F429594

General Info

Members Datasets Scaffolds Average Seq Length
383 226 766 460

Family's Representative Sequence

Representative Sequence 3300013105|Ga0157369_10211348|Ga0157369_102113481
Length 485
Sequence VIAPVTLEDRETCPTTAIAQAAGARRVIPIQPTTEEVALYEIRKTIHPRAVHGWFAGWRWTLVFLTQAVFYGIPWLTWNGRQAVLFDLGARKFYLFGGVFWPQDVIYLSVLLIISALSLFLFTAIAGRLWCGYACPQTVYTEIFMWIERKIEGDRLARVRLDAAPLTLDKFVIKALKHTAWFAVSLWTAYTFVGYFTPIRDLGVSAITWQLGPWESFWILFYGIATYGNAGWLREQVCKYMCPYARFQSVMFDKDTLVITYDRARGEPRGGRSKAVDPRAQGLGDCVDCNICVQVCPTGIDIRKGLQYQVMDKMGYPKGLIRYTTEHALEQGLTPRAMWKRVFRLRTLLYGAGLLLITGVAAGSLAMRNPLKVDIIRDRGALARETIPGQIENVYRLQVMNTEERPRSYMISVAGVPGLALVGVEQPIELKAESTKLFAVRLQAPLEPAGAAAPAAGPHKIELTVKAVDDDKVVRHEQSTFIIPR

Samples

Sample ID Description Type Environment
1 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
2 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
12 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
13 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
14 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
15 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
16 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
17 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
20 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
21 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
22 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
23 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
24 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
25 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
28 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
29 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
30 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
31 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
32 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
33 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
34 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
35 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
36 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
37 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
38 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
39 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
40 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
41 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
42 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
43 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
56 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
57 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
58 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
59 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
60 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
62 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
68 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
69 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
72 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
73 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
74 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
75 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
76 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
77 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
78 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
79 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
80 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
81 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
82 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
126 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
127 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
129 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
130 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
131 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
137 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
138 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
139 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
140 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
141 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
142 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
143 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
144 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
145 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
146 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
147 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
148 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
149 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
150 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
151 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
152 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
153 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
154 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
155 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
156 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
157 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
158 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
159 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
160 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
161 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
162 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
163 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
164 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
165 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
166 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
167 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
168 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
169 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
170 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
171 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
172 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
173 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
174 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
175 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
180 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
181 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
182 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
183 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
184 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
189 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
205 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
206 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
207 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
208 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
219 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
220 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
225 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
226 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.13
Rhizosphere 94.52
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157369_10211348 3300013105 Bacteria 2033
2 Ga0070676_10006852 3300005328 Bacteria 6102
3 Ga0070683_100008815 3300005329 Bacteria 8579
4 Ga0070683_100037217 3300005329 Bacteria 4454
5 Ga0070683_100146620 3300005329 Bacteria 2237
6 Ga0070690_100002553 3300005330 Bacteria 9795
7 Ga0070690_100006640 3300005330 Bacteria 6572
8 Ga0070670_100002673 3300005331 Bacteria 14724
9 Ga0068869_100006374 3300005334 Bacteria 7478
10 Ga0070680_100079431 3300005336 Bacteria 2704
11 Ga0068868_100086692 3300005338 Bacteria 2517
12 Ga0068868_100093739 3300005338 Bacteria 2421
13 Ga0068868_100100627 3300005338 Bacteria 2339
14 Ga0070660_100000581 3300005339 Bacteria 24544
15 Ga0070660_100015171 3300005339 Bacteria 5558
16 Ga0070689_100015381 3300005340 Bacteria 5578
17 Ga0070689_100030282 3300005340 Bacteria 4107
18 Ga0070691_10038399 3300005341 Bacteria 2261
19 Ga0070661_100005284 3300005344 Bacteria 8898
20 Ga0070661_100005599 3300005344 Bacteria 8654
21 Ga0070692_10011876 3300005345 Bacteria 4015
22 Ga0070692_10094914 3300005345 Bacteria 1627
23 Ga0070668_100023220 3300005347 Bacteria 4691
24 Ga0070668_100041154 3300005347 Bacteria 3540
25 Ga0070668_100050688 3300005347 Bacteria 3197
26 Ga0070669_100010896 3300005353 Bacteria 6455
27 Ga0070669_100023650 3300005353 Bacteria 4401
28 Ga0070669_100117206 3300005353 Bacteria 2027
29 Ga0070675_100012028 3300005354 Bacteria 6784
30 Ga0070671_100002453 3300005355 Bacteria 14337
31 Ga0070671_100120560 3300005355 Bacteria 2207
32 Ga0070671_100151822 3300005355 Bacteria 1956
33 Ga0070673_100006904 3300005364 Bacteria 7425
34 Ga0070673_100013295 3300005364 Bacteria 5687
35 Ga0070688_100025033 3300005365 Bacteria 3529
36 Ga0070659_100001886 3300005366 Bacteria 15004
37 Ga0070659_100023388 3300005366 Bacteria 4728
38 Ga0070659_100031957 3300005366 Bacteria 4080
39 Ga0070667_100008529 3300005367 Bacteria 8497
40 Ga0070667_100039738 3300005367 Bacteria 3944
41 Ga0070667_100110372 3300005367 Bacteria 2384
42 Ga0070714_100020564 3300005435 Bacteria 5393
43 Ga0070705_100029910 3300005440 Bacteria 3002
44 Ga0070700_100002031 3300005441 Bacteria 10282
45 Ga0070700_100007776 3300005441 Bacteria 5809
46 Ga0070694_100121184 3300005444 Bacteria 1877
47 Ga0070708_100014748 3300005445 Bacteria 6438
48 Ga0070678_100003000 3300005456 Bacteria 9356
49 Ga0070678_100027328 3300005456 Bacteria 3873
50 Ga0070662_100000078 3300005457 Bacteria 53638
51 Ga0070662_100018915 3300005457 Bacteria 4668
52 Ga0070681_10065142 3300005458 Bacteria 3613
53 Ga0068867_100006690 3300005459 Bacteria 8151
54 Ga0068867_100008503 3300005459 Bacteria 7246
55 Ga0070698_100025752 3300005471 Bacteria 6128
56 Ga0070679_100070891 3300005530 Bacteria 3476
57 Ga0070679_100086033 3300005530 Bacteria 3131
58 Ga0070679_100161367 3300005530 Bacteria 2216
59 Ga0070684_100043078 3300005535 Bacteria 3897
60 Ga0068853_100004317 3300005539 Bacteria 10993
61 Ga0068853_100030236 3300005539 Bacteria 4574
62 Ga0068853_100069211 3300005539 Bacteria 3070
63 Ga0070672_100008962 3300005543 Bacteria 6877
64 Ga0070672_100031245 3300005543 Bacteria 4007
65 Ga0070686_100020741 3300005544 Bacteria 3893
66 Ga0070695_100020443 3300005545 Bacteria 4043
67 Ga0070695_100051194 3300005545 Bacteria 2649
68 Ga0070693_100032771 3300005547 Bacteria 2861
69 Ga0070665_100004334 3300005548 Bacteria 14923
70 Ga0070665_100063242 3300005548 Bacteria 3711
71 Ga0070704_100018498 3300005549 Bacteria 4457
72 Ga0070704_100062346 3300005549 Bacteria 2672
73 Ga0068855_100004942 3300005563 Bacteria 16258
74 Ga0068855_100028202 3300005563 Bacteria 6715
75 Ga0068855_100046643 3300005563 Bacteria 5121
76 Ga0070664_100010485 3300005564 Bacteria 7510
77 Ga0070664_100027161 3300005564 Bacteria 4754
78 Ga0070664_100075939 3300005564 Bacteria 2887
79 Ga0070664_100215880 3300005564 Bacteria 1715
80 Ga0068857_100033391 3300005577 Bacteria 4550
81 Ga0068857_100047626 3300005577 Bacteria 3806
82 Ga0068854_100017063 3300005578 Bacteria 4854
83 Ga0068854_100046004 3300005578 Bacteria 3105
84 Ga0068856_100001001 3300005614 Bacteria 30117
85 Ga0068856_100007039 3300005614 Bacteria 10986
86 Ga0068852_100002270 3300005616 Bacteria 13203
87 Ga0068852_100017186 3300005616 Bacteria 5670
88 Ga0068852_100019923 3300005616 Bacteria 5323
89 Ga0068859_100004203 3300005617 Bacteria 14701
90 Ga0068859_100095007 3300005617 Bacteria 3033
91 Ga0068859_100140846 3300005617 Bacteria 2485
92 Ga0068864_100001909 3300005618 Bacteria 17108
93 Ga0068864_100035079 3300005618 Bacteria 4269
94 Ga0068866_10002600 3300005718 Bacteria 7457
95 Ga0068861_100041962 3300005719 Bacteria 3428
96 Ga0068861_100077149 3300005719 Bacteria 2598
97 Ga0068851_10011747 3300005834 Bacteria 4112
98 Ga0068863_100003624 3300005841 Bacteria 15249
99 Ga0068863_100035228 3300005841 Bacteria 4768
100 Ga0068858_100045079 3300005842 Bacteria 4086
101 Ga0068858_100050302 3300005842 Bacteria 3857
102 Ga0068858_100218010 3300005842 Bacteria 1807
103 Ga0068862_100001127 3300005844 Bacteria 25370
104 Ga0068862_100002393 3300005844 Bacteria 16681
105 Ga0068862_100014795 3300005844 Bacteria 6481
106 Ga0097621_100102383 3300006237 Bacteria 2411
107 Ga0097621_100219819 3300006237 Bacteria 1655
108 Ga0075428_100007666 3300006844 Bacteria 11965
109 Ga0075428_100051663 3300006844 Bacteria 4507
110 Ga0075428_100055569 3300006844 Bacteria 4337
111 Ga0075431_100182349 3300006847 Bacteria 2154
112 Ga0075429_100204033 3300006880 Bacteria 1732
113 Ga0068865_100027847 3300006881 Bacteria 3737
114 Ga0097620_100004203 3300006931 Bacteria 14701
115 Ga0097620_100095006 3300006931 Bacteria 3033
116 Ga0097620_100140849 3300006931 Bacteria 2485
117 Ga0105240_10003662 3300009093 Bacteria 23770
118 Ga0111539_10029532 3300009094 Bacteria 6676
119 Ga0105245_10011528 3300009098 Bacteria 7698
120 Ga0114129_10034677 3300009147 Bacteria 7128
121 Ga0105243_10006231 3300009148 Bacteria 9218
122 Ga0105243_10010002 3300009148 Bacteria 7210
123 Ga0105243_10087902 3300009148 Bacteria 2552
124 Ga0105241_10086128 3300009174 Bacteria 2470
125 Ga0105248_10001569 3300009177 Bacteria 25432
126 Ga0105248_10088185 3300009177 Bacteria 3492
127 Ga0105237_10011888 3300009545 Bacteria 9207
128 Ga0105238_10006202 3300009551 Bacteria 11871
129 Ga0105239_10293582 3300010375 Bacteria 1830
130 Ga0157373_10003538 3300013100 Bacteria 11798
131 Ga0157373_10010022 3300013100 Bacteria 6984
132 Ga0157371_10001873 3300013102 Bacteria 21052
133 Ga0157371_10024483 3300013102 Bacteria 4408
134 Ga0157370_10192622 3300013104 Bacteria 1892
135 Ga0157369_10189961 3300013105 Bacteria 2158
136 Ga0157378_10010388 3300013297 Bacteria 8130
137 Ga0157378_10101409 3300013297 Bacteria 2629
138 Ga0157372_10000380 3300013307 Bacteria 49260
139 Ga0157372_10008547 3300013307 Bacteria 10874
140 Ga0157375_10164931 3300013308 Bacteria 2360
141 Ga0163163_10005831 3300014325 Bacteria 10709
142 Ga0157380_10006932 3300014326 Bacteria 8018
143 Ga0157379_10019642 3300014968 Bacteria 5970
144 Ga0157379_10067526 3300014968 Bacteria 3196
145 Ga0157376_10010297 3300014969 Bacteria 6830
146 Ga0157376_10035380 3300014969 Bacteria 4040
147 Ga0157376_10064951 3300014969 Bacteria 3079
148 Ga0163161_10021873 3300017792 Bacteria 4497
149 Ga0207682_10005184 3300025893 Bacteria 5335
150 Ga0207682_10011960 3300025893 Bacteria 3388
151 Ga0207642_10009677 3300025899 Bacteria 3363
152 Ga0207680_10109815 3300025903 Bacteria 1786
153 Ga0207680_10110159 3300025903 Bacteria 1784
154 Ga0207645_10011775 3300025907 Bacteria 5957
155 Ga0207645_10032671 3300025907 Bacteria 3345
156 Ga0207643_10000513 3300025908 Bacteria 24812
157 Ga0207643_10039075 3300025908 Bacteria 2669
158 Ga0207707_10013754 3300025912 Bacteria 7057
159 Ga0207707_10069700 3300025912 Bacteria 3064
160 Ga0207707_10152289 3300025912 Bacteria 2022
161 Ga0207695_10045724 3300025913 Bacteria 4646
162 Ga0207671_10023864 3300025914 Bacteria 4607
163 Ga0207662_10009607 3300025918 Bacteria 5329
164 Ga0207657_10000411 3300025919 Bacteria 45329
165 Ga0207657_10008890 3300025919 Bacteria 10157
166 Ga0207657_10009338 3300025919 Bacteria 9872
167 Ga0207649_10019287 3300025920 Bacteria 3895
168 Ga0207649_10029036 3300025920 Bacteria 3263
169 Ga0207652_10016248 3300025921 Bacteria 6073
170 Ga0207681_10005013 3300025923 Bacteria 8136
171 Ga0207681_10045511 3300025923 Bacteria 2947
172 Ga0207694_10088574 3300025924 Bacteria 2440
173 Ga0207650_10007503 3300025925 Bacteria 7436
174 Ga0207687_10009179 3300025927 Bacteria 6469
175 Ga0207664_10017997 3300025929 Bacteria 5192
176 Ga0207644_10004497 3300025931 Bacteria 9058
177 Ga0207644_10006293 3300025931 Bacteria 7732
178 Ga0207644_10090305 3300025931 Bacteria 2282
179 Ga0207690_10001598 3300025932 Bacteria 14142
180 Ga0207690_10031887 3300025932 Bacteria 3377
181 Ga0207690_10102978 3300025932 Bacteria 2042
182 Ga0207706_10000008 3300025933 Bacteria 201940
183 Ga0207706_10007150 3300025933 Bacteria 10323
184 Ga0207706_10021932 3300025933 Bacteria 5732
185 Ga0207686_10006735 3300025934 Bacteria 6188
186 Ga0207686_10085110 3300025934 Bacteria 2073
187 Ga0207709_10016245 3300025935 Bacteria 4136
188 Ga0207709_10019488 3300025935 Bacteria 3816
189 Ga0207691_10008219 3300025940 Bacteria 10024
190 Ga0207691_10015633 3300025940 Bacteria 7214
191 Ga0207691_10019856 3300025940 Bacteria 6355
192 Ga0207691_10064749 3300025940 Bacteria 3311
193 Ga0207711_10007053 3300025941 Bacteria 9417
194 Ga0207689_10000525 3300025942 Bacteria 36352
195 Ga0207689_10001702 3300025942 Bacteria 20851
196 Ga0207689_10066883 3300025942 Bacteria 2954
197 Ga0207689_10076439 3300025942 Bacteria 2753
198 Ga0207679_10007633 3300025945 Bacteria 6871
199 Ga0207679_10009381 3300025945 Bacteria 6268
200 Ga0207679_10132922 3300025945 Bacteria 1999
201 Ga0207667_10002837 3300025949 Bacteria 21521
202 Ga0207667_10033936 3300025949 Bacteria 5482
203 Ga0207651_10063189 3300025960 Bacteria 2584
204 Ga0207651_10088186 3300025960 Bacteria 2261
205 Ga0207651_10094997 3300025960 Bacteria 2194
206 Ga0207668_10067522 3300025972 Bacteria 2539
207 Ga0207640_10028400 3300025981 Bacteria 3420
208 Ga0207658_10016787 3300025986 Bacteria 5038
209 Ga0207658_10053729 3300025986 Bacteria 2978
210 Ga0207658_10180016 3300025986 Bacteria 1749
211 Ga0207677_10073770 3300026023 Bacteria 2418
212 Ga0207703_10010199 3300026035 Bacteria 7363
213 Ga0207703_10077154 3300026035 Bacteria 2766
214 Ga0207703_10123971 3300026035 Bacteria 2222
215 Ga0207639_10036044 3300026041 Bacteria 3663
216 Ga0207639_10043744 3300026041 Bacteria 3364
217 Ga0207639_10144193 3300026041 Bacteria 1988
218 Ga0207708_10010541 3300026075 Bacteria 6862
219 Ga0207708_10037779 3300026075 Bacteria 3678
220 Ga0207702_10003563 3300026078 Bacteria 14163
221 Ga0207702_10039246 3300026078 Bacteria 3966
222 Ga0207641_10003573 3300026088 Bacteria 13744
223 Ga0207641_10007607 3300026088 Bacteria 9010
224 Ga0207648_10009095 3300026089 Bacteria 9550
225 Ga0207648_10086872 3300026089 Bacteria 2729
226 Ga0207676_10001593 3300026095 Bacteria 16712
227 Ga0207676_10003299 3300026095 Bacteria 11461
228 Ga0207676_10005802 3300026095 Bacteria 8728
229 Ga0207676_10088116 3300026095 Bacteria 2540
230 Ga0207674_10000155 3300026116 Bacteria 80715
231 Ga0207674_10025066 3300026116 Bacteria 6365
232 Ga0207675_100007594 3300026118 Bacteria 10243
233 Ga0207675_100016625 3300026118 Bacteria 6872
234 Ga0207675_100092999 3300026118 Bacteria 2836
235 Ga0207683_10001701 3300026121 Bacteria 19679
236 Ga0207683_10001956 3300026121 Bacteria 18241
237 Ga0207698_10007783 3300026142 Bacteria 6733
238 Ga0209996_1003984 3300027395 Bacteria 1871
239 Ga0210000_1004207 3300027462 Bacteria 2080
240 Ga0209995_1003491 3300027471 Bacteria 2504
241 Ga0209999_1001563 3300027543 Bacteria 3936
242 Ga0209983_1009753 3300027665 Bacteria 1963
243 Ga0209983_1009775 3300027665 Bacteria 1960
244 Ga0209971_1002134 3300027682 Bacteria 4811
245 Ga0209974_10000461 3300027876 Bacteria 13511
246 Ga0209974_10015053 3300027876 Bacteria 2568
247 Ga0207428_10013127 3300027907 Bacteria 7252
248 Ga0268266_10026864 3300028379 Bacteria 4897
249 Ga0268265_10001675 3300028380 Bacteria 18077
250 Ga0268264_10042128 3300028381 Bacteria 3779
251 Ga0307515_10005856 3300028794 Bacteria 24799
252 Ga0307515_10060136 3300028794 Bacteria 5428
253 Ga0307512_10028671 3300030522 Bacteria 4877
254 Ga0265325_10007139 3300031241 Bacteria 6719
255 Ga0307509_10001394 3300031507 Bacteria 40983
256 Ga0307509_10024769 3300031507 Bacteria 6715
257 Ga0307508_10000684 3300031616 Bacteria 40683
258 Ga0307514_10005730 3300031649 Bacteria 10983
259 Ga0316578_10020384 3300031728 Bacteria 3663
260 Ga0307516_10011494 3300031730 Bacteria 9615
261 Ga0307507_10012243 3300033179 Bacteria 10640
262 Ga0373941_0004745 3300035115 Bacteria 3160
263 Ga0373954_0000024 3300035118 Bacteria 57545
264 Ga0373946_0028438 3300035171 Bacteria 2218
265 Ga0373955_0029992 3300035172 Bacteria 2835
266 Ga0373942_0004326 3300035207 Bacteria 3302
267 Ga0316574_0023605 3300035398 Bacteria 3673
268 Ga0373924_0003674 3300035410 Bacteria 5291
269 Ga0373931_0006858 3300035691 Bacteria 5354
270 Ga0373931_0080487 3300035691 Bacteria 1796
271 Ga0373927_0012321 3300035695 Bacteria 5690
272 Ga0373927_0022085 3300035695 Bacteria 4170
273 Ga0373947_0027082 3300035725 Bacteria 3354
274 Ga0373937_0002943 3300036401 Bacteria 14249
275 Ga0373937_0019995 3300036401 Bacteria 5997
276 Ga0373937_0029330 3300036401 Bacteria 4983
277 Ga0373937_0169514 3300036401 Bacteria 2048
278 Ga0316582_0006484 3300036647 Bacteria 6149
279 Ga0373925_0024344 3300037068 Bacteria 4421
280 Ga0395900_0059678 3300037418 Bacteria 3927
281 Ga0395898_0090392 3300037466 Bacteria 2946
282 Ga0395901_0029144 3300038443 Bacteria 5681
283 Ga0451791_0229544 3300041451 Bacteria 3337
284 Ga0451802_2135161 3300041460 Bacteria 1738
285 Ga0439446_0030284 3300042156 Bacteria 1564
286 Ga0439434_0004217 3300042435 Bacteria 4199
287 Ga0439434_0006693 3300042435 Bacteria 3368
288 Ga0439435_0016045 3300042436 Bacteria 1872
289 Ga0439444_0008840 3300042437 Bacteria 1576
290 Ga0451577_0024950 3300042876 Bacteria 5430
291 Ga0451577_0025984 3300042876 Bacteria 5306
292 Ga0451577_0070663 3300042876 Bacteria 3113
293 Ga0451577_0086176 3300042876 Bacteria 2802
294 Ga0453683_0049875 3300044673 Bacteria 2623
295 Ga0451576_0000335 3300045051 Bacteria 113806
296 Ga0451576_0001486 3300045051 Bacteria 39626
297 Ga0451576_0049042 3300045051 Bacteria 4431
298 Ga0451576_0087442 3300045051 Bacteria 3242
299 Ga0451576_0091742 3300045051 Bacteria 3159
300 Ga0495629_0114419 3300046459 Bacteria 1880
301 Ga0495641_0011561 3300046461 Bacteria 5016
302 Ga0495651_0015489 3300046462 Bacteria 5899
303 Ga0495653_0016021 3300046463 Bacteria 6109
304 Ga0495580_0017202 3300046472 Bacteria 5412
305 Ga0495664_0059315 3300046477 Bacteria 2277
306 Ga0495630_0002338 3300046517 Bacteria 13181
307 Ga0495652_0037438 3300046529 Bacteria 4209
308 Ga0495665_0013415 3300046531 Bacteria 4430
309 Ga0495622_0078890 3300046557 Bacteria 1516
310 Ga0495625_0005656 3300046660 Bacteria 11326
311 Ga0495657_0017967 3300046675 Bacteria 5127
312 Ga0495658_0090564 3300046683 Bacteria 1811
313 Ga0495604_0024249 3300047317 Bacteria 4840
314 Ga0495675_0006291 3300047444 Bacteria 7268
315 Ga0496101_0048157 3300048904 Bacteria 3062
316 Ga0496101_0143629 3300048904 Bacteria 1821
317 Ga0496102_0027375 3300048905 Bacteria 5091
318 Ga0496105_0064348 3300048908 Bacteria 3026
319 Ga0496106_0006884 3300048909 Bacteria 8411
320 Ga0496107_0009080 3300048910 Bacteria 6893
321 Ga0496107_0018797 3300048910 Bacteria 4871
322 Ga0496110_0115693 3300048913 Bacteria 2414
323 Ga0496110_0271587 3300048913 Bacteria 1544
324 Ga0496114_0114648 3300048917 Bacteria 2311
325 Ga0501031_0004874 3300049568 Bacteria 8725
326 Ga0501033_0004194 3300049570 Bacteria 11601
327 Ga0501034_0000206 3300049571 Bacteria 112130
328 Ga0501036_0000096 3300049572 Bacteria 54442
329 Ga0501036_0093154 3300049572 Bacteria 2545
330 Ga0501038_0000791 3300049574 Bacteria 28037
331 Ga0501038_0117682 3300049574 Bacteria 2194
332 Ga0501039_0008295 3300049575 Bacteria 7917
333 Ga0501039_0009150 3300049575 Bacteria 7546
334 Ga0501039_0022584 3300049575 Bacteria 4830
335 Ga0501039_0033181 3300049575 Bacteria 3982
336 Ga0501040_0000395 3300049576 Bacteria 25703
337 Ga0501040_0013815 3300049576 Bacteria 5315
338 Ga0501041_0000652 3300049577 Bacteria 18234
339 Ga0501041_0015867 3300049577 Bacteria 4477
340 Ga0501041_0042688 3300049577 Bacteria 2756
341 Ga0501042_0003069 3300049578 Bacteria 10402
342 Ga0501042_0071602 3300049578 Bacteria 2480
343 Ga0501042_0090564 3300049578 Bacteria 2195
344 Ga0501043_0023407 3300049579 Bacteria 4845
345 Ga0501046_0000200 3300049580 Bacteria 61991
346 Ga0501046_0111485 3300049580 Bacteria 2089
347 Ga0501048_0004765 3300049582 Bacteria 10333
348 Ga0501071_0041356 3300049587 Bacteria 3301
349 Ga0501071_0041498 3300049587 Bacteria 3295
350 Ga0501072_0000765 3300049588 Bacteria 23435
351 Ga0501072_0001267 3300049588 Bacteria 18869
352 Ga0501072_0002044 3300049588 Bacteria 15013
353 Ga0501072_0029239 3300049588 Bacteria 4303
354 Ga0501073_0037854 3300049589 Bacteria 3424
355 Ga0501074_0032656 3300049590 Bacteria 3770
356 Ga0501075_0000232 3300049591 Bacteria 29854
357 Ga0501075_0004718 3300049591 Bacteria 9258
358 Ga0501076_0005762 3300049592 Bacteria 8931
359 Ga0501077_0064044 3300049593 Bacteria 2332
360 Ga0501079_0003631 3300049741 Bacteria 11359
361 Ga0501079_0005200 3300049741 Bacteria 9672
362 Ga0501079_0031455 3300049741 Bacteria 4079
363 Ga0501080_0131381 3300049742 Bacteria 2318
364 Ga0501081_0000992 3300049743 Bacteria 16898
365 Ga0501081_0002360 3300049743 Bacteria 11890
366 Ga0501081_0003024 3300049743 Bacteria 10673
367 Ga0501083_0031006 3300049744 Bacteria 3670
368 Ga0501035_0078349 3300049822 Bacteria 2920
369 Ga0501044_0100778 3300049823 Bacteria 2906
370 Ga0501045_0000087 3300049824 Bacteria 43859
371 nmdc:mga05p37_1955_c1 3300050507 Bacteria 9356
372 nmdc:mga09592_9676_c1 3300050508 Bacteria 7833
373 nmdc:mga0qj67_23096_c1 3300050509 Bacteria 4781
374 nmdc:mga0qj67_34611_c1 3300050509 Bacteria 3946
375 nmdc:mga08y16_25472_c1 3300050511 Bacteria 6240
376 Ga0495595_0002788 3300053084 Bacteria 6870
377 Ga0495619_0031190 3300053085 Bacteria 3453
378 Ga0501084_0004143 3300054114 Bacteria 11816
379 Ga0501084_0047035 3300054114 Bacteria 3613
380 Ga0501082_0010273 3300060353 Bacteria 8059
381 Ga0501082_0036777 3300060353 Bacteria 4217
382 Ga0501082_0075088 3300060353 Bacteria 2912
383 Ga0530510_0000522 3300061734 Bacteria 24577
384 Ga0157369_10211348
385 Ga0070676_10006852
386 Ga0070683_100008815
387 Ga0070683_100037217
388 Ga0070683_100146620
389 Ga0070690_100002553
390 Ga0070690_100006640
391 Ga0070670_100002673
392 Ga0068869_100006374
393 Ga0070680_100079431
394 Ga0068868_100086692
395 Ga0068868_100093739
396 Ga0068868_100100627
397 Ga0070660_100000581
398 Ga0070660_100015171
399 Ga0070689_100015381
400 Ga0070689_100030282
401 Ga0070691_10038399
402 Ga0070661_100005284
403 Ga0070661_100005599
404 Ga0070692_10011876
405 Ga0070692_10094914
406 Ga0070668_100023220
407 Ga0070668_100041154
408 Ga0070668_100050688
409 Ga0070669_100010896
410 Ga0070669_100023650
411 Ga0070669_100117206
412 Ga0070675_100012028
413 Ga0070671_100002453
414 Ga0070671_100120560
415 Ga0070671_100151822
416 Ga0070673_100006904
417 Ga0070673_100013295
418 Ga0070688_100025033
419 Ga0070659_100001886
420 Ga0070659_100023388
421 Ga0070659_100031957
422 Ga0070667_100008529
423 Ga0070667_100039738
424 Ga0070667_100110372
425 Ga0070714_100020564
426 Ga0070705_100029910
427 Ga0070700_100002031
428 Ga0070700_100007776
429 Ga0070694_100121184
430 Ga0070708_100014748
431 Ga0070678_100003000
432 Ga0070678_100027328
433 Ga0070662_100000078
434 Ga0070662_100018915
435 Ga0070681_10065142
436 Ga0068867_100006690
437 Ga0068867_100008503
438 Ga0070698_100025752
439 Ga0070679_100070891
440 Ga0070679_100086033
441 Ga0070679_100161367
442 Ga0070684_100043078
443 Ga0068853_100004317
444 Ga0068853_100030236
445 Ga0068853_100069211
446 Ga0070672_100008962
447 Ga0070672_100031245
448 Ga0070686_100020741
449 Ga0070695_100020443
450 Ga0070695_100051194
451 Ga0070693_100032771
452 Ga0070665_100004334
453 Ga0070665_100063242
454 Ga0070704_100018498
455 Ga0070704_100062346
456 Ga0068855_100004942
457 Ga0068855_100028202
458 Ga0068855_100046643
459 Ga0070664_100010485
460 Ga0070664_100027161
461 Ga0070664_100075939
462 Ga0070664_100215880
463 Ga0068857_100033391
464 Ga0068857_100047626
465 Ga0068854_100017063
466 Ga0068854_100046004
467 Ga0068856_100001001
468 Ga0068856_100007039
469 Ga0068852_100002270
470 Ga0068852_100017186
471 Ga0068852_100019923
472 Ga0068859_100004203
473 Ga0068859_100095007
474 Ga0068859_100140846
475 Ga0068864_100001909
476 Ga0068864_100035079
477 Ga0068866_10002600
478 Ga0068861_100041962
479 Ga0068861_100077149
480 Ga0068851_10011747
481 Ga0068863_100003624
482 Ga0068863_100035228
483 Ga0068858_100045079
484 Ga0068858_100050302
485 Ga0068858_100218010
486 Ga0068862_100001127
487 Ga0068862_100002393
488 Ga0068862_100014795
489 Ga0097621_100102383
490 Ga0097621_100219819
491 Ga0075428_100007666
492 Ga0075428_100051663
493 Ga0075428_100055569
494 Ga0075431_100182349
495 Ga0075429_100204033
496 Ga0068865_100027847
497 Ga0097620_100004203
498 Ga0097620_100095006
499 Ga0097620_100140849
500 Ga0105240_10003662
501 Ga0111539_10029532
502 Ga0105245_10011528
503 Ga0114129_10034677
504 Ga0105243_10006231
505 Ga0105243_10010002
506 Ga0105243_10087902
507 Ga0105241_10086128
508 Ga0105248_10001569
509 Ga0105248_10088185
510 Ga0105237_10011888
511 Ga0105238_10006202
512 Ga0105239_10293582
513 Ga0157373_10003538
514 Ga0157373_10010022
515 Ga0157371_10001873
516 Ga0157371_10024483
517 Ga0157370_10192622
518 Ga0157369_10189961
519 Ga0157378_10010388
520 Ga0157378_10101409
521 Ga0157372_10000380
522 Ga0157372_10008547
523 Ga0157375_10164931
524 Ga0163163_10005831
525 Ga0157380_10006932
526 Ga0157379_10019642
527 Ga0157379_10067526
528 Ga0157376_10010297
529 Ga0157376_10035380
530 Ga0157376_10064951
531 Ga0163161_10021873
532 Ga0207682_10005184
533 Ga0207682_10011960
534 Ga0207642_10009677
535 Ga0207680_10109815
536 Ga0207680_10110159
537 Ga0207645_10011775
538 Ga0207645_10032671
539 Ga0207643_10000513
540 Ga0207643_10039075
541 Ga0207707_10013754
542 Ga0207707_10069700
543 Ga0207707_10152289
544 Ga0207695_10045724
545 Ga0207671_10023864
546 Ga0207662_10009607
547 Ga0207657_10000411
548 Ga0207657_10008890
549 Ga0207657_10009338
550 Ga0207649_10019287
551 Ga0207649_10029036
552 Ga0207652_10016248
553 Ga0207681_10005013
554 Ga0207681_10045511
555 Ga0207694_10088574
556 Ga0207650_10007503
557 Ga0207687_10009179
558 Ga0207664_10017997
559 Ga0207644_10004497
560 Ga0207644_10006293
561 Ga0207644_10090305
562 Ga0207690_10001598
563 Ga0207690_10031887
564 Ga0207690_10102978
565 Ga0207706_10000008
566 Ga0207706_10007150
567 Ga0207706_10021932
568 Ga0207686_10006735
569 Ga0207686_10085110
570 Ga0207709_10016245
571 Ga0207709_10019488
572 Ga0207691_10008219
573 Ga0207691_10015633
574 Ga0207691_10019856
575 Ga0207691_10064749
576 Ga0207711_10007053
577 Ga0207689_10000525
578 Ga0207689_10001702
579 Ga0207689_10066883
580 Ga0207689_10076439
581 Ga0207679_10007633
582 Ga0207679_10009381
583 Ga0207679_10132922
584 Ga0207667_10002837
585 Ga0207667_10033936
586 Ga0207651_10063189
587 Ga0207651_10088186
588 Ga0207651_10094997
589 Ga0207668_10067522
590 Ga0207640_10028400
591 Ga0207658_10016787
592 Ga0207658_10053729
593 Ga0207658_10180016
594 Ga0207677_10073770
595 Ga0207703_10010199
596 Ga0207703_10077154
597 Ga0207703_10123971
598 Ga0207639_10036044
599 Ga0207639_10043744
600 Ga0207639_10144193
601 Ga0207708_10010541
602 Ga0207708_10037779
603 Ga0207702_10003563
604 Ga0207702_10039246
605 Ga0207641_10003573
606 Ga0207641_10007607
607 Ga0207648_10009095
608 Ga0207648_10086872
609 Ga0207676_10001593
610 Ga0207676_10003299
611 Ga0207676_10005802
612 Ga0207676_10088116
613 Ga0207674_10000155
614 Ga0207674_10025066
615 Ga0207675_100007594
616 Ga0207675_100016625
617 Ga0207675_100092999
618 Ga0207683_10001701
619 Ga0207683_10001956
620 Ga0207698_10007783
621 Ga0209996_1003984
622 Ga0210000_1004207
623 Ga0209995_1003491
624 Ga0209999_1001563
625 Ga0209983_1009753
626 Ga0209983_1009775
627 Ga0209971_1002134
628 Ga0209974_10000461
629 Ga0209974_10015053
630 Ga0207428_10013127
631 Ga0268266_10026864
632 Ga0268265_10001675
633 Ga0268264_10042128
634 Ga0307515_10005856
635 Ga0307515_10060136
636 Ga0307512_10028671
637 Ga0265325_10007139
638 Ga0307509_10001394
639 Ga0307509_10024769
640 Ga0307508_10000684
641 Ga0307514_10005730
642 Ga0316578_10020384
643 Ga0307516_10011494
644 Ga0307507_10012243
645 Ga0373941_0004745
646 Ga0373954_0000024
647 Ga0373946_0028438
648 Ga0373955_0029992
649 Ga0373942_0004326
650 Ga0316574_0023605
651 Ga0373924_0003674
652 Ga0373931_0006858
653 Ga0373931_0080487
654 Ga0373927_0012321
655 Ga0373927_0022085
656 Ga0373947_0027082
657 Ga0373937_0002943
658 Ga0373937_0019995
659 Ga0373937_0029330
660 Ga0373937_0169514
661 Ga0316582_0006484
662 Ga0373925_0024344
663 Ga0395900_0059678
664 Ga0395898_0090392
665 Ga0395901_0029144
666 Ga0451791_0229544
667 Ga0451802_2135161
668 Ga0439446_0030284
669 Ga0439434_0004217
670 Ga0439434_0006693
671 Ga0439435_0016045
672 Ga0439444_0008840
673 Ga0451577_0024950
674 Ga0451577_0025984
675 Ga0451577_0070663
676 Ga0451577_0086176
677 Ga0453683_0049875
678 Ga0451576_0000335
679 Ga0451576_0001486
680 Ga0451576_0049042
681 Ga0451576_0087442
682 Ga0451576_0091742
683 Ga0495629_0114419
684 Ga0495641_0011561
685 Ga0495651_0015489
686 Ga0495653_0016021
687 Ga0495580_0017202
688 Ga0495664_0059315
689 Ga0495630_0002338
690 Ga0495652_0037438
691 Ga0495665_0013415
692 Ga0495622_0078890
693 Ga0495625_0005656
694 Ga0495657_0017967
695 Ga0495658_0090564
696 Ga0495604_0024249
697 Ga0495675_0006291
698 Ga0496101_0048157
699 Ga0496101_0143629
700 Ga0496102_0027375
701 Ga0496105_0064348
702 Ga0496106_0006884
703 Ga0496107_0009080
704 Ga0496107_0018797
705 Ga0496110_0115693
706 Ga0496110_0271587
707 Ga0496114_0114648
708 Ga0501031_0004874
709 Ga0501033_0004194
710 Ga0501034_0000206
711 Ga0501036_0000096
712 Ga0501036_0093154
713 Ga0501038_0000791
714 Ga0501038_0117682
715 Ga0501039_0008295
716 Ga0501039_0009150
717 Ga0501039_0022584
718 Ga0501039_0033181
719 Ga0501040_0000395
720 Ga0501040_0013815
721 Ga0501041_0000652
722 Ga0501041_0015867
723 Ga0501041_0042688
724 Ga0501042_0003069
725 Ga0501042_0071602
726 Ga0501042_0090564
727 Ga0501043_0023407
728 Ga0501046_0000200
729 Ga0501046_0111485
730 Ga0501048_0004765
731 Ga0501071_0041356
732 Ga0501071_0041498
733 Ga0501072_0000765
734 Ga0501072_0001267
735 Ga0501072_0002044
736 Ga0501072_0029239
737 Ga0501073_0037854
738 Ga0501074_0032656
739 Ga0501075_0000232
740 Ga0501075_0004718
741 Ga0501076_0005762
742 Ga0501077_0064044
743 Ga0501079_0003631
744 Ga0501079_0005200
745 Ga0501079_0031455
746 Ga0501080_0131381
747 Ga0501081_0000992
748 Ga0501081_0002360
749 Ga0501081_0003024
750 Ga0501083_0031006
751 Ga0501035_0078349
752 Ga0501044_0100778
753 Ga0501045_0000087
754 nmdc:mga05p37_1955_c1
755 nmdc:mga09592_9676_c1
756 nmdc:mga0qj67_23096_c1
757 nmdc:mga0qj67_34611_c1
758 nmdc:mga08y16_25472_c1
759 Ga0495595_0002788
760 Ga0495619_0031190
761 Ga0501084_0004143
762 Ga0501084_0047035
763 Ga0501082_0010273
764 Ga0501082_0036777
765 Ga0501082_0075088
766 Ga0530510_0000522

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF12801

Fer4_5

4Fe-4S binding domain

108

153

0.91

PF13746

Fer4_18

4Fe-4S dicluster domain

233

326

0.9

PF11614

FixG_C

IG-like fold at C-terminal of FixG, putative oxidoreductase

361

484

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
2r39-assembly1.cif.gz_A crystal structure of fixg-related protein from vibrio parahaemolyticus 0.8859 367 481
2r39-assembly1.cif.gz_A crystal structure of fixg-related protein from vibrio parahaemolyticus 0.856 367 481
7ad7-assembly1.cif.gz_A crystal structure of human complement c5 in complex with the k8 bovine knob domain peptide. 0.7183 366 483
5jpm-assembly2.cif.gz_E structure of the complex of human complement c4 with masp-2 rebuilt using imdff 0.7156 366 484
3vta-assembly1.cif.gz_A crystal structure of cucumisin, a subtilisin-like endoprotease from cucumis melo l 0.7058 389 481
ID Description Score Start End Superfamily
2r39A00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8367 367 481 2.60.40.10
2r39A00 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8087 367 481 2.60.40.10
af_P91870_477_576_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7472 391 479 2.60.40.10
5jpmE03 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7233 369 484 2.60.40.10
af_Q3U3D7_90_190_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.7213 391 484 2.60.40.10
ID Description Score Start End GO Terms
AF-A0A7W5TU33-F1-model_v4 deleted 0.9395 369 484
AF-A0A6N4DF21-F1-model_v4 deleted 0.9334 367 444
AF-A0A258ZZ26-F1-model_v4 Cytochrome c oxidase accessory protein CcoG 0.9318 370 484
AF-A0A7C5CMJ8-F1-model_v4 Cytochrome c oxidase accessory protein CcoG 0.9252 372 484
AF-A0A7W5TU33-F1-model_v4 deleted 0.923 369 484

Map