F429800

General Info

Members Datasets Scaffolds Average Seq Length
384 183 768 132

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_101521272|Ga0070683_1015212721
Length 154
Sequence VSEELQVGLARFKLLKGHKMKLAAPLAALAVVSGFAVPSPVLAQDEQSSSGTTQTTGQRIAEIVVFGNDPCPRSTDDEVVVCSRVPESYRYPSGTYQQGQAWANKARSIERMGRTGIQSCSPVGPAGYTGCLNQMINEAKEESREAAQGSRPPQ

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
27 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
28 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
29 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
30 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
31 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
37 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
38 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
39 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
40 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
41 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
46 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
47 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
48 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
49 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
55 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
56 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
60 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
63 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
64 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
67 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
68 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
71 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
72 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
73 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
74 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
75 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
115 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
116 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
117 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
118 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
119 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
120 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
121 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
122 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
123 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
124 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
125 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
126 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
127 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
128 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
129 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
130 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
131 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
134 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
135 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
136 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
137 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
138 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
141 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
142 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
143 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
144 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
145 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
146 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
147 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
148 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
149 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
150 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
151 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
152 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
153 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
154 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
155 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
156 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
157 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
158 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
159 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
160 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
161 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
162 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
163 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
164 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
165 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
166 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
167 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
168 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
169 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
170 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
171 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
172 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
173 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
174 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
175 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
176 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
177 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
178 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
179 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
180 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
181 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
182 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
183 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.22
Metatranscriptomes 0.78
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.25
Rhizosphere 92.97
Stem 0
Stem Tuber 0
Unclassified 5.99

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_101521272 3300005329 Unclassified 643
2 JGI25406J46586_10136047 3300003203 Bacteria 719
3 rootH2_10183403 3300003320 Bacteria 1512
4 rootH1_10181963 3300003323 Bacteria 2026
5 Ga0065714_10288775 3300005288 Unclassified 711
6 Ga0065712_10100187 3300005290 Bacteria 2069
7 Ga0065715_10172608 3300005293 Bacteria 1535
8 Ga0070658_10036103 3300005327 Bacteria 3983
9 Ga0070658_11604266 3300005327 Bacteria 564
10 Ga0070676_10176179 3300005328 Bacteria 1387
11 Ga0070683_100566699 3300005329 Bacteria 1086
12 Ga0070670_100001439 3300005331 Bacteria 19145
13 Ga0070670_100035495 3300005331 Bacteria 4292
14 Ga0070670_100055939 3300005331 Bacteria 3386
15 Ga0070670_100183121 3300005331 Bacteria 1819
16 Ga0070670_101006707 3300005331 Bacteria 758
17 Ga0070677_10061803 3300005333 Bacteria 1547
18 Ga0068869_101380551 3300005334 Bacteria 623
19 Ga0070666_10247696 3300005335 Bacteria 1261
20 Ga0070680_100334366 3300005336 Bacteria 1287
21 Ga0070680_100494551 3300005336 Bacteria 1046
22 Ga0070660_100088887 3300005339 Bacteria 2433
23 Ga0070660_100286304 3300005339 Bacteria 1349
24 Ga0070689_100807340 3300005340 Bacteria 825
25 Ga0070687_100099640 3300005343 Bacteria 1624
26 Ga0070661_100016204 3300005344 Bacteria 5264
27 Ga0070661_100100433 3300005344 Bacteria 2151
28 Ga0070661_100690955 3300005344 Bacteria 831
29 Ga0070668_101019130 3300005347 Bacteria 745
30 Ga0070668_101144548 3300005347 Unclassified 703
31 Ga0070669_100417634 3300005353 Bacteria 1100
32 Ga0070675_100015226 3300005354 Bacteria 6074
33 Ga0070675_100214351 3300005354 Bacteria 1675
34 Ga0070671_100006901 3300005355 Bacteria 9094
35 Ga0070671_100037476 3300005355 Bacteria 4021
36 Ga0070674_100040927 3300005356 Bacteria 3137
37 Ga0070659_100030394 3300005366 Bacteria 4181
38 Ga0070659_100038756 3300005366 Bacteria 3718
39 Ga0070659_100104586 3300005366 Bacteria 2281
40 Ga0070667_100002452 3300005367 Bacteria 16200
41 Ga0070667_100004350 3300005367 Bacteria 11952
42 Ga0070714_100060591 3300005435 Bacteria 3248
43 Ga0070714_100095924 3300005435 Bacteria 2605
44 Ga0070713_100278435 3300005436 Bacteria 1534
45 Ga0070713_100584027 3300005436 Bacteria 1060
46 Ga0070711_101849402 3300005439 Bacteria 530
47 Ga0070663_100212890 3300005455 Bacteria 1514
48 Ga0070678_100801254 3300005456 Bacteria 855
49 Ga0070662_100310227 3300005457 Bacteria 1284
50 Ga0070681_10263894 3300005458 Bacteria 1634
51 Ga0070679_100104519 3300005530 Bacteria 2819
52 Ga0070679_100846543 3300005530 Bacteria 858
53 Ga0070679_101492602 3300005530 Bacteria 623
54 Ga0068853_100352714 3300005539 Bacteria 1369
55 Ga0068853_101178813 3300005539 Unclassified 739
56 Ga0070672_100002633 3300005543 Bacteria 11476
57 Ga0070672_100117490 3300005543 Bacteria 2174
58 Ga0070672_100510076 3300005543 Bacteria 1041
59 Ga0070693_100538532 3300005547 Bacteria 834
60 Ga0070693_100608239 3300005547 Bacteria 790
61 Ga0070665_100241675 3300005548 Bacteria 1806
62 Ga0068855_100194737 3300005563 Bacteria 2284
63 Ga0068855_100292925 3300005563 Bacteria 1804
64 Ga0068855_100531990 3300005563 Bacteria 1274
65 Ga0068855_102359290 3300005563 Bacteria 531
66 Ga0070664_100001064 3300005564 Bacteria 21598
67 Ga0070664_100021362 3300005564 Bacteria 5334
68 Ga0070664_100055095 3300005564 Bacteria 3374
69 Ga0070664_100070038 3300005564 Bacteria 3003
70 Ga0070664_100114535 3300005564 Bacteria 2356
71 Ga0070664_100535563 3300005564 Bacteria 1082
72 Ga0070664_100924707 3300005564 Bacteria 818
73 Ga0068857_100315202 3300005577 Bacteria 1444
74 Ga0068856_100029169 3300005614 Bacteria 5389
75 Ga0068856_100118659 3300005614 Bacteria 2646
76 Ga0068852_100041037 3300005616 Bacteria 3908
77 Ga0068852_100163395 3300005616 Bacteria 2081
78 Ga0068852_100344889 3300005616 Bacteria 1453
79 Ga0068859_100014660 3300005617 Bacteria 7877
80 Ga0068859_100018006 3300005617 Bacteria 7099
81 Ga0068859_100247873 3300005617 Bacteria 1871
82 Ga0068864_100006405 3300005618 Bacteria 9649
83 Ga0068864_100212499 3300005618 Bacteria 1782
84 Ga0068851_10121668 3300005834 Bacteria 1403
85 Ga0068863_100009191 3300005841 Bacteria 9642
86 Ga0068858_100009554 3300005842 Bacteria 9252
87 Ga0068858_100207206 3300005842 Bacteria 1855
88 Ga0068858_100421223 3300005842 Bacteria 1284
89 Ga0068860_101669079 3300005843 Unclassified 659
90 Ga0068862_100704316 3300005844 Bacteria 979
91 Ga0081539_10014265 3300005985 Bacteria 5896
92 Ga0081539_10057858 3300005985 Bacteria 2142
93 Ga0097621_100025055 3300006237 Bacteria 4665
94 Ga0068871_100019814 3300006358 Bacteria 5141
95 Ga0068871_100225189 3300006358 Bacteria 1626
96 Ga0097620_100014661 3300006931 Bacteria 7877
97 Ga0097620_100018006 3300006931 Bacteria 7099
98 Ga0097620_100247862 3300006931 Bacteria 1871
99 Ga0105251_10027578 3300009011 Bacteria 2877
100 Ga0105240_10118986 3300009093 Bacteria 3183
101 Ga0105241_10449175 3300009174 Unclassified 1140
102 Ga0105241_10705456 3300009174 Bacteria 921
103 Ga0105248_10003948 3300009177 Bacteria 16395
104 Ga0105248_10093970 3300009177 Bacteria 3377
105 Ga0105237_10412037 3300009545 Bacteria 1356
106 Ga0105237_11453613 3300009545 Unclassified 692
107 Ga0105238_10110100 3300009551 Bacteria 2735
108 Ga0105246_10828551 3300011119 Bacteria 823
109 Ga0157373_10010871 3300013100 Bacteria 6699
110 Ga0157373_10141559 3300013100 Bacteria 1692
111 Ga0157373_10700409 3300013100 Bacteria 742
112 Ga0157371_10043687 3300013102 Bacteria 3192
113 Ga0157371_10149187 3300013102 Bacteria 1667
114 Ga0157370_10088590 3300013104 Bacteria 2906
115 Ga0157370_10269993 3300013104 Bacteria 1571
116 Ga0157369_10101014 3300013105 Bacteria 3075
117 Ga0157369_10193280 3300013105 Bacteria 2137
118 Ga0157369_10329044 3300013105 Bacteria 1588
119 Ga0157369_11787002 3300013105 Unclassified 624
120 Ga0163162_10187667 3300013306 Bacteria 2195
121 Ga0157372_10186312 3300013307 Bacteria 2403
122 Ga0157372_10534995 3300013307 Bacteria 1366
123 Ga0157372_10714553 3300013307 Bacteria 1166
124 Ga0157372_12670985 3300013307 Unclassified 573
125 Ga0157375_11891891 3300013308 Unclassified 708
126 Ga0163163_10068861 3300014325 Bacteria 3522
127 Ga0163163_10201050 3300014325 Bacteria 2041
128 Ga0182008_10053867 3300014497 Bacteria 1991
129 Ga0157379_10033530 3300014968 Bacteria 4578
130 Ga0157379_10244020 3300014968 Bacteria 1629
131 Ga0163161_10095655 3300017792 Bacteria 2203
132 Ga0197907_10923631 3300020069 Bacteria 1414
133 Ga0206354_10676864 3300020081 Bacteria 1889
134 Ga0206353_10786692 3300020082 Bacteria 1128
135 Ga0207656_10117442 3300025321 Bacteria 1235
136 Ga0207680_10098268 3300025903 Bacteria 1876
137 Ga0207705_10002578 3300025909 Bacteria 13924
138 Ga0207705_10207854 3300025909 Bacteria 1484
139 Ga0207705_10594232 3300025909 Bacteria 861
140 Ga0207705_11006128 3300025909 Bacteria 644
141 Ga0207654_10557571 3300025911 Bacteria 814
142 Ga0207707_10213308 3300025912 Bacteria 1681
143 Ga0207695_10098153 3300025913 Bacteria 2929
144 Ga0207671_10386905 3300025914 Bacteria 1112
145 Ga0207660_10542118 3300025917 Bacteria 946
146 Ga0207657_10019175 3300025919 Bacteria 6504
147 Ga0207657_10063025 3300025919 Bacteria 3172
148 Ga0207657_10211899 3300025919 Bacteria 1555
149 Ga0207649_10010751 3300025920 Bacteria 5032
150 Ga0207649_10027989 3300025920 Bacteria 3314
151 Ga0207649_10057610 3300025920 Bacteria 2430
152 Ga0207649_10901053 3300025920 Bacteria 693
153 Ga0207649_10959139 3300025920 Unclassified 672
154 Ga0207649_11212565 3300025920 Unclassified 596
155 Ga0207652_10177424 3300025921 Bacteria 1913
156 Ga0207652_11190348 3300025921 Bacteria 664
157 Ga0207681_10047529 3300025923 Bacteria 2892
158 Ga0207681_10769696 3300025923 Bacteria 803
159 Ga0207694_10156331 3300025924 Bacteria 1839
160 Ga0207650_10001178 3300025925 Bacteria 19210
161 Ga0207650_10068133 3300025925 Bacteria 2672
162 Ga0207650_10068856 3300025925 Bacteria 2658
163 Ga0207650_10743542 3300025925 Bacteria 830
164 Ga0207650_10991910 3300025925 Bacteria 714
165 Ga0207650_11179800 3300025925 Unclassified 652
166 Ga0207659_10010689 3300025926 Bacteria 5772
167 Ga0207659_10183302 3300025926 Bacteria 1660
168 Ga0207700_10239753 3300025928 Bacteria 1545
169 Ga0207664_10252876 3300025929 Bacteria 1538
170 Ga0207644_10072679 3300025931 Bacteria 2519
171 Ga0207644_10087504 3300025931 Bacteria 2315
172 Ga0207690_10037469 3300025932 Bacteria 3148
173 Ga0207690_10064796 3300025932 Bacteria 2496
174 Ga0207690_10070126 3300025932 Bacteria 2413
175 Ga0207690_10086556 3300025932 Bacteria 2202
176 Ga0207690_10227630 3300025932 Bacteria 1430
177 Ga0207690_10485653 3300025932 Bacteria 997
178 Ga0207706_10102422 3300025933 Bacteria 2519
179 Ga0207706_10260631 3300025933 Bacteria 1513
180 Ga0207706_10627487 3300025933 Bacteria 922
181 Ga0207691_10002368 3300025940 Bacteria 18465
182 Ga0207691_10033577 3300025940 Bacteria 4777
183 Ga0207691_10576507 3300025940 Bacteria 953
184 Ga0207711_10003726 3300025941 Bacteria 13140
185 Ga0207711_10152381 3300025941 Bacteria 2087
186 Ga0207711_11062510 3300025941 Bacteria 750
187 Ga0207689_10296819 3300025942 Bacteria 1339
188 Ga0207661_10259345 3300025944 Bacteria 1548
189 Ga0207661_11427619 3300025944 Bacteria 635
190 Ga0207679_10024697 3300025945 Bacteria 4123
191 Ga0207679_10027093 3300025945 Bacteria 3960
192 Ga0207679_10057545 3300025945 Bacteria 2876
193 Ga0207679_10109027 3300025945 Bacteria 2181
194 Ga0207679_10381658 3300025945 Bacteria 1235
195 Ga0207679_10386352 3300025945 Bacteria 1228
196 Ga0207679_10765770 3300025945 Unclassified 879
197 Ga0207667_10033651 3300025949 Bacteria 5509
198 Ga0207667_10242793 3300025949 Bacteria 1843
199 Ga0207667_10275273 3300025949 Bacteria 1721
200 Ga0207651_10012912 3300025960 Bacteria 4752
201 Ga0207658_10471202 3300025986 Bacteria 1114
202 Ga0207658_11561527 3300025986 Unclassified 603
203 Ga0207658_12126094 3300025986 Bacteria 510
204 Ga0207677_10049910 3300026023 Bacteria 2827
205 Ga0207703_10053951 3300026035 Bacteria 3268
206 Ga0207703_10105581 3300026035 Bacteria 2394
207 Ga0207703_10324976 3300026035 Bacteria 1410
208 Ga0207639_10077185 3300026041 Bacteria 2625
209 Ga0207678_10004258 3300026067 Bacteria 12830
210 Ga0207702_10003777 3300026078 Bacteria 13675
211 Ga0207702_10080760 3300026078 Bacteria 2822
212 Ga0207641_10007958 3300026088 Bacteria 8783
213 Ga0207676_10025219 3300026095 Bacteria 4411
214 Ga0207676_10466528 3300026095 Bacteria 1193
215 Ga0207676_10923451 3300026095 Bacteria 857
216 Ga0207674_10009197 3300026116 Bacteria 11325
217 Ga0207683_10386553 3300026121 Bacteria 1287
218 Ga0207698_10004864 3300026142 Bacteria 8233
219 Ga0207698_10047359 3300026142 Bacteria 3256
220 Ga0207698_10091004 3300026142 Bacteria 2496
221 Ga0207698_10105949 3300026142 Bacteria 2344
222 Ga0268266_10041886 3300028379 Bacteria 3910
223 Ga0307408_100054329 3300031548 Bacteria 2896
224 Ga0307408_100119206 3300031548 Bacteria 2041
225 Ga0307408_100780796 3300031548 Bacteria 865
226 Ga0307405_10099473 3300031731 Bacteria 1946
227 Ga0307405_10288386 3300031731 Bacteria 1239
228 Ga0307405_10584731 3300031731 Bacteria 909
229 Ga0307413_10011876 3300031824 Bacteria 4305
230 Ga0307413_10280805 3300031824 Bacteria 1252
231 Ga0307413_10716509 3300031824 Bacteria 833
232 Ga0307410_10053278 3300031852 Bacteria 2737
233 Ga0307410_10066681 3300031852 Bacteria 2480
234 Ga0307410_10074620 3300031852 Bacteria 2363
235 Ga0307410_10428406 3300031852 Bacteria 1074
236 Ga0307406_10013772 3300031901 Bacteria 4640
237 Ga0307406_10121263 3300031901 Bacteria 1818
238 Ga0307406_10257312 3300031901 Bacteria 1319
239 Ga0307406_10270767 3300031901 Bacteria 1290
240 Ga0307407_10049990 3300031903 Bacteria 2389
241 Ga0307407_10060691 3300031903 Bacteria 2207
242 Ga0307407_10979469 3300031903 Bacteria 653
243 Ga0307412_11855922 3300031911 Unclassified 555
244 Ga0307409_100026779 3300031995 Bacteria 4073
245 Ga0307409_100089093 3300031995 Bacteria 2521
246 Ga0307409_100121277 3300031995 Bacteria 2214
247 Ga0307409_100304502 3300031995 Bacteria 1484
248 Ga0307409_101746758 3300031995 Bacteria 651
249 Ga0307409_102811059 3300031995 Bacteria 514
250 Ga0307416_100002466 3300032002 Bacteria 10639
251 Ga0307416_100052872 3300032002 Bacteria 3255
252 Ga0307414_10119192 3300032004 Bacteria 2025
253 Ga0307414_10187434 3300032004 Bacteria 1670
254 Ga0307411_10014240 3300032005 Bacteria 4418
255 Ga0307411_10096494 3300032005 Bacteria 2078
256 Ga0307411_10460270 3300032005 Bacteria 1066
257 Ga0307411_10480313 3300032005 Bacteria 1046
258 Ga0307411_10906425 3300032005 Bacteria 783
259 Ga0307415_100013513 3300032126 Bacteria 4768
260 Ga0307415_100242606 3300032126 Bacteria 1458
261 Ga0307415_100448105 3300032126 Bacteria 1115
262 Ga0373928_0262362 3300035084 Unclassified 518
263 Ga0373923_0192564 3300035111 Bacteria 940
264 Ga0373956_0060794 3300035119 Bacteria 1711
265 Ga0373957_0051032 3300035120 Unclassified 1582
266 Ga0373960_0053294 3300035121 Bacteria 1207
267 Ga0373955_0001400 3300035172 Bacteria 10266
268 Ga0373937_0003288 3300036401 Bacteria 13564
269 Ga0395899_0000113 3300037312 Bacteria 136163
270 Ga0395899_0005323 3300037312 Bacteria 9993
271 Ga0395899_0025543 3300037312 Bacteria 4459
272 Ga0395899_0117814 3300037312 Bacteria 1904
273 Ga0395899_0161514 3300037312 Bacteria 1582
274 Ga0395899_0340297 3300037312 Bacteria 1006
275 Ga0395899_0404027 3300037312 Bacteria 903
276 Ga0395900_0000365 3300037418 Bacteria 65054
277 Ga0395900_0014673 3300037418 Bacteria 7992
278 Ga0395900_0063096 3300037418 Bacteria 3809
279 Ga0395900_0087130 3300037418 Bacteria 3209
280 Ga0395900_0239113 3300037418 Bacteria 1822
281 Ga0395900_0281005 3300037418 Bacteria 1656
282 Ga0395900_0367225 3300037418 Bacteria 1409
283 Ga0395900_0523176 3300037418 Bacteria 1134
284 Ga0395900_0587148 3300037418 Bacteria 1055
285 Ga0395898_0000306 3300037466 Bacteria 115940
286 Ga0395898_0079594 3300037466 Bacteria 3161
287 Ga0395898_0164530 3300037466 Bacteria 2122
288 Ga0395898_0197102 3300037466 Bacteria 1923
289 Ga0395898_0268029 3300037466 Bacteria 1628
290 Ga0395898_1816724 3300037466 Bacteria 530
291 Ga0395905_0000005 3300037471 Bacteria 557808
292 Ga0395905_0020726 3300037471 Bacteria 6223
293 Ga0395905_0047990 3300037471 Bacteria 4001
294 Ga0395905_0060410 3300037471 Bacteria 3544
295 Ga0395905_0098993 3300037471 Bacteria 2738
296 Ga0395905_0133642 3300037471 Bacteria 2333
297 Ga0395905_0139924 3300037471 Bacteria 2277
298 Ga0395905_0193157 3300037471 Bacteria 1909
299 Ga0395905_0299411 3300037471 Bacteria 1495
300 Ga0395905_0326894 3300037471 Bacteria 1423
301 Ga0395905_1060562 3300037471 Bacteria 713
302 Ga0395905_1185643 3300037471 Bacteria 667
303 Ga0395905_1350838 3300037471 Bacteria 617
304 Ga0395901_0000589 3300038443 Bacteria 42319
305 Ga0395901_0000647 3300038443 Bacteria 40233
306 Ga0395901_0025684 3300038443 Bacteria 6047
307 Ga0395901_0058928 3300038443 Bacteria 3994
308 Ga0395901_0144971 3300038443 Bacteria 2496
309 Ga0395901_0196356 3300038443 Bacteria 2116
310 Ga0395901_0256104 3300038443 Bacteria 1822
311 Ga0395901_0352545 3300038443 Bacteria 1518
312 Ga0395901_0421555 3300038443 Bacteria 1368
313 Ga0436365_1253103 3300039437 Unclassified 548
314 Ga0439449_0213037 3300042007 Bacteria 724
315 Ga0466972_0025827 3300044658 Bacteria 2910
316 Ga0466965_0804039 3300044683 Unclassified 544
317 Ga0466966_0615206 3300044684 Unclassified 654
318 Ga0466963_0184870 3300044694 Bacteria 1455
319 Ga0466963_0325029 3300044694 Bacteria 1082
320 Ga0466964_0094104 3300044706 Unclassified 1309
321 Ga0466971_0550597 3300044719 Bacteria 572
322 Ga0466957_0034450 3300044842 Bacteria 3037
323 Ga0466957_0472100 3300044842 Bacteria 867
324 Ga0466957_0678547 3300044842 Bacteria 726
325 Ga0466957_1231254 3300044842 Bacteria 542
326 Ga0466960_0093384 3300044901 Bacteria 1537
327 Ga0466958_0354184 3300045836 Bacteria 945
328 Ga0466967_0003854 3300045976 Bacteria 9933
329 Ga0466967_0018168 3300045976 Bacteria 5611
330 Ga0466967_0019919 3300045976 Bacteria 5409
331 Ga0466967_0032728 3300045976 Bacteria 4394
332 Ga0466967_0036819 3300045976 Bacteria 4181
333 Ga0466967_0119219 3300045976 Bacteria 2435
334 Ga0466967_0216434 3300045976 Bacteria 1818
335 Ga0466967_1062688 3300045976 Bacteria 806
336 Ga0466967_1260718 3300045976 Unclassified 736
337 Ga0466967_1513995 3300045976 Bacteria 668
338 Ga0495585_0243213 3300046492 Bacteria 900
339 Ga0495631_0502739 3300046518 Bacteria 516
340 Ga0495663_0002264 3300046525 Bacteria 5848
341 Ga0495663_0199179 3300046525 Bacteria 698
342 Ga0495598_0000207 3300046537 Bacteria 10287
343 Ga0495621_0000081 3300046539 Bacteria 19404
344 Ga0495633_0195544 3300046558 Bacteria 929
345 Ga0495623_0176441 3300046679 Bacteria 1244
346 Ga0495669_0017841 3300046684 Bacteria 3047
347 Ga0495669_0041474 3300046684 Bacteria 2044
348 Ga0495670_0007256 3300046691 Bacteria 5449
349 Ga0495670_0130227 3300046691 Bacteria 1311
350 Ga0495677_0008769 3300047445 Bacteria 3752
351 Ga0496100_0252061 3300048903 Bacteria 1306
352 Ga0496101_0189760 3300048904 Bacteria 1585
353 Ga0496101_0283704 3300048904 Bacteria 1295
354 Ga0496102_0043391 3300048905 Bacteria 4078
355 Ga0496103_0061852 3300048906 Bacteria 2329
356 Ga0496104_0071008 3300048907 Bacteria 3311
357 Ga0496105_0465570 3300048908 Bacteria 996
358 Ga0496106_0187271 3300048909 Bacteria 1644
359 Ga0496106_0462692 3300048909 Bacteria 1019
360 Ga0496107_0010084 3300048910 Bacteria 6553
361 Ga0496108_0000946 3300048911 Bacteria 22575
362 Ga0496109_0017156 3300048912 Bacteria 6339
363 Ga0496109_0046997 3300048912 Bacteria 3922
364 Ga0496109_0121382 3300048912 Bacteria 2435
365 Ga0496110_0357519 3300048913 Bacteria 1331
366 Ga0496111_0032467 3300048914 Bacteria 3723
367 Ga0496111_0046972 3300048914 Bacteria 3109
368 Ga0496111_0101438 3300048914 Bacteria 2114
369 Ga0496112_0051857 3300048915 Bacteria 4024
370 Ga0496112_0478168 3300048915 Bacteria 1182
371 Ga0496113_0002421 3300048916 Bacteria 10845
372 Ga0496113_0354830 3300048916 Bacteria 1176
373 Ga0496113_0422968 3300048916 Bacteria 1070
374 Ga0496114_0600414 3300048917 Bacteria 971
375 Ga0501290_002714 3300049513 Bacteria 2270
376 Ga0501068_0190006 3300049584 Bacteria 1300
377 Ga0501198_099490 3300049649 Bacteria 588
378 Ga0501249_120890 3300049679 Bacteria 639
379 Ga0501257_000041 3300049686 Bacteria 36608
380 Ga0501257_046424 3300049686 Bacteria 1076
381 Ga0501262_047617 3300049759 Bacteria 656
382 Ga0495612_0563586 3300053078 Bacteria 525
383 Ga0590071_024513 3300059421 Bacteria 1430
384 Ga0466962_0235354 3300061719 Bacteria 898
385 Ga0070683_101521272
386 JGI25406J46586_10136047
387 rootH2_10183403
388 rootH1_10181963
389 Ga0065714_10288775
390 Ga0065712_10100187
391 Ga0065715_10172608
392 Ga0070658_10036103
393 Ga0070658_11604266
394 Ga0070676_10176179
395 Ga0070683_100566699
396 Ga0070670_100001439
397 Ga0070670_100035495
398 Ga0070670_100055939
399 Ga0070670_100183121
400 Ga0070670_101006707
401 Ga0070677_10061803
402 Ga0068869_101380551
403 Ga0070666_10247696
404 Ga0070680_100334366
405 Ga0070680_100494551
406 Ga0070660_100088887
407 Ga0070660_100286304
408 Ga0070689_100807340
409 Ga0070687_100099640
410 Ga0070661_100016204
411 Ga0070661_100100433
412 Ga0070661_100690955
413 Ga0070668_101019130
414 Ga0070668_101144548
415 Ga0070669_100417634
416 Ga0070675_100015226
417 Ga0070675_100214351
418 Ga0070671_100006901
419 Ga0070671_100037476
420 Ga0070674_100040927
421 Ga0070659_100030394
422 Ga0070659_100038756
423 Ga0070659_100104586
424 Ga0070667_100002452
425 Ga0070667_100004350
426 Ga0070714_100060591
427 Ga0070714_100095924
428 Ga0070713_100278435
429 Ga0070713_100584027
430 Ga0070711_101849402
431 Ga0070663_100212890
432 Ga0070678_100801254
433 Ga0070662_100310227
434 Ga0070681_10263894
435 Ga0070679_100104519
436 Ga0070679_100846543
437 Ga0070679_101492602
438 Ga0068853_100352714
439 Ga0068853_101178813
440 Ga0070672_100002633
441 Ga0070672_100117490
442 Ga0070672_100510076
443 Ga0070693_100538532
444 Ga0070693_100608239
445 Ga0070665_100241675
446 Ga0068855_100194737
447 Ga0068855_100292925
448 Ga0068855_100531990
449 Ga0068855_102359290
450 Ga0070664_100001064
451 Ga0070664_100021362
452 Ga0070664_100055095
453 Ga0070664_100070038
454 Ga0070664_100114535
455 Ga0070664_100535563
456 Ga0070664_100924707
457 Ga0068857_100315202
458 Ga0068856_100029169
459 Ga0068856_100118659
460 Ga0068852_100041037
461 Ga0068852_100163395
462 Ga0068852_100344889
463 Ga0068859_100014660
464 Ga0068859_100018006
465 Ga0068859_100247873
466 Ga0068864_100006405
467 Ga0068864_100212499
468 Ga0068851_10121668
469 Ga0068863_100009191
470 Ga0068858_100009554
471 Ga0068858_100207206
472 Ga0068858_100421223
473 Ga0068860_101669079
474 Ga0068862_100704316
475 Ga0081539_10014265
476 Ga0081539_10057858
477 Ga0097621_100025055
478 Ga0068871_100019814
479 Ga0068871_100225189
480 Ga0097620_100014661
481 Ga0097620_100018006
482 Ga0097620_100247862
483 Ga0105251_10027578
484 Ga0105240_10118986
485 Ga0105241_10449175
486 Ga0105241_10705456
487 Ga0105248_10003948
488 Ga0105248_10093970
489 Ga0105237_10412037
490 Ga0105237_11453613
491 Ga0105238_10110100
492 Ga0105246_10828551
493 Ga0157373_10010871
494 Ga0157373_10141559
495 Ga0157373_10700409
496 Ga0157371_10043687
497 Ga0157371_10149187
498 Ga0157370_10088590
499 Ga0157370_10269993
500 Ga0157369_10101014
501 Ga0157369_10193280
502 Ga0157369_10329044
503 Ga0157369_11787002
504 Ga0163162_10187667
505 Ga0157372_10186312
506 Ga0157372_10534995
507 Ga0157372_10714553
508 Ga0157372_12670985
509 Ga0157375_11891891
510 Ga0163163_10068861
511 Ga0163163_10201050
512 Ga0182008_10053867
513 Ga0157379_10033530
514 Ga0157379_10244020
515 Ga0163161_10095655
516 Ga0197907_10923631
517 Ga0206354_10676864
518 Ga0206353_10786692
519 Ga0207656_10117442
520 Ga0207680_10098268
521 Ga0207705_10002578
522 Ga0207705_10207854
523 Ga0207705_10594232
524 Ga0207705_11006128
525 Ga0207654_10557571
526 Ga0207707_10213308
527 Ga0207695_10098153
528 Ga0207671_10386905
529 Ga0207660_10542118
530 Ga0207657_10019175
531 Ga0207657_10063025
532 Ga0207657_10211899
533 Ga0207649_10010751
534 Ga0207649_10027989
535 Ga0207649_10057610
536 Ga0207649_10901053
537 Ga0207649_10959139
538 Ga0207649_11212565
539 Ga0207652_10177424
540 Ga0207652_11190348
541 Ga0207681_10047529
542 Ga0207681_10769696
543 Ga0207694_10156331
544 Ga0207650_10001178
545 Ga0207650_10068133
546 Ga0207650_10068856
547 Ga0207650_10743542
548 Ga0207650_10991910
549 Ga0207650_11179800
550 Ga0207659_10010689
551 Ga0207659_10183302
552 Ga0207700_10239753
553 Ga0207664_10252876
554 Ga0207644_10072679
555 Ga0207644_10087504
556 Ga0207690_10037469
557 Ga0207690_10064796
558 Ga0207690_10070126
559 Ga0207690_10086556
560 Ga0207690_10227630
561 Ga0207690_10485653
562 Ga0207706_10102422
563 Ga0207706_10260631
564 Ga0207706_10627487
565 Ga0207691_10002368
566 Ga0207691_10033577
567 Ga0207691_10576507
568 Ga0207711_10003726
569 Ga0207711_10152381
570 Ga0207711_11062510
571 Ga0207689_10296819
572 Ga0207661_10259345
573 Ga0207661_11427619
574 Ga0207679_10024697
575 Ga0207679_10027093
576 Ga0207679_10057545
577 Ga0207679_10109027
578 Ga0207679_10381658
579 Ga0207679_10386352
580 Ga0207679_10765770
581 Ga0207667_10033651
582 Ga0207667_10242793
583 Ga0207667_10275273
584 Ga0207651_10012912
585 Ga0207658_10471202
586 Ga0207658_11561527
587 Ga0207658_12126094
588 Ga0207677_10049910
589 Ga0207703_10053951
590 Ga0207703_10105581
591 Ga0207703_10324976
592 Ga0207639_10077185
593 Ga0207678_10004258
594 Ga0207702_10003777
595 Ga0207702_10080760
596 Ga0207641_10007958
597 Ga0207676_10025219
598 Ga0207676_10466528
599 Ga0207676_10923451
600 Ga0207674_10009197
601 Ga0207683_10386553
602 Ga0207698_10004864
603 Ga0207698_10047359
604 Ga0207698_10091004
605 Ga0207698_10105949
606 Ga0268266_10041886
607 Ga0307408_100054329
608 Ga0307408_100119206
609 Ga0307408_100780796
610 Ga0307405_10099473
611 Ga0307405_10288386
612 Ga0307405_10584731
613 Ga0307413_10011876
614 Ga0307413_10280805
615 Ga0307413_10716509
616 Ga0307410_10053278
617 Ga0307410_10066681
618 Ga0307410_10074620
619 Ga0307410_10428406
620 Ga0307406_10013772
621 Ga0307406_10121263
622 Ga0307406_10257312
623 Ga0307406_10270767
624 Ga0307407_10049990
625 Ga0307407_10060691
626 Ga0307407_10979469
627 Ga0307412_11855922
628 Ga0307409_100026779
629 Ga0307409_100089093
630 Ga0307409_100121277
631 Ga0307409_100304502
632 Ga0307409_101746758
633 Ga0307409_102811059
634 Ga0307416_100002466
635 Ga0307416_100052872
636 Ga0307414_10119192
637 Ga0307414_10187434
638 Ga0307411_10014240
639 Ga0307411_10096494
640 Ga0307411_10460270
641 Ga0307411_10480313
642 Ga0307411_10906425
643 Ga0307415_100013513
644 Ga0307415_100242606
645 Ga0307415_100448105
646 Ga0373928_0262362
647 Ga0373923_0192564
648 Ga0373956_0060794
649 Ga0373957_0051032
650 Ga0373960_0053294
651 Ga0373955_0001400
652 Ga0373937_0003288
653 Ga0395899_0000113
654 Ga0395899_0005323
655 Ga0395899_0025543
656 Ga0395899_0117814
657 Ga0395899_0161514
658 Ga0395899_0340297
659 Ga0395899_0404027
660 Ga0395900_0000365
661 Ga0395900_0014673
662 Ga0395900_0063096
663 Ga0395900_0087130
664 Ga0395900_0239113
665 Ga0395900_0281005
666 Ga0395900_0367225
667 Ga0395900_0523176
668 Ga0395900_0587148
669 Ga0395898_0000306
670 Ga0395898_0079594
671 Ga0395898_0164530
672 Ga0395898_0197102
673 Ga0395898_0268029
674 Ga0395898_1816724
675 Ga0395905_0000005
676 Ga0395905_0020726
677 Ga0395905_0047990
678 Ga0395905_0060410
679 Ga0395905_0098993
680 Ga0395905_0133642
681 Ga0395905_0139924
682 Ga0395905_0193157
683 Ga0395905_0299411
684 Ga0395905_0326894
685 Ga0395905_1060562
686 Ga0395905_1185643
687 Ga0395905_1350838
688 Ga0395901_0000589
689 Ga0395901_0000647
690 Ga0395901_0025684
691 Ga0395901_0058928
692 Ga0395901_0144971
693 Ga0395901_0196356
694 Ga0395901_0256104
695 Ga0395901_0352545
696 Ga0395901_0421555
697 Ga0436365_1253103
698 Ga0439449_0213037
699 Ga0466972_0025827
700 Ga0466965_0804039
701 Ga0466966_0615206
702 Ga0466963_0184870
703 Ga0466963_0325029
704 Ga0466964_0094104
705 Ga0466971_0550597
706 Ga0466957_0034450
707 Ga0466957_0472100
708 Ga0466957_0678547
709 Ga0466957_1231254
710 Ga0466960_0093384
711 Ga0466958_0354184
712 Ga0466967_0003854
713 Ga0466967_0018168
714 Ga0466967_0019919
715 Ga0466967_0032728
716 Ga0466967_0036819
717 Ga0466967_0119219
718 Ga0466967_0216434
719 Ga0466967_1062688
720 Ga0466967_1260718
721 Ga0466967_1513995
722 Ga0495585_0243213
723 Ga0495631_0502739
724 Ga0495663_0002264
725 Ga0495663_0199179
726 Ga0495598_0000207
727 Ga0495621_0000081
728 Ga0495633_0195544
729 Ga0495623_0176441
730 Ga0495669_0017841
731 Ga0495669_0041474
732 Ga0495670_0007256
733 Ga0495670_0130227
734 Ga0495677_0008769
735 Ga0496100_0252061
736 Ga0496101_0189760
737 Ga0496101_0283704
738 Ga0496102_0043391
739 Ga0496103_0061852
740 Ga0496104_0071008
741 Ga0496105_0465570
742 Ga0496106_0187271
743 Ga0496106_0462692
744 Ga0496107_0010084
745 Ga0496108_0000946
746 Ga0496109_0017156
747 Ga0496109_0046997
748 Ga0496109_0121382
749 Ga0496110_0357519
750 Ga0496111_0032467
751 Ga0496111_0046972
752 Ga0496111_0101438
753 Ga0496112_0051857
754 Ga0496112_0478168
755 Ga0496113_0002421
756 Ga0496113_0354830
757 Ga0496113_0422968
758 Ga0496114_0600414
759 Ga0501290_002714
760 Ga0501068_0190006
761 Ga0501198_099490
762 Ga0501249_120890
763 Ga0501257_000041
764 Ga0501257_046424
765 Ga0501262_047617
766 Ga0495612_0563586
767 Ga0590071_024513
768 Ga0466962_0235354

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map