F429812

General Info

Members Datasets Scaffolds Average Seq Length
384 220 768 421

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10006537|Ga0070709_100065375
Length 443
Sequence LTSPPRHGTHQRCDECGAEFGDLQTITRCSRCGGLLTLVYDAPGERSAALRERFDTRRNAGASCDPLRDARVSPDASGVWRYRELVLPDAAASEIISHPEGNTPLLRRAAVGRWCGVDAVLMKHEGVNPTGSFKDRGMTVAVTQACRVGATAVACASTGNTAASLXXYAAHAGLPALVLVPNGQVSLGKLAQSLAYGARTLLVRGDFDDCLRLVDEAADQLGVYLANSISPYRIAGQKTIVFEILQQLAWRAPDWIALPAGNLGNTSAFGAALHEALELGLIDRLPRLAAVQASGAAPFAASYREGFRVRHKVRAETVATAIRIGDPASYTRAVRVIRETNGVVLDVSDAAILHAKAVVDASGVGCEPASAASIAGVRELVSRGVIRPDDVVVAVLTGHVLKDPGVLLQYHRETDPAPADANRPIEIEATLSEVERVLKSLSF

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
15 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
16 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
17 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
18 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
30 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
31 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
32 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
33 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
34 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
35 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
36 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
37 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
42 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
43 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
44 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
45 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
48 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
51 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
56 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
57 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
58 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
63 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
69 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
70 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
71 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
72 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
73 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
74 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
87 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
138 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
139 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
140 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
141 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
142 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
143 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
144 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
145 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
146 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
147 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
148 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
149 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
150 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
153 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
154 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
155 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
156 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
157 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
158 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
159 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
160 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
162 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
163 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
168 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
169 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
170 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
171 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
172 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
175 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
180 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
181 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
182 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
185 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
186 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
187 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
188 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
189 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
190 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
191 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
192 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
193 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
194 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
195 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
206 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
207 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
208 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
212 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
213 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
214 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
215 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
216 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
217 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.17
Rhizosphere 95.31
Stem 0
Stem Tuber 0
Unclassified 7.81

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10006537 3300005434 Bacteria 6357
2 Ga0065707_10006701 3300005295 Bacteria 2854
3 Ga0070658_10151782 3300005327 Bacteria 1940
4 Ga0070676_10003123 3300005328 Bacteria 8555
5 Ga0070683_100009209 3300005329 Bacteria 8433
6 Ga0070683_100012961 3300005329 Archaea 7256
7 Ga0070670_100207615 3300005331 Unclassified 1702
8 Ga0070677_10034906 3300005333 Bacteria 1946
9 Ga0068869_100028172 3300005334 Bacteria 3923
10 Ga0068869_100050642 3300005334 Bacteria 3011
11 Ga0070680_100020034 3300005336 Bacteria 5303
12 Ga0070680_100107562 3300005336 Bacteria 2320
13 Ga0068868_100017986 3300005338 Bacteria 5275
14 Ga0070660_100050679 3300005339 Bacteria 3195
15 Ga0070660_100116152 3300005339 Unclassified 2134
16 Ga0070691_10029710 3300005341 Bacteria 2558
17 Ga0070668_100011037 3300005347 Bacteria 6724
18 Ga0070669_100003899 3300005353 Bacteria 10792
19 Ga0070669_100022620 3300005353 Bacteria 4495
20 Ga0070669_100022708 3300005353 Unclassified 4486
21 Ga0070675_100007922 3300005354 Bacteria 8234
22 Ga0070675_100010309 3300005354 Bacteria 7295
23 Ga0070674_100002705 3300005356 Bacteria 9804
24 Ga0070674_100231007 3300005356 Bacteria 1444
25 Ga0070673_100011820 3300005364 Bacteria 5974
26 Ga0070688_100008129 3300005365 Bacteria 5685
27 Ga0070688_100012688 3300005365 Bacteria 4727
28 Ga0070667_100191560 3300005367 Bacteria 1812
29 Ga0070709_10021785 3300005434 Bacteria 3739
30 Ga0070714_100006847 3300005435 Bacteria 8834
31 Ga0070714_100008134 3300005435 Bacteria 8172
32 Ga0070714_100047884 3300005435 Bacteria 3634
33 Ga0070713_100003481 3300005436 Bacteria 10381
34 Ga0070711_100038257 3300005439 Bacteria 3225
35 Ga0070705_100003029 3300005440 Bacteria 8297
36 Ga0070705_100104914 3300005440 Bacteria 1793
37 Ga0070708_100000007 3300005445 Bacteria 146443
38 Ga0070708_100178476 3300005445 Bacteria 1984
39 Ga0070663_100122207 3300005455 Bacteria 1968
40 Ga0070662_100000330 3300005457 Bacteria 28434
41 Ga0070662_100026126 3300005457 Unclassified 4041
42 Ga0070662_100168761 3300005457 Bacteria 1717
43 Ga0070681_10011077 3300005458 Bacteria 8920
44 Ga0068867_100006124 3300005459 Bacteria 8515
45 Ga0070685_10009646 3300005466 Bacteria 4997
46 Ga0070706_100050803 3300005467 Bacteria 3826
47 Ga0070706_100107821 3300005467 Bacteria 2591
48 Ga0070707_100003112 3300005468 Bacteria 15705
49 Ga0070707_100026892 3300005468 Bacteria 5468
50 Ga0070707_100215426 3300005468 Bacteria 1871
51 Ga0070698_100007602 3300005471 Bacteria 11728
52 Ga0070698_100270921 3300005471 Bacteria 1629
53 Ga0070699_100012434 3300005518 Bacteria 7345
54 Ga0070699_100023622 3300005518 Bacteria 5296
55 Ga0070699_100046505 3300005518 Bacteria 3755
56 Ga0070699_100188053 3300005518 Bacteria 1834
57 Ga0070679_100002620 3300005530 Bacteria 16363
58 Ga0070679_100086994 3300005530 Bacteria 3112
59 Ga0070684_100011789 3300005535 Bacteria 6975
60 Ga0070684_100023661 3300005535 Bacteria 5143
61 Ga0070684_100034471 3300005535 Bacteria 4328
62 Ga0070684_100077877 3300005535 Bacteria 2929
63 Ga0070684_100185882 3300005535 Bacteria 1890
64 Ga0070697_100014494 3300005536 Bacteria 6193
65 Ga0070697_100047511 3300005536 Bacteria 3480
66 Ga0070697_100264991 3300005536 Bacteria 1472
67 Ga0068853_100033515 3300005539 Unclassified 4358
68 Ga0068853_100083260 3300005539 Bacteria 2803
69 Ga0068853_100120530 3300005539 Bacteria 2339
70 Ga0070672_100011651 3300005543 Bacteria 6137
71 Ga0070686_100175230 3300005544 Unclassified 1520
72 Ga0070696_100001521 3300005546 Bacteria 15219
73 Ga0070696_100012482 3300005546 Bacteria 5701
74 Ga0070704_100040672 3300005549 Bacteria 3202
75 Ga0070704_100058587 3300005549 Bacteria 2744
76 Ga0068855_100031895 3300005563 Bacteria 6289
77 Ga0068855_100288084 3300005563 Bacteria 1821
78 Ga0070664_100003604 3300005564 Bacteria 12475
79 Ga0070664_100052842 3300005564 Bacteria 3442
80 Ga0070664_100166585 3300005564 Bacteria 1953
81 Ga0068857_100002724 3300005577 Bacteria 14505
82 Ga0068857_100007171 3300005577 Bacteria 9604
83 Ga0068857_100017871 3300005577 Bacteria 6219
84 Ga0068857_100119107 3300005577 Bacteria 2376
85 Ga0068854_100002506 3300005578 Bacteria 11389
86 Ga0068854_100018023 3300005578 Unclassified 4733
87 Ga0068852_100123865 3300005616 Unclassified 2371
88 Ga0068852_100160556 3300005616 Bacteria 2098
89 Ga0068864_100002665 3300005618 Bacteria 14740
90 Ga0068864_100034827 3300005618 Bacteria 4284
91 Ga0068864_100139067 3300005618 Bacteria 2189
92 Ga0068864_100158877 3300005618 Bacteria 2053
93 Ga0068866_10000284 3300005718 Bacteria 24229
94 Ga0068861_100009948 3300005719 Bacteria 6584
95 Ga0068861_100029089 3300005719 Unclassified 4038
96 Ga0068870_10001241 3300005840 Bacteria 10245
97 Ga0068863_100022616 3300005841 Bacteria 6005
98 Ga0068858_100020621 3300005842 Bacteria 6157
99 Ga0068860_100002458 3300005843 Bacteria 19449
100 Ga0068860_100018371 3300005843 Bacteria 6803
101 Ga0068862_100005918 3300005844 Bacteria 10184
102 Ga0068862_100016253 3300005844 Bacteria 6193
103 Ga0068862_100030572 3300005844 Bacteria 4539
104 Ga0081455_10106214 3300005937 Archaea 2241
105 Ga0070717_10000725 3300006028 Bacteria 21446
106 Ga0075428_100336027 3300006844 Bacteria 1622
107 Ga0075430_100005314 3300006846 Bacteria 10868
108 Ga0075430_100011952 3300006846 Bacteria 7392
109 Ga0075431_100022808 3300006847 Bacteria 6399
110 Ga0075431_100076269 3300006847 Bacteria 3459
111 Ga0075433_10154783 3300006852 Bacteria 2039
112 Ga0075433_10236073 3300006852 Bacteria 1623
113 Ga0075434_100120011 3300006871 Bacteria 2644
114 Ga0068865_100002473 3300006881 Bacteria 10937
115 Ga0068865_100055278 3300006881 Unclassified 2761
116 Ga0075436_100025103 3300006914 Bacteria 4098
117 Ga0075436_100182226 3300006914 Unclassified 1484
118 Ga0075435_100151004 3300007076 Unclassified 1953
119 Ga0105240_10044221 3300009093 Bacteria 5662
120 Ga0105240_10247401 3300009093 Bacteria 2064
121 Ga0105240_10542108 3300009093 Bacteria 1288
122 Ga0111539_10109195 3300009094 Bacteria 3246
123 Ga0114129_10170616 3300009147 Bacteria 2966
124 Ga0105243_10007707 3300009148 Bacteria 8277
125 Ga0105241_10034179 3300009174 Bacteria 3818
126 Ga0105242_10009169 3300009176 Bacteria 7596
127 Ga0105242_10022693 3300009176 Bacteria 4940
128 Ga0105248_10002442 3300009177 Bacteria 20625
129 Ga0105248_10024779 3300009177 Bacteria 6673
130 Ga0105248_10239938 3300009177 Bacteria 2040
131 Ga0105237_10004593 3300009545 Bacteria 15940
132 Ga0105237_10234444 3300009545 Bacteria 1836
133 Ga0105249_10001082 3300009553 Bacteria 24187
134 Ga0105249_10025770 3300009553 Bacteria 5296
135 Ga0105249_10040473 3300009553 Bacteria 4233
136 Ga0105249_10068228 3300009553 Bacteria 3279
137 Ga0105249_10104450 3300009553 Bacteria 2670
138 Ga0105249_10104998 3300009553 Bacteria 2663
139 Ga0105239_10018637 3300010375 Bacteria 7667
140 Ga0105246_10201568 3300011119 Bacteria 1547
141 Ga0157373_10021672 3300013100 Bacteria 4663
142 Ga0157373_10041772 3300013100 Bacteria 3279
143 Ga0157370_10197750 3300013104 Bacteria 1865
144 Ga0157369_10246249 3300013105 Bacteria 1866
145 Ga0157374_10023541 3300013296 Bacteria 5510
146 Ga0157378_10095889 3300013297 Bacteria 2702
147 Ga0157378_10403053 3300013297 Bacteria 1348
148 Ga0157372_10273820 3300013307 Bacteria 1962
149 Ga0157375_10023440 3300013308 Bacteria 5695
150 Ga0157375_10091027 3300013308 Unclassified 3111
151 Ga0157375_10213495 3300013308 Bacteria 2087
152 Ga0157375_10220948 3300013308 Bacteria 2053
153 Ga0163163_10019991 3300014325 Bacteria 6300
154 Ga0163163_10037492 3300014325 Bacteria 4716
155 Ga0157380_10003980 3300014326 Bacteria 10198
156 Ga0157380_10022966 3300014326 Bacteria 4704
157 Ga0157380_10162680 3300014326 Bacteria 1942
158 Ga0157377_10002944 3300014745 Bacteria 7613
159 Ga0157379_10034605 3300014968 Unclassified 4504
160 Ga0163161_10012295 3300017792 Bacteria 5941
161 Ga0213876_10017389 3300021384 Bacteria 3796
162 Ga0207697_10031822 3300025315 Unclassified 2158
163 Ga0207653_10003495 3300025885 Bacteria 4948
164 Ga0207682_10038920 3300025893 Bacteria 1931
165 Ga0207688_10045966 3300025901 Unclassified 2436
166 Ga0207699_10012924 3300025906 Bacteria 4256
167 Ga0207645_10000203 3300025907 Bacteria 48457
168 Ga0207645_10000536 3300025907 Bacteria 31571
169 Ga0207643_10003829 3300025908 Bacteria 8091
170 Ga0207643_10013158 3300025908 Bacteria 4476
171 Ga0207684_10001697 3300025910 Bacteria 23390
172 Ga0207684_10039845 3300025910 Bacteria 3983
173 Ga0207684_10087796 3300025910 Bacteria 2650
174 Ga0207707_10019840 3300025912 Bacteria 5868
175 Ga0207707_10087196 3300025912 Bacteria 2727
176 Ga0207663_10029990 3300025916 Bacteria 3202
177 Ga0207663_10075944 3300025916 Bacteria 2182
178 Ga0207660_10013129 3300025917 Bacteria 5425
179 Ga0207660_10014667 3300025917 Bacteria 5161
180 Ga0207660_10022401 3300025917 Bacteria 4256
181 Ga0207662_10043353 3300025918 Unclassified 2654
182 Ga0207657_10059929 3300025919 Bacteria 3268
183 Ga0207652_10033286 3300025921 Bacteria 4339
184 Ga0207652_10038544 3300025921 Bacteria 4052
185 Ga0207652_10065912 3300025921 Bacteria 3137
186 Ga0207646_10003599 3300025922 Bacteria 17369
187 Ga0207646_10039398 3300025922 Bacteria 4254
188 Ga0207646_10050859 3300025922 Bacteria 3708
189 Ga0207681_10009550 3300025923 Bacteria 5927
190 Ga0207694_10058669 3300025924 Bacteria 2994
191 Ga0207650_10065054 3300025925 Bacteria 2731
192 Ga0207659_10064460 3300025926 Unclassified 2652
193 Ga0207659_10076447 3300025926 Unclassified 2461
194 Ga0207700_10012782 3300025928 Bacteria 5429
195 Ga0207664_10021476 3300025929 Bacteria 4802
196 Ga0207706_10000038 3300025933 Bacteria 132725
197 Ga0207706_10001427 3300025933 Bacteria 23910
198 Ga0207706_10076718 3300025933 Unclassified 2939
199 Ga0207686_10000413 3300025934 Bacteria 29614
200 Ga0207669_10000761 3300025937 Bacteria 13916
201 Ga0207669_10115254 3300025937 Bacteria 1811
202 Ga0207669_10145904 3300025937 Bacteria 1650
203 Ga0207704_10041132 3300025938 Bacteria 2707
204 Ga0207665_10067902 3300025939 Bacteria 2428
205 Ga0207691_10003550 3300025940 Bacteria 15167
206 Ga0207691_10010675 3300025940 Bacteria 8816
207 Ga0207691_10030465 3300025940 Bacteria 5041
208 Ga0207691_10048224 3300025940 Bacteria 3906
209 Ga0207691_10067399 3300025940 Bacteria 3236
210 Ga0207711_10131628 3300025941 Unclassified 2243
211 Ga0207689_10005759 3300025942 Bacteria 11000
212 Ga0207661_10021844 3300025944 Bacteria 4804
213 Ga0207679_10053055 3300025945 Bacteria 2977
214 Ga0207679_10068123 3300025945 Unclassified 2672
215 Ga0207679_10162830 3300025945 Bacteria 1828
216 Ga0207679_10201278 3300025945 Bacteria 1663
217 Ga0207667_10038191 3300025949 Bacteria 5129
218 Ga0207667_10263012 3300025949 Bacteria 1764
219 Ga0207651_10045053 3300025960 Bacteria 2956
220 Ga0207668_10018920 3300025972 Bacteria 4342
221 Ga0207640_10000464 3300025981 Bacteria 24768
222 Ga0207677_10021772 3300026023 Unclassified 3925
223 Ga0207703_10086845 3300026035 Bacteria 2621
224 Ga0207639_10062931 3300026041 Bacteria 2871
225 Ga0207639_10175339 3300026041 Bacteria 1819
226 Ga0207678_10167528 3300026067 Bacteria 1876
227 Ga0207678_10258179 3300026067 Bacteria 1493
228 Ga0207708_10022285 3300026075 Bacteria 4782
229 Ga0207648_10000036 3300026089 Bacteria 122209
230 Ga0207676_10003713 3300026095 Bacteria 10798
231 Ga0207676_10039051 3300026095 Bacteria 3628
232 Ga0207676_10064589 3300026095 Bacteria 2912
233 Ga0207674_10000548 3300026116 Bacteria 49225
234 Ga0207674_10005980 3300026116 Bacteria 14402
235 Ga0207674_10010419 3300026116 Bacteria 10533
236 Ga0207674_10019667 3300026116 Bacteria 7312
237 Ga0207675_100001528 3300026118 Bacteria 23200
238 Ga0207675_100013065 3300026118 Bacteria 7750
239 Ga0207698_10105609 3300026142 Bacteria 2347
240 Ga0207698_10109782 3300026142 Bacteria 2309
241 Ga0207698_10262347 3300026142 Bacteria 1588
242 Ga0268266_10314569 3300028379 Bacteria 1464
243 Ga0268265_10001322 3300028380 Bacteria 21261
244 Ga0268265_10009314 3300028380 Bacteria 6637
245 Ga0268264_10001573 3300028381 Bacteria 21159
246 Ga0307405_10001343 3300031731 Bacteria 10311
247 Ga0307413_10050435 3300031824 Bacteria 2500
248 Ga0307413_10054258 3300031824 Bacteria 2431
249 Ga0307410_10001360 3300031852 Bacteria 10980
250 Ga0307410_10002471 3300031852 Bacteria 8930
251 Ga0307410_10010600 3300031852 Bacteria 5230
252 Ga0307410_10025865 3300031852 Bacteria 3688
253 Ga0307410_10035305 3300031852 Archaea 3246
254 Ga0307410_10067844 3300031852 Bacteria 2461
255 Ga0307406_10013189 3300031901 Bacteria 4730
256 Ga0307406_10015001 3300031901 Bacteria 4473
257 Ga0307407_10003373 3300031903 Bacteria 6537
258 Ga0307407_10007216 3300031903 Bacteria 5017
259 Ga0307407_10015098 3300031903 Bacteria 3804
260 Ga0307412_10052782 3300031911 Bacteria 2693
261 Ga0307409_100000729 3300031995 Bacteria 14742
262 Ga0307409_100002112 3300031995 Bacteria 10234
263 Ga0307409_100072245 3300031995 Archaea 2747
264 Ga0307409_100226115 3300031995 Bacteria 1692
265 Ga0307416_100003454 3300032002 Bacteria 9276
266 Ga0307416_100005481 3300032002 Bacteria 7797
267 Ga0307416_100008102 3300032002 Bacteria 6744
268 Ga0307416_100050900 3300032002 Bacteria 3305
269 Ga0307416_100057449 3300032002 Archaea 3148
270 Ga0307416_100069148 3300032002 Bacteria 2921
271 Ga0307416_100132660 3300032002 Bacteria 2246
272 Ga0307416_100383548 3300032002 Bacteria 1436
273 Ga0307414_10006884 3300032004 Bacteria 6363
274 Ga0307414_10041873 3300032004 Bacteria 3107
275 Ga0307414_10168057 3300032004 Unclassified 1750
276 Ga0307411_10001103 3300032005 Bacteria 10520
277 Ga0307411_10015066 3300032005 Bacteria 4327
278 Ga0307411_10024310 3300032005 Bacteria 3609
279 Ga0307411_10121846 3300032005 Bacteria 1889
280 Ga0307415_100138696 3300032126 Archaea 1854
281 Ga0307415_100250056 3300032126 Bacteria 1440
282 Ga0373934_0010663 3300035086 Bacteria 3452
283 Ga0373940_0005001 3300035088 Bacteria 2844
284 Ga0373923_0004796 3300035111 Bacteria 4526
285 Ga0373932_0025172 3300035112 Bacteria 1608
286 Ga0373941_0020350 3300035115 Bacteria 1859
287 Ga0373956_0004662 3300035119 Bacteria 5479
288 Ga0373955_0010387 3300035172 Bacteria 4395
289 Ga0373935_0154023 3300035692 Bacteria 1562
290 Ga0373927_0028770 3300035695 Unclassified 3624
291 Ga0373933_0001858 3300035724 Bacteria 12215
292 Ga0373933_0008761 3300035724 Bacteria 5515
293 Ga0373937_0022509 3300036401 Bacteria 5667
294 Ga0316584_0102009 3300036712 Bacteria 2149
295 Ga0373925_0075666 3300037068 Bacteria 2552
296 Ga0395905_0032738 3300037471 Bacteria 4887
297 Ga0436365_0623468 3300039437 Bacteria 2359
298 Ga0451577_0166727 3300042876 Bacteria 1984
299 Ga0451577_0246364 3300042876 Archaea 1617
300 Ga0451577_0295861 3300042876 Bacteria 1467
301 Ga0451576_0168584 3300045051 Bacteria 2285
302 Ga0495603_0052418 3300046455 Bacteria 2423
303 Ga0495603_0152628 3300046455 Bacteria 1341
304 Ga0495629_0006543 3300046459 Bacteria 8628
305 Ga0495638_0011987 3300046460 Bacteria 5959
306 Ga0495651_0028734 3300046462 Bacteria 4333
307 Ga0495651_0030780 3300046462 Bacteria 4184
308 Ga0495653_0001337 3300046463 Bacteria 19141
309 Ga0495580_0056522 3300046472 Bacteria 2763
310 Ga0495580_0161400 3300046472 Bacteria 1551
311 Ga0495582_0004565 3300046473 Bacteria 7778
312 Ga0495639_0011127 3300046475 Bacteria 3877
313 Ga0495594_0008397 3300046499 Bacteria 5323
314 Ga0495594_0018773 3300046499 Bacteria 3667
315 Ga0495608_0054151 3300046511 Bacteria 2653
316 Ga0495628_0036038 3300046516 Bacteria 3973
317 Ga0495666_0011910 3300046526 Bacteria 4340
318 Ga0495652_0003334 3300046529 Bacteria 15943
319 Ga0495665_0068908 3300046531 Bacteria 1865
320 Ga0495586_0123926 3300046535 Bacteria 1444
321 Ga0495587_0003006 3300046536 Bacteria 11274
322 Ga0495587_0020354 3300046536 Bacteria 4097
323 Ga0495645_0000856 3300046543 Bacteria 20729
324 Ga0495645_0021455 3300046543 Bacteria 4667
325 Ga0495667_0047609 3300046559 Bacteria 2832
326 Ga0495634_0005468 3300046642 Bacteria 9768
327 Ga0495657_0004867 3300046675 Bacteria 10692
328 Ga0495657_0105070 3300046675 Bacteria 1795
329 Ga0495599_0002385 3300046678 Bacteria 10931
330 Ga0495599_0002474 3300046678 Bacteria 10761
331 Ga0495623_0007643 3300046679 Bacteria 7023
332 Ga0495623_0009141 3300046679 Bacteria 6429
333 Ga0495646_0002100 3300046680 Bacteria 12078
334 Ga0495658_0001636 3300046683 Bacteria 11650
335 Ga0495624_0113102 3300046690 Bacteria 1669
336 Ga0495600_0013210 3300046809 Bacteria 5183
337 Ga0495581_0033278 3300047315 Bacteria 2984
338 Ga0495674_0002051 3300047319 Bacteria 19757
339 Ga0495674_0007260 3300047319 Bacteria 10604
340 Ga0495672_0001828 3300047320 Bacteria 20361
341 Ga0495680_0004128 3300047322 Bacteria 13961
342 Ga0495680_0038221 3300047322 Bacteria 3838
343 Ga0495675_0005930 3300047444 Bacteria 7465
344 Ga0495675_0080847 3300047444 Bacteria 2047
345 Ga0495684_0003249 3300047471 Bacteria 12764
346 Ga0495684_0065938 3300047471 Bacteria 2753
347 Ga0495602_0011341 3300048088 Bacteria 9220
348 Ga0495602_0021768 3300048088 Bacteria 6299
349 Ga0495602_0037074 3300048088 Bacteria 4530
350 Ga0496101_0090136 3300048904 Bacteria 2280
351 Ga0496101_0162549 3300048904 Bacteria 1713
352 Ga0496102_0009571 3300048905 Bacteria 8334
353 Ga0496105_0089686 3300048908 Bacteria 2540
354 Ga0496106_0052876 3300048909 Bacteria 3066
355 Ga0496106_0095715 3300048909 Bacteria 2297
356 Ga0496108_0005443 3300048911 Bacteria 10286
357 Ga0496109_0007265 3300048912 Bacteria 9366
358 Ga0496109_0011984 3300048912 Bacteria 7466
359 Ga0496111_0007555 3300048914 Bacteria 7131
360 Ga0496112_0003713 3300048915 Bacteria 12738
361 Ga0496112_0056470 3300048915 Bacteria 3864
362 Ga0496112_0134940 3300048915 Unclassified 2438
363 Ga0496113_0005200 3300048916 Bacteria 8095
364 Ga0496113_0055522 3300048916 Unclassified 2969
365 Ga0496114_0006898 3300048917 Bacteria 8947
366 Ga0501067_0038554 3300049583 Unclassified 2653
367 Ga0501068_0039332 3300049584 Bacteria 2836
368 Ga0501069_0030911 3300049585 Bacteria 2943
369 Ga0501069_0096876 3300049585 Bacteria 1672
370 Ga0501081_0068510 3300049743 Bacteria 2470
371 nmdc:mga05p37_327601_c1 3300050507 Bacteria 1810
372 nmdc:mga0qj67_80746_c1 3300050509 Bacteria 2606
373 nmdc:mga0qj67_9588_c1 3300050509 Bacteria 7216
374 nmdc:mga06r32_1663_c1 3300050510 Bacteria 20058
375 nmdc:mga0n895_173143_c1 3300050512 Bacteria 2190
376 nmdc:mga0n895_216887_c1 3300050512 Unclassified 1943
377 nmdc:mga0n895_95113_c1 3300050512 Unclassified 2984
378 nmdc:mga0rr50_27129_c1 3300050513 Bacteria 4005
379 nmdc:mga08x19_12003_c1 3300050514 Bacteria 5213
380 nmdc:mga08x19_31362_c1 3300050514 Bacteria 3343
381 nmdc:mga0a205_51596_c1 3300050515 Bacteria 3971
382 nmdc:mga0a205_95770_c1 3300050515 Bacteria 2867
383 Ga0495601_0031193 3300053077 Bacteria 3312
384 Ga0495612_0002126 3300053078 Bacteria 8143
385 Ga0070709_10006537
386 Ga0065707_10006701
387 Ga0070658_10151782
388 Ga0070676_10003123
389 Ga0070683_100009209
390 Ga0070683_100012961
391 Ga0070670_100207615
392 Ga0070677_10034906
393 Ga0068869_100028172
394 Ga0068869_100050642
395 Ga0070680_100020034
396 Ga0070680_100107562
397 Ga0068868_100017986
398 Ga0070660_100050679
399 Ga0070660_100116152
400 Ga0070691_10029710
401 Ga0070668_100011037
402 Ga0070669_100003899
403 Ga0070669_100022620
404 Ga0070669_100022708
405 Ga0070675_100007922
406 Ga0070675_100010309
407 Ga0070674_100002705
408 Ga0070674_100231007
409 Ga0070673_100011820
410 Ga0070688_100008129
411 Ga0070688_100012688
412 Ga0070667_100191560
413 Ga0070709_10021785
414 Ga0070714_100006847
415 Ga0070714_100008134
416 Ga0070714_100047884
417 Ga0070713_100003481
418 Ga0070711_100038257
419 Ga0070705_100003029
420 Ga0070705_100104914
421 Ga0070708_100000007
422 Ga0070708_100178476
423 Ga0070663_100122207
424 Ga0070662_100000330
425 Ga0070662_100026126
426 Ga0070662_100168761
427 Ga0070681_10011077
428 Ga0068867_100006124
429 Ga0070685_10009646
430 Ga0070706_100050803
431 Ga0070706_100107821
432 Ga0070707_100003112
433 Ga0070707_100026892
434 Ga0070707_100215426
435 Ga0070698_100007602
436 Ga0070698_100270921
437 Ga0070699_100012434
438 Ga0070699_100023622
439 Ga0070699_100046505
440 Ga0070699_100188053
441 Ga0070679_100002620
442 Ga0070679_100086994
443 Ga0070684_100011789
444 Ga0070684_100023661
445 Ga0070684_100034471
446 Ga0070684_100077877
447 Ga0070684_100185882
448 Ga0070697_100014494
449 Ga0070697_100047511
450 Ga0070697_100264991
451 Ga0068853_100033515
452 Ga0068853_100083260
453 Ga0068853_100120530
454 Ga0070672_100011651
455 Ga0070686_100175230
456 Ga0070696_100001521
457 Ga0070696_100012482
458 Ga0070704_100040672
459 Ga0070704_100058587
460 Ga0068855_100031895
461 Ga0068855_100288084
462 Ga0070664_100003604
463 Ga0070664_100052842
464 Ga0070664_100166585
465 Ga0068857_100002724
466 Ga0068857_100007171
467 Ga0068857_100017871
468 Ga0068857_100119107
469 Ga0068854_100002506
470 Ga0068854_100018023
471 Ga0068852_100123865
472 Ga0068852_100160556
473 Ga0068864_100002665
474 Ga0068864_100034827
475 Ga0068864_100139067
476 Ga0068864_100158877
477 Ga0068866_10000284
478 Ga0068861_100009948
479 Ga0068861_100029089
480 Ga0068870_10001241
481 Ga0068863_100022616
482 Ga0068858_100020621
483 Ga0068860_100002458
484 Ga0068860_100018371
485 Ga0068862_100005918
486 Ga0068862_100016253
487 Ga0068862_100030572
488 Ga0081455_10106214
489 Ga0070717_10000725
490 Ga0075428_100336027
491 Ga0075430_100005314
492 Ga0075430_100011952
493 Ga0075431_100022808
494 Ga0075431_100076269
495 Ga0075433_10154783
496 Ga0075433_10236073
497 Ga0075434_100120011
498 Ga0068865_100002473
499 Ga0068865_100055278
500 Ga0075436_100025103
501 Ga0075436_100182226
502 Ga0075435_100151004
503 Ga0105240_10044221
504 Ga0105240_10247401
505 Ga0105240_10542108
506 Ga0111539_10109195
507 Ga0114129_10170616
508 Ga0105243_10007707
509 Ga0105241_10034179
510 Ga0105242_10009169
511 Ga0105242_10022693
512 Ga0105248_10002442
513 Ga0105248_10024779
514 Ga0105248_10239938
515 Ga0105237_10004593
516 Ga0105237_10234444
517 Ga0105249_10001082
518 Ga0105249_10025770
519 Ga0105249_10040473
520 Ga0105249_10068228
521 Ga0105249_10104450
522 Ga0105249_10104998
523 Ga0105239_10018637
524 Ga0105246_10201568
525 Ga0157373_10021672
526 Ga0157373_10041772
527 Ga0157370_10197750
528 Ga0157369_10246249
529 Ga0157374_10023541
530 Ga0157378_10095889
531 Ga0157378_10403053
532 Ga0157372_10273820
533 Ga0157375_10023440
534 Ga0157375_10091027
535 Ga0157375_10213495
536 Ga0157375_10220948
537 Ga0163163_10019991
538 Ga0163163_10037492
539 Ga0157380_10003980
540 Ga0157380_10022966
541 Ga0157380_10162680
542 Ga0157377_10002944
543 Ga0157379_10034605
544 Ga0163161_10012295
545 Ga0213876_10017389
546 Ga0207697_10031822
547 Ga0207653_10003495
548 Ga0207682_10038920
549 Ga0207688_10045966
550 Ga0207699_10012924
551 Ga0207645_10000203
552 Ga0207645_10000536
553 Ga0207643_10003829
554 Ga0207643_10013158
555 Ga0207684_10001697
556 Ga0207684_10039845
557 Ga0207684_10087796
558 Ga0207707_10019840
559 Ga0207707_10087196
560 Ga0207663_10029990
561 Ga0207663_10075944
562 Ga0207660_10013129
563 Ga0207660_10014667
564 Ga0207660_10022401
565 Ga0207662_10043353
566 Ga0207657_10059929
567 Ga0207652_10033286
568 Ga0207652_10038544
569 Ga0207652_10065912
570 Ga0207646_10003599
571 Ga0207646_10039398
572 Ga0207646_10050859
573 Ga0207681_10009550
574 Ga0207694_10058669
575 Ga0207650_10065054
576 Ga0207659_10064460
577 Ga0207659_10076447
578 Ga0207700_10012782
579 Ga0207664_10021476
580 Ga0207706_10000038
581 Ga0207706_10001427
582 Ga0207706_10076718
583 Ga0207686_10000413
584 Ga0207669_10000761
585 Ga0207669_10115254
586 Ga0207669_10145904
587 Ga0207704_10041132
588 Ga0207665_10067902
589 Ga0207691_10003550
590 Ga0207691_10010675
591 Ga0207691_10030465
592 Ga0207691_10048224
593 Ga0207691_10067399
594 Ga0207711_10131628
595 Ga0207689_10005759
596 Ga0207661_10021844
597 Ga0207679_10053055
598 Ga0207679_10068123
599 Ga0207679_10162830
600 Ga0207679_10201278
601 Ga0207667_10038191
602 Ga0207667_10263012
603 Ga0207651_10045053
604 Ga0207668_10018920
605 Ga0207640_10000464
606 Ga0207677_10021772
607 Ga0207703_10086845
608 Ga0207639_10062931
609 Ga0207639_10175339
610 Ga0207678_10167528
611 Ga0207678_10258179
612 Ga0207708_10022285
613 Ga0207648_10000036
614 Ga0207676_10003713
615 Ga0207676_10039051
616 Ga0207676_10064589
617 Ga0207674_10000548
618 Ga0207674_10005980
619 Ga0207674_10010419
620 Ga0207674_10019667
621 Ga0207675_100001528
622 Ga0207675_100013065
623 Ga0207698_10105609
624 Ga0207698_10109782
625 Ga0207698_10262347
626 Ga0268266_10314569
627 Ga0268265_10001322
628 Ga0268265_10009314
629 Ga0268264_10001573
630 Ga0307405_10001343
631 Ga0307413_10050435
632 Ga0307413_10054258
633 Ga0307410_10001360
634 Ga0307410_10002471
635 Ga0307410_10010600
636 Ga0307410_10025865
637 Ga0307410_10035305
638 Ga0307410_10067844
639 Ga0307406_10013189
640 Ga0307406_10015001
641 Ga0307407_10003373
642 Ga0307407_10007216
643 Ga0307407_10015098
644 Ga0307412_10052782
645 Ga0307409_100000729
646 Ga0307409_100002112
647 Ga0307409_100072245
648 Ga0307409_100226115
649 Ga0307416_100003454
650 Ga0307416_100005481
651 Ga0307416_100008102
652 Ga0307416_100050900
653 Ga0307416_100057449
654 Ga0307416_100069148
655 Ga0307416_100132660
656 Ga0307416_100383548
657 Ga0307414_10006884
658 Ga0307414_10041873
659 Ga0307414_10168057
660 Ga0307411_10001103
661 Ga0307411_10015066
662 Ga0307411_10024310
663 Ga0307411_10121846
664 Ga0307415_100138696
665 Ga0307415_100250056
666 Ga0373934_0010663
667 Ga0373940_0005001
668 Ga0373923_0004796
669 Ga0373932_0025172
670 Ga0373941_0020350
671 Ga0373956_0004662
672 Ga0373955_0010387
673 Ga0373935_0154023
674 Ga0373927_0028770
675 Ga0373933_0001858
676 Ga0373933_0008761
677 Ga0373937_0022509
678 Ga0316584_0102009
679 Ga0373925_0075666
680 Ga0395905_0032738
681 Ga0436365_0623468
682 Ga0451577_0166727
683 Ga0451577_0246364
684 Ga0451577_0295861
685 Ga0451576_0168584
686 Ga0495603_0052418
687 Ga0495603_0152628
688 Ga0495629_0006543
689 Ga0495638_0011987
690 Ga0495651_0028734
691 Ga0495651_0030780
692 Ga0495653_0001337
693 Ga0495580_0056522
694 Ga0495580_0161400
695 Ga0495582_0004565
696 Ga0495639_0011127
697 Ga0495594_0008397
698 Ga0495594_0018773
699 Ga0495608_0054151
700 Ga0495628_0036038
701 Ga0495666_0011910
702 Ga0495652_0003334
703 Ga0495665_0068908
704 Ga0495586_0123926
705 Ga0495587_0003006
706 Ga0495587_0020354
707 Ga0495645_0000856
708 Ga0495645_0021455
709 Ga0495667_0047609
710 Ga0495634_0005468
711 Ga0495657_0004867
712 Ga0495657_0105070
713 Ga0495599_0002385
714 Ga0495599_0002474
715 Ga0495623_0007643
716 Ga0495623_0009141
717 Ga0495646_0002100
718 Ga0495658_0001636
719 Ga0495624_0113102
720 Ga0495600_0013210
721 Ga0495581_0033278
722 Ga0495674_0002051
723 Ga0495674_0007260
724 Ga0495672_0001828
725 Ga0495680_0004128
726 Ga0495680_0038221
727 Ga0495675_0005930
728 Ga0495675_0080847
729 Ga0495684_0003249
730 Ga0495684_0065938
731 Ga0495602_0011341
732 Ga0495602_0021768
733 Ga0495602_0037074
734 Ga0496101_0090136
735 Ga0496101_0162549
736 Ga0496102_0009571
737 Ga0496105_0089686
738 Ga0496106_0052876
739 Ga0496106_0095715
740 Ga0496108_0005443
741 Ga0496109_0007265
742 Ga0496109_0011984
743 Ga0496111_0007555
744 Ga0496112_0003713
745 Ga0496112_0056470
746 Ga0496112_0134940
747 Ga0496113_0005200
748 Ga0496113_0055522
749 Ga0496114_0006898
750 Ga0501067_0038554
751 Ga0501068_0039332
752 Ga0501069_0030911
753 Ga0501069_0096876
754 Ga0501081_0068510
755 nmdc:mga05p37_327601_c1
756 nmdc:mga0qj67_80746_c1
757 nmdc:mga0qj67_9588_c1
758 nmdc:mga06r32_1663_c1
759 nmdc:mga0n895_173143_c1
760 nmdc:mga0n895_216887_c1
761 nmdc:mga0n895_95113_c1
762 nmdc:mga0rr50_27129_c1
763 nmdc:mga08x19_12003_c1
764 nmdc:mga08x19_31362_c1
765 nmdc:mga0a205_51596_c1
766 nmdc:mga0a205_95770_c1
767 Ga0495601_0031193
768 Ga0495612_0002126

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00291

PALP

Pyridoxal-phosphate dependent enzyme

96

398

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
2c2b-assembly2.cif.gz_C crystallographic structure of arabidopsis thaliana threonine synthase complexed with pyridoxal phosphate and s-adenosylmethionine 0.9267 9 419
2zsj-assembly2.cif.gz_D crystal structure of threonine synthase from aquifex aeolicus vf5 0.9245 58 418
1uin-assembly1.cif.gz_B crystal structure of threonine synthase from thermus thermophilus hb8, trigonal crystal form 0.9213 58 418
2zsj-assembly2.cif.gz_C crystal structure of threonine synthase from aquifex aeolicus vf5 0.9204 58 418
3aey-assembly1.cif.gz_B apo form of threonine synthase from thermus thermophilus hb8 0.9204 59 418
ID Description Score Start End Superfamily
2d1fA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9232 113 204 3.40.50.1100
af_A0A1D6M0B0_306_515_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9216 220 417 3.40.50.1100
af_Q9SSP5_269_516_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.9189 183 418 3.40.50.1100
af_X1WC99_42_136_3.40.50.1100 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8836 116 206 3.40.50.1100
2jc3H02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.8823 107 206 3.40.50.1100
ID Description Score Start End GO Terms
AF-A0A842UJZ7-F1-model_v4 Threonine synthase (EC 4.2.3.1) 0.9727 43 416 GO:0003941
GO:0004794
GO:0004795
GO:0006565
GO:0006567
GO:0009088
GO:0009097
GO:0030170
AF-A0A392QMB6-F1-model_v4 Threonine synthase chloroplastic-like 0.9633 193 339
AF-A0A7X6JZB1-F1-model_v4 deleted 0.9603 104 228
AF-A0A2V9ZH50-F1-model_v4 Threonine synthase (EC 4.2.3.1) 0.9589 58 383 GO:0004795
GO:0009088
AF-A0A1H6AUM6-F1-model_v4 Threonine synthase (EC 4.2.3.1) 0.9573 11 417 GO:0003941
GO:0004794
GO:0004795
GO:0006565
GO:0006567
GO:0009088
GO:0009097

Map