150 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
151 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
154 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
155 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
160 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
161 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
162 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
163 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
169 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
172 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
173 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
174 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
175 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
176 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
177 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
178 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
182 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
183 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
184 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
185 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
186 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
190 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
191 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
192 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
193 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
194 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
195 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
196 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
197 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
200 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
202 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
203 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
204 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
205 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
206 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
207 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
208 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
209 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
210 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
211 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
212 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
213 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
214 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
215 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
216 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.04
Rhizosphere 98.96
Stem 0
Stem Tuber 0
Unclassified 20.83

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070672_100103061 3300005543 Bacteria 2317
2 JGI24746J21847_1046435 3300001977 Bacteria 608
3 Ga0065712_10115360 3300005290 Bacteria 1753
4 Ga0070683_100015756 3300005329 Bacteria 6645
5 Ga0070683_100019116 3300005329 Bacteria 6080
6 Ga0070683_100020234 3300005329 Bacteria 5921
7 Ga0070690_100005417 3300005330 Bacteria 7166
8 Ga0070670_100009461 3300005331 Bacteria 8320
9 Ga0070670_100578890 3300005331 Bacteria 1003
10 Ga0068869_100001949 3300005334 Bacteria 12368
11 Ga0070666_10284734 3300005335 Bacteria 1175
12 Ga0070680_100018353 3300005336 Bacteria 5526
13 Ga0070682_100005960 3300005337 Bacteria 6822
14 Ga0068868_100019384 3300005338 Bacteria 5097
15 Ga0070660_100706072 3300005339 Bacteria 846
16 Ga0070689_100125817 3300005340 Bacteria 2051
17 Ga0070689_100289505 3300005340 Unclassified 1361
18 Ga0070687_100025030 3300005343 Bacteria 2858
19 Ga0070661_100009045 3300005344 Bacteria 6890
20 Ga0070661_100010557 3300005344 Bacteria 6423
21 Ga0070661_100015866 3300005344 Bacteria 5315
22 Ga0070661_100339513 3300005344 Bacteria 1176
23 Ga0070692_10040687 3300005345 Bacteria 2379
24 Ga0070668_101012222 3300005347 Unclassified 747
25 Ga0070669_100002539 3300005353 Bacteria 13190
26 Ga0070669_100296229 3300005353 Unclassified 1300
27 Ga0070669_100730007 3300005353 Bacteria 838
28 Ga0070675_100011326 3300005354 Bacteria 6981
29 Ga0070675_100251939 3300005354 Unclassified 1546
30 Ga0070674_100105110 3300005356 Bacteria 2064
31 Ga0070674_100132604 3300005356 Bacteria 1859
32 Ga0070673_100014914 3300005364 Bacteria 5438
33 Ga0070673_100312433 3300005364 Unclassified 1387
34 Ga0070673_101032898 3300005364 Unclassified 766
35 Ga0070688_100139951 3300005365 Bacteria 1643
36 Ga0070659_100001041 3300005366 Bacteria 20294
37 Ga0070667_100440588 3300005367 Bacteria 1190
38 Ga0070705_100009611 3300005440 Unclassified 4814
39 Ga0070705_100091658 3300005440 Bacteria 1895
40 Ga0070700_101396603 3300005441 Unclassified 592
41 Ga0070678_100051781 3300005456 Unclassified 2978
42 Ga0070678_101039415 3300005456 Unclassified 754
43 Ga0070662_100063024 3300005457 Unclassified 2711
44 Ga0070662_100601381 3300005457 Bacteria 925
45 Ga0070681_10001143 3300005458 Bacteria 22860
46 Ga0070681_10017152 3300005458 Bacteria 7240
47 Ga0068867_100564767 3300005459 Bacteria 987
48 Ga0070685_10014998 3300005466 Bacteria 4113
49 Ga0070685_10874810 3300005466 Unclassified 667
50 Ga0070707_100000535 3300005468 Bacteria 37975
51 Ga0070698_100000047 3300005471 Bacteria 84276
52 Ga0070698_100820888 3300005471 Unclassified 874
53 Ga0070679_100020022 3300005530 Bacteria 6519
54 Ga0070684_100014275 3300005535 Bacteria 6429
55 Ga0070684_100025413 3300005535 Unclassified 4978
56 Ga0070684_100181700 3300005535 Bacteria 1913
57 Ga0068853_100060710 3300005539 Unclassified 3268
58 Ga0070672_100019465 3300005543 Bacteria 4927
59 Ga0070672_100027835 3300005543 Unclassified 4220
60 Ga0070672_100102285 3300005543 Bacteria 2325
61 Ga0070672_100406215 3300005543 Bacteria 1168
62 Ga0070672_100959222 3300005543 Bacteria 757
63 Ga0070686_100032745 3300005544 Bacteria 3189
64 Ga0070695_100126651 3300005545 Bacteria 1755
65 Ga0070693_100050298 3300005547 Bacteria 2381
66 Ga0068855_100032907 3300005563 Bacteria 6190
67 Ga0068855_100394155 3300005563 Unclassified 1518
68 Ga0070664_100040987 3300005564 Bacteria 3906
69 Ga0070664_100248573 3300005564 Bacteria 1598
70 Ga0070664_101406396 3300005564 Bacteria 659
71 Ga0068854_100348613 3300005578 Unclassified 1211
72 Ga0068854_100983472 3300005578 Unclassified 746
73 Ga0068856_100009407 3300005614 Bacteria 9491
74 Ga0068856_100308500 3300005614 Bacteria 1600
75 Ga0070702_100000333 3300005615 Bacteria 16392
76 Ga0068852_100350210 3300005616 Bacteria 1442
77 Ga0068859_100024121 3300005617 Bacteria 6104
78 Ga0068859_100027925 3300005617 Bacteria 5658
79 Ga0068864_100002119 3300005618 Bacteria 16411
80 Ga0068864_100088144 3300005618 Bacteria 2733
81 Ga0068866_10231071 3300005718 Bacteria 1122
82 Ga0068851_10541141 3300005834 Unclassified 703
83 Ga0068870_10001514 3300005840 Bacteria 9429
84 Ga0068870_10321508 3300005840 Bacteria 983
85 Ga0068863_100024067 3300005841 Bacteria 5810
86 Ga0068863_101447691 3300005841 Archaea 695
87 Ga0068858_100016936 3300005842 Bacteria 6843
88 Ga0068860_100626187 3300005843 Bacteria 1083
89 Ga0068862_100215916 3300005844 Bacteria 1735
90 Ga0068862_101162573 3300005844 Bacteria 769
91 Ga0081540_1043456 3300005983 Bacteria 2305
92 Ga0097621_100014016 3300006237 Bacteria 5990
93 Ga0097621_100238008 3300006237 Unclassified 1591
94 Ga0097621_100818487 3300006237 Bacteria 864
95 Ga0097621_101493797 3300006237 Bacteria 641
96 Ga0068871_100017630 3300006358 Bacteria 5408
97 Ga0068871_100168912 3300006358 Bacteria 1874
98 Ga0068871_100579117 3300006358 Bacteria 1019
99 Ga0075428_100012246 3300006844 Bacteria 9538
100 Ga0075428_100063875 3300006844 Bacteria 4031
101 Ga0075428_100071437 3300006844 Bacteria 3793
102 Ga0075428_100747962 3300006844 Unclassified 1040
103 Ga0075428_101652802 3300006844 Bacteria 669
104 Ga0075430_100001208 3300006846 Bacteria 20761
105 Ga0075431_100009185 3300006847 Bacteria 9916
106 Ga0075431_100055344 3300006847 Bacteria 4092
107 Ga0075431_100063093 3300006847 Bacteria 3823
108 Ga0075431_100112427 3300006847 Bacteria 2811
109 Ga0075431_100281535 3300006847 Bacteria 1683
110 Ga0075431_100939389 3300006847 Bacteria 833
111 Ga0075433_10008173 3300006852 Bacteria 8333
112 Ga0075433_10042572 3300006852 Bacteria 3941
113 Ga0075433_10230280 3300006852 Bacteria 1646
114 Ga0075434_100000039 3300006871 Bacteria 59823
115 Ga0075434_100023405 3300006871 Bacteria 6020
116 Ga0075434_100047343 3300006871 Bacteria 4267
117 Ga0075434_100082680 3300006871 Unclassified 3209
118 Ga0075434_100129210 3300006871 Bacteria 2545
119 Ga0075434_100970180 3300006871 Unclassified 864
120 Ga0075434_101002456 3300006871 Unclassified 849
121 Ga0075429_100011322 3300006880 Bacteria 7721
122 Ga0075429_100025760 3300006880 Bacteria 5107
123 Ga0075429_100113629 3300006880 Bacteria 2367
124 Ga0075429_100733240 3300006880 Bacteria 866
125 Ga0068865_100175666 3300006881 Unclassified 1646
126 Ga0068865_100384008 3300006881 Bacteria 1146
127 Ga0075436_100289131 3300006914 Bacteria 1173
128 Ga0097620_100024123 3300006931 Bacteria 6104
129 Ga0097620_100027926 3300006931 Bacteria 5658
130 Ga0075435_100119904 3300007076 Bacteria 2195
131 Ga0075435_100170546 3300007076 Bacteria 1836
132 Ga0075435_100490303 3300007076 Bacteria 1062
133 Ga0075435_100499851 3300007076 Bacteria 1051
134 Ga0075435_100733711 3300007076 Unclassified 859
135 Ga0099794_10076531 3300007265 Unclassified 1645
136 Ga0105240_10065718 3300009093 Bacteria 4501
137 Ga0111539_10167235 3300009094 Bacteria 2570
138 Ga0105245_10003349 3300009098 Bacteria 14380
139 Ga0105245_10122575 3300009098 Bacteria 2430
140 Ga0105245_10424849 3300009098 Bacteria 1333
141 Ga0105247_10536129 3300009101 Unclassified 858
142 Ga0114129_10038368 3300009147 Bacteria 6758
143 Ga0114129_10072508 3300009147 Bacteria 4800
144 Ga0114129_11013486 3300009147 Unclassified 1045
145 Ga0105243_10343562 3300009148 Unclassified 1368
146 Ga0105241_10010204 3300009174 Bacteria 6898
147 Ga0105242_10000971 3300009176 Bacteria 22389
148 Ga0105242_10025221 3300009176 Bacteria 4702
149 Ga0105242_10045561 3300009176 Unclassified 3554
150 Ga0105248_10002091 3300009177 Bacteria 22097
151 Ga0105248_10123156 3300009177 Bacteria 2925
152 Ga0105248_10136908 3300009177 Bacteria 2763
153 Ga0105248_11125847 3300009177 Bacteria 887
154 Ga0105237_10801049 3300009545 Unclassified 949
155 Ga0105238_10197548 3300009551 Unclassified 1987
156 Ga0105249_10097472 3300009553 Unclassified 2760
157 Ga0105249_10178014 3300009553 Bacteria 2067
158 Ga0105249_10750017 3300009553 Bacteria 1038
159 Ga0105249_11719849 3300009553 Bacteria 700
160 Ga0105239_10051858 3300010375 Bacteria 4497
161 Ga0105239_10423922 3300010375 Bacteria 1508
162 Ga0105239_10671815 3300010375 Bacteria 1184
163 Ga0105246_10019633 3300011119 Unclassified 4323
164 Ga0105246_10049757 3300011119 Unclassified 2871
165 Ga0105246_10389050 3300011119 Bacteria 1155
166 Ga0157373_10004256 3300013100 Bacteria 10792
167 Ga0157371_10006569 3300013102 Bacteria 9561
168 Ga0157370_10007853 3300013104 Bacteria 11562
169 Ga0157370_10090550 3300013104 Unclassified 2872
170 Ga0157369_10078876 3300013105 Bacteria 3527
171 Ga0157369_10089750 3300013105 Bacteria 3282
172 Ga0157369_10273934 3300013105 Unclassified 1758
173 Ga0157374_10029497 3300013296 Bacteria 4969
174 Ga0157374_10493030 3300013296 Unclassified 1229
175 Ga0157378_11219942 3300013297 Bacteria 792
176 Ga0163162_10215279 3300013306 Bacteria 2051
177 Ga0157372_10007811 3300013307 Bacteria 11362
178 Ga0157372_10022495 3300013307 Bacteria 6822
179 Ga0157372_10050477 3300013307 Bacteria 4627
180 Ga0157375_10008972 3300013308 Bacteria 8750
181 Ga0157375_10016409 3300013308 Bacteria 6654
182 Ga0157375_11666417 3300013308 Bacteria 755
183 Ga0163163_10069788 3300014325 Bacteria 3498
184 Ga0163163_10576402 3300014325 Bacteria 1188
185 Ga0157377_10001005 3300014745 Bacteria 11889
186 Ga0157376_10085123 3300014969 Unclassified 2724
187 Ga0157376_10532554 3300014969 Bacteria 1160
188 Ga0157376_11230447 3300014969 Bacteria 777
189 Ga0207697_10149477 3300025315 Bacteria 1016
190 Ga0207692_10251884 3300025898 Bacteria 1058
191 Ga0207688_10463101 3300025901 Unclassified 791
192 Ga0207643_10003211 3300025908 Bacteria 8809
193 Ga0207643_10046051 3300025908 Bacteria 2465
194 Ga0207643_10309346 3300025908 Bacteria 985
195 Ga0207705_10309465 3300025909 Bacteria 1213
196 Ga0207705_10643228 3300025909 Bacteria 825
197 Ga0207684_10180397 3300025910 Bacteria 1821
198 Ga0207707_10023764 3300025912 Bacteria 5360
199 Ga0207695_10007813 3300025913 Bacteria 13540
200 Ga0207695_10082833 3300025913 Bacteria 3242
201 Ga0207660_10065685 3300025917 Unclassified 2622
202 Ga0207662_10004875 3300025918 Bacteria 7097
203 Ga0207662_10040449 3300025918 Bacteria 2741
204 Ga0207662_10050437 3300025918 Bacteria 2472
205 Ga0207649_10008090 3300025920 Bacteria 5722
206 Ga0207652_10014599 3300025921 Bacteria 6368
207 Ga0207646_10002029 3300025922 Bacteria 24334
208 Ga0207646_10856988 3300025922 Bacteria 807
209 Ga0207681_10212004 3300025923 Bacteria 1493
210 Ga0207681_10222951 3300025923 Bacteria 1460
211 Ga0207681_10911874 3300025923 Unclassified 736
212 Ga0207650_10034927 3300025925 Unclassified 3648
213 Ga0207650_10039017 3300025925 Unclassified 3471
214 Ga0207650_10457362 3300025925 Bacteria 1063
215 Ga0207659_10005394 3300025926 Bacteria 7745
216 Ga0207659_10014991 3300025926 Bacteria 5012
217 Ga0207659_10016871 3300025926 Bacteria 4761
218 Ga0207687_10010714 3300025927 Bacteria 5988
219 Ga0207687_10257187 3300025927 Bacteria 1391
220 Ga0207687_10303574 3300025927 Bacteria 1286
221 Ga0207687_10679309 3300025927 Bacteria 873
222 Ga0207644_10060712 3300025931 Bacteria 2736
223 Ga0207644_10233492 3300025931 Bacteria 1462
224 Ga0207690_10023576 3300025932 Bacteria 3842
225 Ga0207706_10001666 3300025933 Bacteria 21960
226 Ga0207706_10087620 3300025933 Unclassified 2738
227 Ga0207686_10004437 3300025934 Bacteria 7523
228 Ga0207686_10216907 3300025934 Unclassified 1379
229 Ga0207670_10593802 3300025936 Bacteria 908
230 Ga0207670_11184401 3300025936 Unclassified 646
231 Ga0207669_10844932 3300025937 Unclassified 762
232 Ga0207691_10007114 3300025940 Bacteria 10802
233 Ga0207691_10008232 3300025940 Bacteria 10013
234 Ga0207691_10558546 3300025940 Bacteria 970
235 Ga0207711_10350792 3300025941 Unclassified 1366
236 Ga0207711_11231324 3300025941 Bacteria 690
237 Ga0207689_10001727 3300025942 Bacteria 20649
238 Ga0207689_10787713 3300025942 Unclassified 803
239 Ga0207661_10003113 3300025944 Bacteria 11484
240 Ga0207661_10173212 3300025944 Unclassified 1880
241 Ga0207661_10216074 3300025944 Bacteria 1692
242 Ga0207661_11791142 3300025944 Unclassified 559
243 Ga0207661_11817186 3300025944 Bacteria 555
244 Ga0207679_10004259 3300025945 Bacteria 8887
245 Ga0207679_10004925 3300025945 Bacteria 8328
246 Ga0207679_10064917 3300025945 Unclassified 2730
247 Ga0207679_10239823 3300025945 Bacteria 1536
248 Ga0207667_10038465 3300025949 Bacteria 5110
249 Ga0207651_10154951 3300025960 Bacteria 1788
250 Ga0207651_10487225 3300025960 Unclassified 1064
251 Ga0207712_10500897 3300025961 Bacteria 1038
252 Ga0207668_10925230 3300025972 Bacteria 777
253 Ga0207677_10376308 3300026023 Bacteria 1197
254 Ga0207703_10452464 3300026035 Bacteria 1199
255 Ga0207703_11633474 3300026035 Unclassified 620
256 Ga0207639_10162897 3300026041 Bacteria 1881
257 Ga0207702_10213479 3300026078 Bacteria 1795
258 Ga0207702_10938662 3300026078 Unclassified 858
259 Ga0207641_11064415 3300026088 Unclassified 807
260 Ga0207648_10044617 3300026089 Bacteria 3890
261 Ga0207676_10005737 3300026095 Bacteria 8783
262 Ga0207676_10072901 3300026095 Bacteria 2762
263 Ga0207674_10000421 3300026116 Bacteria 55179
264 Ga0207674_10005477 3300026116 Bacteria 15080
265 Ga0207683_10429237 3300026121 Bacteria 1217
266 Ga0207698_11786444 3300026142 Unclassified 630
267 Ga0268265_10221865 3300028380 Bacteria 1655
268 Ga0268265_10233020 3300028380 Bacteria 1619
269 Ga0268264_10347213 3300028381 Bacteria 1411
270 Ga0268264_12068036 3300028381 Bacteria 578
271 Ga0307408_100814656 3300031548 Unclassified 848
272 Ga0307409_100422786 3300031995 Unclassified 1279
273 Ga0307416_101381609 3300032002 Bacteria 810
274 Ga0307414_10265863 3300032004 Unclassified 1434
275 Ga0307411_10487720 3300032005 Unclassified 1039
276 Ga0373926_0000159 3300035083 Bacteria 14821
277 Ga0373944_0104039 3300035089 Bacteria 962
278 Ga0373936_0007711 3300035113 Bacteria 4042
279 Ga0373943_0001063 3300035170 Bacteria 12209
280 Ga0373946_0030286 3300035171 Bacteria 2159
281 Ga0373935_0000421 3300035692 Bacteria 22081
282 Ga0373927_0001209 3300035695 Bacteria 19588
283 Ga0373947_0000021 3300035725 Bacteria 89576
284 Ga0373925_0000404 3300037068 Bacteria 43931
285 Ga0436362_0529052 3300039453 Bacteria 873
286 Ga0450923_029901 3300042125 Unclassified 1106
287 Ga0495603_0007002 3300046455 Bacteria 6769
288 Ga0495629_0031866 3300046459 Bacteria 3733
289 Ga0495580_0000722 3300046472 Bacteria 28259
290 Ga0495582_0001043 3300046473 Bacteria 15549
291 Ga0495582_0016840 3300046473 Bacteria 4002
292 Ga0495639_0000027 3300046475 Bacteria 68298
293 Ga0495594_0279259 3300046499 Bacteria 952
294 Ga0495596_0057014 3300046500 Bacteria 1525
295 Ga0495630_0000527 3300046517 Bacteria 28192
296 Ga0495665_0000010 3300046531 Bacteria 71277
297 Ga0495665_0069063 3300046531 Bacteria 1863
298 Ga0495645_0163699 3300046543 Bacteria 1536
299 Ga0495588_0000954 3300046674 Bacteria 12602
300 Ga0495588_0124137 3300046674 Bacteria 1361
301 Ga0495658_0000072 3300046683 Bacteria 52083
302 Ga0495658_0082963 3300046683 Bacteria 1884
303 Ga0495613_0011521 3300046689 Bacteria 6577
304 Ga0495581_0000458 3300047315 Bacteria 20890
305 Ga0495581_0019220 3300047315 Bacteria 3965
306 Ga0495581_0519315 3300047315 Unclassified 692
307 Ga0495685_007818 3300047447 Bacteria 3536
308 Ga0495593_0000208 3300047673 Bacteria 30996
309 Ga0495614_0000043 3300048089 Bacteria 38806
310 Ga0495615_0084091 3300048090 Bacteria 877
311 Ga0496104_0404872 3300048907 Bacteria 1277
312 Ga0496106_0815706 3300048909 Unclassified 740
313 Ga0496112_0001305 3300048915 Bacteria 18935
314 Ga0496113_0097535 3300048916 Bacteria 2274
315 Ga0501299_093779 3300049522 Unclassified 686
316 Ga0501031_0397419 3300049568 Bacteria 892
317 Ga0501032_0000557 3300049569 Bacteria 30210
318 Ga0501034_0002346 3300049571 Bacteria 23096
319 Ga0501036_0008261 3300049572 Bacteria 8533
320 Ga0501036_0951878 3300049572 Unclassified 704
321 Ga0501038_0004954 3300049574 Bacteria 12366
322 Ga0501039_0001705 3300049575 Bacteria 16186
323 Ga0501040_0511516 3300049576 Bacteria 866
324 Ga0501042_0485191 3300049578 Bacteria 897
325 Ga0501043_0009181 3300049579 Bacteria 7772
326 Ga0501046_0000201 3300049580 Bacteria 61759
327 Ga0501047_0001125 3300049581 Bacteria 26581
328 Ga0501048_0022760 3300049582 Bacteria 4581
329 Ga0501068_0003026 3300049584 Bacteria 8968
330 Ga0501069_0052646 3300049585 Bacteria 2267
331 Ga0501069_0620215 3300049585 Bacteria 650
332 Ga0501071_0648052 3300049587 Bacteria 813
333 Ga0501072_0242615 3300049588 Bacteria 1435
334 Ga0501073_0002654 3300049589 Bacteria 13400
335 Ga0501073_0041332 3300049589 Bacteria 3258
336 Ga0501074_1122482 3300049590 Bacteria 552
337 Ga0501247_052290 3300049677 Unclassified 609
338 Ga0501259_010368 3300049688 Bacteria 1522
339 Ga0501080_0001511 3300049742 Bacteria 19645
340 Ga0501083_0067936 3300049744 Bacteria 2372
341 Ga0501083_0080885 3300049744 Bacteria 2154
342 Ga0501035_0002515 3300049822 Bacteria 17925
343 Ga0501044_0000893 3300049823 Bacteria 36023
344 Ga0501044_0257735 3300049823 Bacteria 1683
345 Ga0501044_0723354 3300049823 Bacteria 879
346 nmdc:mga05p37_139633_c1 3300050507 Bacteria 2969
347 nmdc:mga05p37_241738_c1 3300050507 Bacteria 2170
348 nmdc:mga05p37_805207_c1 3300050507 Unclassified 1027
349 nmdc:mga05p37_99442_c1 3300050507 Bacteria 3583
350 nmdc:mga09592_1322279_c1 3300050508 Unclassified 592
351 nmdc:mga09592_394320_c1 3300050508 Unclassified 1197
352 nmdc:mga09592_649854_c1 3300050508 Bacteria 900
353 nmdc:mga09592_67862_c1 3300050508 Unclassified 3025
354 nmdc:mga09592_69526_c1 3300050508 Bacteria 2987
355 nmdc:mga0qj67_27242_c1 3300050509 Unclassified 4427
356 nmdc:mga0qj67_702172_c1 3300050509 Unclassified 805
357 nmdc:mga06r32_130704_c1 3300050510 Bacteria 2483
358 nmdc:mga06r32_184747_c1 3300050510 Bacteria 2071
359 nmdc:mga06r32_49268_c1 3300050510 Bacteria 4028
360 nmdc:mga0n895_13500_c1 3300050512 Bacteria 7373
361 nmdc:mga0n895_25465_c1 3300050512 Bacteria 5590
362 nmdc:mga0n895_31515_c1 3300050512 Bacteria 5077
363 nmdc:mga0n895_7997_c1 3300050512 Bacteria 9121
364 nmdc:mga0n895_889877_c1 3300050512 Unclassified 876
365 nmdc:mga0rr50_244766_c1 3300050513 Unclassified 1487
366 nmdc:mga0rr50_3245_c1 3300050513 Bacteria 9318
367 nmdc:mga0rr50_354052_c1 3300050513 Bacteria 1235
368 nmdc:mga0rr50_44162_c1 3300050513 Bacteria 3267
369 nmdc:mga0rr50_538349_c1 3300050513 Unclassified 994
370 nmdc:mga0rr50_558899_c1 3300050513 Unclassified 974
371 nmdc:mga08x19_78458_c1 3300050514 Bacteria 2164
372 nmdc:mga0a205_136388_c1 3300050515 Bacteria 2354
373 nmdc:mga0a205_173540_c1 3300050515 Bacteria 2052
374 nmdc:mga0a205_241_c1 3300050515 Bacteria 38813
375 nmdc:mga0a205_34114_c1 3300050515 Bacteria 4882
376 nmdc:mga0a205_9978_c1 3300050515 Bacteria 8714
377 Ga0495601_0337207 3300053077 Bacteria 981
378 Ga0495595_0409011 3300053084 Bacteria 688
379 Ga0501084_0222317 3300054114 Bacteria 1593
380 Ga0501084_0494998 3300054114 Bacteria 1033
381 Ga0590071_000549 3300059421 Bacteria 10879
382 Ga0590075_002468 3300059424 Bacteria 4424
383 Ga0590077_000027 3300059426 Bacteria 33787
384 Ga0501082_0025977 3300060353 Bacteria 5047
385 Ga0070672_100103061
386 JGI24746J21847_1046435
387 Ga0065712_10115360
388 Ga0070683_100015756
389 Ga0070683_100019116
390 Ga0070683_100020234
391 Ga0070690_100005417
392 Ga0070670_100009461
393 Ga0070670_100578890
394 Ga0068869_100001949
395 Ga0070666_10284734
396 Ga0070680_100018353
397 Ga0070682_100005960
398 Ga0068868_100019384
399 Ga0070660_100706072
400 Ga0070689_100125817
401 Ga0070689_100289505
402 Ga0070687_100025030
403 Ga0070661_100009045
404 Ga0070661_100010557
405 Ga0070661_100015866
406 Ga0070661_100339513
407 Ga0070692_10040687
408 Ga0070668_101012222
409 Ga0070669_100002539
410 Ga0070669_100296229
411 Ga0070669_100730007
412 Ga0070675_100011326
413 Ga0070675_100251939
414 Ga0070674_100105110
415 Ga0070674_100132604
416 Ga0070673_100014914
417 Ga0070673_100312433
418 Ga0070673_101032898
419 Ga0070688_100139951
420 Ga0070659_100001041
421 Ga0070667_100440588
422 Ga0070705_100009611
423 Ga0070705_100091658
424 Ga0070700_101396603
425 Ga0070678_100051781
426 Ga0070678_101039415
427 Ga0070662_100063024
428 Ga0070662_100601381
429 Ga0070681_10001143
430 Ga0070681_10017152
431 Ga0068867_100564767
432 Ga0070685_10014998
433 Ga0070685_10874810
434 Ga0070707_100000535
435 Ga0070698_100000047
436 Ga0070698_100820888
437 Ga0070679_100020022
438 Ga0070684_100014275
439 Ga0070684_100025413
440 Ga0070684_100181700
441 Ga0068853_100060710
442 Ga0070672_100019465
443 Ga0070672_100027835
444 Ga0070672_100102285
445 Ga0070672_100406215
446 Ga0070672_100959222
447 Ga0070686_100032745
448 Ga0070695_100126651
449 Ga0070693_100050298
450 Ga0068855_100032907
451 Ga0068855_100394155
452 Ga0070664_100040987
453 Ga0070664_100248573
454 Ga0070664_101406396
455 Ga0068854_100348613
456 Ga0068854_100983472
457 Ga0068856_100009407
458 Ga0068856_100308500
459 Ga0070702_100000333
460 Ga0068852_100350210
461 Ga0068859_100024121
462 Ga0068859_100027925
463 Ga0068864_100002119
464 Ga0068864_100088144
465 Ga0068866_10231071
466 Ga0068851_10541141
467 Ga0068870_10001514
468 Ga0068870_10321508
469 Ga0068863_100024067
470 Ga0068863_101447691
471 Ga0068858_100016936
472 Ga0068860_100626187
473 Ga0068862_100215916
474 Ga0068862_101162573
475 Ga0081540_1043456
476 Ga0097621_100014016
477 Ga0097621_100238008
478 Ga0097621_100818487
479 Ga0097621_101493797
480 Ga0068871_100017630
481 Ga0068871_100168912
482 Ga0068871_100579117
483 Ga0075428_100012246
484 Ga0075428_100063875
485 Ga0075428_100071437
486 Ga0075428_100747962
487 Ga0075428_101652802
488 Ga0075430_100001208
489 Ga0075431_100009185
490 Ga0075431_100055344
491 Ga0075431_100063093
492 Ga0075431_100112427
493 Ga0075431_100281535
494 Ga0075431_100939389
495 Ga0075433_10008173
496 Ga0075433_10042572
497 Ga0075433_10230280
498 Ga0075434_100000039
499 Ga0075434_100023405
500 Ga0075434_100047343
501 Ga0075434_100082680
502 Ga0075434_100129210
503 Ga0075434_100970180
504 Ga0075434_101002456
505 Ga0075429_100011322
506 Ga0075429_100025760
507 Ga0075429_100113629
508 Ga0075429_100733240
509 Ga0068865_100175666
510 Ga0068865_100384008
511 Ga0075436_100289131
512 Ga0097620_100024123
513 Ga0097620_100027926
514 Ga0075435_100119904
515 Ga0075435_100170546
516 Ga0075435_100490303
517 Ga0075435_100499851
518 Ga0075435_100733711
519 Ga0099794_10076531
520 Ga0105240_10065718
521 Ga0111539_10167235
522 Ga0105245_10003349
523 Ga0105245_10122575
524 Ga0105245_10424849
525 Ga0105247_10536129
526 Ga0114129_10038368
527 Ga0114129_10072508
528 Ga0114129_11013486
529 Ga0105243_10343562
530 Ga0105241_10010204
531 Ga0105242_10000971
532 Ga0105242_10025221
533 Ga0105242_10045561
534 Ga0105248_10002091
535 Ga0105248_10123156
536 Ga0105248_10136908
537 Ga0105248_11125847
538 Ga0105237_10801049
539 Ga0105238_10197548
540 Ga0105249_10097472
541 Ga0105249_10178014
542 Ga0105249_10750017
543 Ga0105249_11719849
544 Ga0105239_10051858
545 Ga0105239_10423922
546 Ga0105239_10671815
547 Ga0105246_10019633
548 Ga0105246_10049757
549 Ga0105246_10389050
550 Ga0157373_10004256
551 Ga0157371_10006569
552 Ga0157370_10007853
553 Ga0157370_10090550
554 Ga0157369_10078876
555 Ga0157369_10089750
556 Ga0157369_10273934
557 Ga0157374_10029497
558 Ga0157374_10493030
559 Ga0157378_11219942
560 Ga0163162_10215279
561 Ga0157372_10007811
562 Ga0157372_10022495
563 Ga0157372_10050477
564 Ga0157375_10008972
565 Ga0157375_10016409
566 Ga0157375_11666417
567 Ga0163163_10069788
568 Ga0163163_10576402
569 Ga0157377_10001005
570 Ga0157376_10085123
571 Ga0157376_10532554
572 Ga0157376_11230447
573 Ga0207697_10149477
574 Ga0207692_10251884
575 Ga0207688_10463101
576 Ga0207643_10003211
577 Ga0207643_10046051
578 Ga0207643_10309346
579 Ga0207705_10309465
580 Ga0207705_10643228
581 Ga0207684_10180397
582 Ga0207707_10023764
583 Ga0207695_10007813
584 Ga0207695_10082833
585 Ga0207660_10065685
586 Ga0207662_10004875
587 Ga0207662_10040449
588 Ga0207662_10050437
589 Ga0207649_10008090
590 Ga0207652_10014599
591 Ga0207646_10002029
592 Ga0207646_10856988
593 Ga0207681_10212004
594 Ga0207681_10222951
595 Ga0207681_10911874
596 Ga0207650_10034927
597 Ga0207650_10039017
598 Ga0207650_10457362
599 Ga0207659_10005394
600 Ga0207659_10014991
601 Ga0207659_10016871
602 Ga0207687_10010714
603 Ga0207687_10257187
604 Ga0207687_10303574
605 Ga0207687_10679309
606 Ga0207644_10060712
607 Ga0207644_10233492
608 Ga0207690_10023576
609 Ga0207706_10001666
610 Ga0207706_10087620
611 Ga0207686_10004437
612 Ga0207686_10216907
613 Ga0207670_10593802
614 Ga0207670_11184401
615 Ga0207669_10844932
616 Ga0207691_10007114
617 Ga0207691_10008232
618 Ga0207691_10558546
619 Ga0207711_10350792
620 Ga0207711_11231324
621 Ga0207689_10001727
622 Ga0207689_10787713
623 Ga0207661_10003113
624 Ga0207661_10173212
625 Ga0207661_10216074
626 Ga0207661_11791142
627 Ga0207661_11817186
628 Ga0207679_10004259
629 Ga0207679_10004925
630 Ga0207679_10064917
631 Ga0207679_10239823
632 Ga0207667_10038465
633 Ga0207651_10154951
634 Ga0207651_10487225
635 Ga0207712_10500897
636 Ga0207668_10925230
637 Ga0207677_10376308
638 Ga0207703_10452464
639 Ga0207703_11633474
640 Ga0207639_10162897
641 Ga0207702_10213479
642 Ga0207702_10938662
643 Ga0207641_11064415
644 Ga0207648_10044617
645 Ga0207676_10005737
646 Ga0207676_10072901
647 Ga0207674_10000421
648 Ga0207674_10005477
649 Ga0207683_10429237
650 Ga0207698_11786444
651 Ga0268265_10221865
652 Ga0268265_10233020
653 Ga0268264_10347213
654 Ga0268264_12068036
655 Ga0307408_100814656
656 Ga0307409_100422786
657 Ga0307416_101381609
658 Ga0307414_10265863
659 Ga0307411_10487720
660 Ga0373926_0000159
661 Ga0373944_0104039
662 Ga0373936_0007711
663 Ga0373943_0001063
664 Ga0373946_0030286
665 Ga0373935_0000421
666 Ga0373927_0001209
667 Ga0373947_0000021
668 Ga0373925_0000404
669 Ga0436362_0529052
670 Ga0450923_029901
671 Ga0495603_0007002
672 Ga0495629_0031866
673 Ga0495580_0000722
674 Ga0495582_0001043
675 Ga0495582_0016840
676 Ga0495639_0000027
677 Ga0495594_0279259
678 Ga0495596_0057014
679 Ga0495630_0000527
680 Ga0495665_0000010
681 Ga0495665_0069063
682 Ga0495645_0163699
683 Ga0495588_0000954
684 Ga0495588_0124137
685 Ga0495658_0000072
686 Ga0495658_0082963
687 Ga0495613_0011521
688 Ga0495581_0000458
689 Ga0495581_0019220
690 Ga0495581_0519315
691 Ga0495685_007818
692 Ga0495593_0000208
693 Ga0495614_0000043
694 Ga0495615_0084091
695 Ga0496104_0404872
696 Ga0496106_0815706
697 Ga0496112_0001305
698 Ga0496113_0097535
699 Ga0501299_093779
700 Ga0501031_0397419
701 Ga0501032_0000557
702 Ga0501034_0002346
703 Ga0501036_0008261
704 Ga0501036_0951878
705 Ga0501038_0004954
706 Ga0501039_0001705
707 Ga0501040_0511516
708 Ga0501042_0485191
709 Ga0501043_0009181
710 Ga0501046_0000201
711 Ga0501047_0001125
712 Ga0501048_0022760
713 Ga0501068_0003026
714 Ga0501069_0052646
715 Ga0501069_0620215
716 Ga0501071_0648052
717 Ga0501072_0242615
718 Ga0501073_0002654
719 Ga0501073_0041332
720 Ga0501074_1122482
721 Ga0501247_052290
722 Ga0501259_010368
723 Ga0501080_0001511
724 Ga0501083_0067936
725 Ga0501083_0080885
726 Ga0501035_0002515
727 Ga0501044_0000893
728 Ga0501044_0257735
729 Ga0501044_0723354
730 nmdc:mga05p37_139633_c1
731 nmdc:mga05p37_241738_c1
732 nmdc:mga05p37_805207_c1
733 nmdc:mga05p37_99442_c1
734 nmdc:mga09592_1322279_c1
735 nmdc:mga09592_394320_c1
736 nmdc:mga09592_649854_c1
737 nmdc:mga09592_67862_c1
738 nmdc:mga09592_69526_c1
739 nmdc:mga0qj67_27242_c1
740 nmdc:mga0qj67_702172_c1
741 nmdc:mga06r32_130704_c1
742 nmdc:mga06r32_184747_c1
743 nmdc:mga06r32_49268_c1
744 nmdc:mga0n895_13500_c1
745 nmdc:mga0n895_25465_c1
746 nmdc:mga0n895_31515_c1
747 nmdc:mga0n895_7997_c1
748 nmdc:mga0n895_889877_c1
749 nmdc:mga0rr50_244766_c1
750 nmdc:mga0rr50_3245_c1
751 nmdc:mga0rr50_354052_c1
752 nmdc:mga0rr50_44162_c1
753 nmdc:mga0rr50_538349_c1
754 nmdc:mga0rr50_558899_c1
755 nmdc:mga08x19_78458_c1
756 nmdc:mga0a205_136388_c1
757 nmdc:mga0a205_173540_c1
758 nmdc:mga0a205_241_c1
759 nmdc:mga0a205_34114_c1
760 nmdc:mga0a205_9978_c1
761 Ga0495601_0337207
762 Ga0495595_0409011
763 Ga0501084_0222317
764 Ga0501084_0494998
765 Ga0590071_000549
766 Ga0590075_002468
767 Ga0590077_000027
768 Ga0501082_0025977

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

2

145

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.9339 3 154
3l8u-assembly1.cif.gz_B crystal structure of smu.1707c, a putative rrna methyltransferase from streptococcus mutans ua159 0.924 1 153
5co4-assembly1.cif.gz_B structural insights into the 2-oh methylation of c/u34 on trna 0.9226 3 151
3l8u-assembly1.cif.gz_A crystal structure of smu.1707c, a putative rrna methyltransferase from streptococcus mutans ua159 0.9213 1 153
7e3t-assembly1.cif.gz_A-2 crystal structure of trml from mycoplasma capricolum 0.9175 2 151
ID Description Score Start End Superfamily
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9339 3 154 3.40.1280.10
3l8uA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9213 1 153 3.40.1280.10
4pzkB00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9049 2 153 3.40.1280.10
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8988 3 154 3.40.1280.10
af_C6TCU8_69_240_3.40.1280.10 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8827 3 153 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A257V5N0-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9631 1 153 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A7V4L968-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9586 2 155 GO:0002130
GO:0003723
GO:0005737
GO:0008175
GO:0008757
AF-A0A2V2S096-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9572 3 151 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A2A2XYI8-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.957 3 151 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A844G4I2-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9559 2 158 GO:0002130
GO:0003723
GO:0005737
GO:0008175
GO:0008757

Map