F429554

General Info

Members Datasets Scaffolds Average Seq Length
383 206 358 110

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100013786|Ga0075428_1000137867
Length 125
Sequence MTREKKECGMSDMKWTELRTESQLEQIQEESRTKSILIFKHSSRCSISKMALDRLERKWNAEETMHIKPYFVDLLSFREISASIASQFDVEHESPQVLIIENGQSIYDQSHFDIDYHKILVAAKN

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
3 2599185184 Mucilaginibacter sp. NFR10 Isolate Rhizoplane
4 2738541283 Pedobacter sp. OK701 Isolate Unclassified
5 2738541284 Pedobacter sp. YR016 Isolate Unclassified
6 2738541302 Pedobacter sp. CF074 Isolate Unclassified
7 2738543023 Pedobacter sp. OK628 Isolate Unclassified
8 2739367651 Pedobacter sp. OK291 Isolate Unclassified
9 2739367656 Pedobacter sp. CF523 Isolate Unclassified
10 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
11 2818991437 Pedobacter terrae 518 Isolate Unclassified
12 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
13 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
14 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
15 2852623160 Mucilaginibacter sp. AK015 Isolate Rhizosphere
16 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
17 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
18 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
19 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
20 2919437846 Mucilaginibacter pocheonensis 3262 Isolate Rhizosphere
21 2928078545 Mucilaginibacter rubeus 1215 Isolate Unclassified
22 2928147474 Mucilaginibacter rubeus 2025 Isolate Unclassified
23 2932082852 Mucilaginibacter sp. 3215 Isolate Rhizosphere
24 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
25 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
26 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
27 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
28 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
29 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
30 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
31 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
32 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
33 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
34 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
35 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
36 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
37 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
38 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
39 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
40 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
41 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
42 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
43 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
44 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
45 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
46 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
47 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
48 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
49 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
50 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
51 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
52 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
53 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
54 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
57 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
58 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
59 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
60 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
61 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
65 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
66 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
67 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
68 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
70 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
71 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
76 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
77 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
85 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
86 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
87 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
88 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
89 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
90 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
91 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
92 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
93 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
94 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
95 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
96 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
97 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
98 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
99 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
101 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
102 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
103 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
120 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
121 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
124 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
125 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
126 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
127 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
128 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
129 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
137 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
138 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
139 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
140 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
141 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
142 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
143 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
144 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
145 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
146 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
147 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
148 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
149 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
150 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
151 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
152 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
153 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
154 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
155 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
156 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
157 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
158 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
159 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
162 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
163 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
164 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
165 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
166 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
167 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
168 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
169 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
170 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
171 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
172 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
173 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
174 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
175 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
176 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
177 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
178 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
179 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
180 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
181 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
182 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
183 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
184 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
185 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
186 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
187 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
188 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
189 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
190 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
191 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
192 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
193 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
194 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
195 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
196 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
197 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
198 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
199 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
200 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
201 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
202 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
203 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
204 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
205 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
206 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.38
Metatranscriptomes 2.09
Isolates 6.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.23
Nodule 0
Rhizoplane 1.83
Rhizosphere 77.55
Stem 0
Stem Tuber 0
Unclassified 9.4

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_1363481 2162886007 Bacteria 1119
2 SwRhRL2b_contig_3392341 2162886007 Bacteria 2529
3 JGI24736J21556_1001405 3300001904 Bacteria 4406
4 JGI24740J21852_10041403 3300001979 Bacteria 1388
5 JGI24739J22299_10199657 3300001989 Bacteria 587
6 JGI24739J22299_10199769 3300001989 Bacteria 587
7 JGI24737J22298_10000077 3300001990 Bacteria 28981
8 JGI24737J22298_10056968 3300001990 Bacteria 1180
9 JGI24737J22298_10137105 3300001990 Bacteria 723
10 JGI24735J21928_10000005 3300002067 Bacteria 356755
11 JGI24735J21928_10023968 3300002067 Bacteria 1848
12 JGI25162J39368_1000563 3300002737 Bacteria 27213
13 JGI25152J39213_1000006 3300002773 Bacteria 158516
14 JGI25150J39212_1000005 3300002774 Bacteria 311800
15 JGI25151J46595_10000004 3300003187 Bacteria 494006
16 JGI25153J46596_10000004 3300003215 Bacteria 494006
17 rootH1_10023440 3300003316 Bacteria 5453
18 rootH2_10194391 3300003320 Bacteria 1212
19 rootL2_10021894 3300003322 Bacteria 11126
20 rootL2_10103955 3300003322 Unclassified 1895
21 rootH1_10008582 3300003323 Bacteria 172664
22 rootH1_10100747 3300003323 Bacteria 6026
23 rootH1_10127442 3300003323 Unclassified 2053
24 rootH1_10152501 3300003323 Bacteria 2114
25 rootH1_10327782 3300003323 Bacteria 1544
26 rootH1_10364027 3300003323 Bacteria 1718
27 Ga0055536_1000004 3300003781 Bacteria 411108
28 Ga0055530_10001269 3300003791 Bacteria 19064
29 Ga0055543_1050969 3300004625 Bacteria 678
30 Ga0058862_10825505 3300004803 Bacteria 672
31 Ga0065165_1000470 3300005262 Bacteria 62866
32 Ga0065714_10004265 3300005288 Bacteria 5776
33 Ga0065714_10064689 3300005288 Bacteria 23467
34 Ga0065714_10066111 3300005288 Bacteria 7587
35 Ga0065714_10072693 3300005288 Bacteria 3313
36 Ga0065714_10120522 3300005288 Bacteria 1351
37 Ga0065714_10136200 3300005288 Bacteria 1207
38 Ga0065714_10155695 3300005288 Bacteria 1080
39 Ga0065714_10155781 3300005288 Bacteria 1079
40 Ga0065714_10207260 3300005288 Bacteria 877
41 Ga0065704_10073975 3300005289 Bacteria 6617
42 Ga0065704_10136808 3300005289 Bacteria 1552
43 Ga0065704_10858711 3300005289 Bacteria 507
44 Ga0065715_10118966 3300005293 Bacteria 2292
45 Ga0070658_10020598 3300005327 Bacteria 5286
46 Ga0070658_10084782 3300005327 Bacteria 2605
47 Ga0070658_10100385 3300005327 Bacteria 2392
48 Ga0070658_10168420 3300005327 Bacteria 1840
49 Ga0070683_100162959 3300005329 Bacteria 2116
50 Ga0070680_100008098 3300005336 Bacteria 8023
51 Ga0070680_101373635 3300005336 Bacteria 612
52 Ga0070660_100194832 3300005339 Bacteria 1642
53 Ga0070660_100256435 3300005339 Bacteria 1427
54 Ga0070692_10399109 3300005345 Bacteria 868
55 Ga0070675_100799079 3300005354 Bacteria 862
56 Ga0070674_100317739 3300005356 Bacteria 1247
57 Ga0070674_101647069 3300005356 Unclassified 579
58 Ga0070659_100002565 3300005366 Bacteria 12918
59 Ga0070713_100470894 3300005436 Bacteria 1182
60 Ga0070663_100017969 3300005455 Bacteria 4626
61 Ga0070663_100578458 3300005455 Bacteria 942
62 Ga0070681_10027266 3300005458 Bacteria 5745
63 Ga0070679_100073738 3300005530 Bacteria 3404
64 Ga0070679_101305008 3300005530 Bacteria 671
65 Ga0068853_100045019 3300005539 Bacteria 3779
66 Ga0070686_100522362 3300005544 Bacteria 924
67 Ga0068855_100041312 3300005563 Bacteria 5467
68 Ga0068855_101548569 3300005563 Unclassified 679
69 Ga0068857_100059357 3300005577 Bacteria 3398
70 Ga0068857_100138715 3300005577 Bacteria 2197
71 Ga0068857_100185597 3300005577 Bacteria 1893
72 Ga0068854_101153458 3300005578 Bacteria 692
73 Ga0068856_100012333 3300005614 Bacteria 8276
74 Ga0068856_100040266 3300005614 Bacteria 4589
75 Ga0075366_10005756 3300006195 Bacteria 6731
76 Ga0075366_10006727 3300006195 Bacteria 6313
77 Ga0097621_100664543 3300006237 Bacteria 957
78 Ga0075428_100013786 3300006844 Bacteria 9004
79 Ga0075430_100684231 3300006846 Unclassified 845
80 Ga0105251_10426558 3300009011 Bacteria 612
81 Ga0105240_10465962 3300009093 Bacteria 1411
82 Ga0111539_10002481 3300009094 Bacteria 24471
83 Ga0105237_10195948 3300009545 Unclassified 2020
84 Ga0105237_10217510 3300009545 Bacteria 1910
85 Ga0105237_10229458 3300009545 Bacteria 1857
86 Ga0105237_10246298 3300009545 Bacteria 1789
87 Ga0105237_10295547 3300009545 Bacteria 1622
88 Ga0105239_10000008 3300010375 Bacteria 376925
89 Ga0105239_10000446 3300010375 Bacteria 60289
90 Ga0105239_10009159 3300010375 Bacteria 11197
91 Ga0105239_10018812 3300010375 Bacteria 7631
92 Ga0105239_11315001 3300010375 Unclassified 834
93 Ga0157373_10000091 3300013100 Bacteria 75012
94 Ga0157373_10000424 3300013100 Bacteria 33838
95 Ga0157373_10003653 3300013100 Bacteria 11625
96 Ga0157373_10018982 3300013100 Bacteria 5005
97 Ga0157373_10054096 3300013100 Bacteria 2853
98 Ga0157373_10121334 3300013100 Bacteria 1837
99 Ga0157373_10187902 3300013100 Bacteria 1455
100 Ga0157371_10000155 3300013102 Bacteria 100230
101 Ga0157371_10000241 3300013102 Bacteria 78231
102 Ga0157371_10001204 3300013102 Bacteria 27630
103 Ga0157371_10003294 3300013102 Bacteria 14779
104 Ga0157371_10012104 3300013102 Bacteria 6609
105 Ga0157371_10030949 3300013102 Bacteria 3857
106 Ga0157371_10078407 3300013102 Bacteria 2340
107 Ga0157371_10094458 3300013102 Bacteria 2119
108 Ga0157371_10748437 3300013102 Bacteria 734
109 Ga0157371_10915387 3300013102 Bacteria 666
110 Ga0157370_10000084 3300013104 Bacteria 104159
111 Ga0157370_10002172 3300013104 Bacteria 23929
112 Ga0157370_10023606 3300013104 Bacteria 6104
113 Ga0157370_10049416 3300013104 Bacteria 4025
114 Ga0157370_10083053 3300013104 Bacteria 3012
115 Ga0157370_10096156 3300013104 Bacteria 2779
116 Ga0157370_10121272 3300013104 Bacteria 2441
117 Ga0157370_10178676 3300013104 Bacteria 1972
118 Ga0157370_10222325 3300013104 Bacteria 1749
119 Ga0157370_10364533 3300013104 Bacteria 1332
120 Ga0157370_10465166 3300013104 Bacteria 1162
121 Ga0157370_11444768 3300013104 Bacteria 619
122 Ga0157370_11602112 3300013104 Bacteria 585
123 Ga0157369_10000023 3300013105 Bacteria 226955
124 Ga0157369_10001688 3300013105 Bacteria 26948
125 Ga0157369_10328518 3300013105 Bacteria 1589
126 Ga0157369_10762558 3300013105 Bacteria 995
127 Ga0157369_11373314 3300013105 Bacteria 719
128 Ga0157369_11868857 3300013105 Unclassified 610
129 Ga0157374_10498457 3300013296 Bacteria 1222
130 Ga0163162_10000675 3300013306 Bacteria 31705
131 Ga0163162_10133830 3300013306 Bacteria 2589
132 Ga0163162_10998812 3300013306 Bacteria 946
133 Ga0163162_11441054 3300013306 Bacteria 784
134 Ga0163162_12396548 3300013306 Bacteria 607
135 Ga0163162_12869300 3300013306 Unclassified 555
136 Ga0157372_10002228 3300013307 Bacteria 21035
137 Ga0157372_10004603 3300013307 Bacteria 14664
138 Ga0157372_10007451 3300013307 Bacteria 11640
139 Ga0157372_10012239 3300013307 Bacteria 9137
140 Ga0157372_10015721 3300013307 Bacteria 8116
141 Ga0157372_10039852 3300013307 Bacteria 5187
142 Ga0157372_10094520 3300013307 Bacteria 3404
143 Ga0157372_10529595 3300013307 Bacteria 1373
144 Ga0157372_10721732 3300013307 Bacteria 1159
145 Ga0157372_11684476 3300013307 Unclassified 730
146 Ga0157375_10523854 3300013308 Bacteria 1348
147 Ga0157375_10774243 3300013308 Bacteria 1110
148 Ga0157375_12057359 3300013308 Bacteria 679
149 Ga0182008_10000002 3300014497 Bacteria 480216
150 Ga0182008_10000112 3300014497 Bacteria 62174
151 Ga0182008_10004431 3300014497 Bacteria 8212
152 Ga0182008_10021751 3300014497 Bacteria 3293
153 Ga0182008_10087176 3300014497 Unclassified 1538
154 Ga0182008_10113001 3300014497 Bacteria 1346
155 Ga0182006_1000236 3300015261 Bacteria 52217
156 Ga0182006_1000666 3300015261 Bacteria 24108
157 Ga0182006_1002055 3300015261 Bacteria 11279
158 Ga0182006_1145081 3300015261 Bacteria 808
159 Ga0182007_10000002 3300015262 Bacteria 564661
160 Ga0182007_10007409 3300015262 Bacteria 4603
161 Ga0182007_10018782 3300015262 Bacteria 2499
162 Ga0182007_10039008 3300015262 Bacteria 1591
163 Ga0183373_1004 3300015682 Bacteria 537398
164 Ga0163161_10000893 3300017792 Bacteria 23185
165 Ga0163161_10000894 3300017792 Bacteria 23161
166 Ga0163161_10001714 3300017792 Bacteria 16064
167 Ga0163161_10010774 3300017792 Bacteria 6335
168 Ga0163161_10058418 3300017792 Bacteria 2804
169 Ga0163161_10265131 3300017792 Bacteria 1343
170 Ga0163161_10534279 3300017792 Bacteria 959
171 Ga0206351_10190117 3300020077 Bacteria 1211
172 Ga0206352_10337241 3300020078 Unclassified 562
173 Ga0206352_10805182 3300020078 Bacteria 670
174 Ga0206350_10412288 3300020080 Unclassified 702
175 Ga0206353_10082492 3300020082 Unclassified 650
176 Ga0154015_1364402 3300020610 Bacteria 540
177 Ga0213872_10464212 3300021361 Unclassified 508
178 Ga0209437_100507 3300025233 Bacteria 27709
179 Ga0207425_1000008 3300025245 Bacteria 618024
180 Ga0209129_1000040 3300025258 Bacteria 313043
181 Ga0209129_1006755 3300025258 Bacteria 3611
182 Ga0209233_1000701 3300025261 Bacteria 15748
183 Ga0209676_1000009 3300025292 Bacteria 981719
184 Ga0209025_1000020 3300025294 Bacteria 618024
185 Ga0209758_1000022 3300025297 Bacteria 618024
186 Ga0209050_1000048 3300025298 Bacteria 371553
187 Ga0209050_1032221 3300025298 Bacteria 1616
188 Ga0207647_10000135 3300025904 Bacteria 58247
189 Ga0207647_10257612 3300025904 Bacteria 1000
190 Ga0207705_10002369 3300025909 Bacteria 14570
191 Ga0207705_10030405 3300025909 Bacteria 3854
192 Ga0207705_10325801 3300025909 Bacteria 1181
193 Ga0207705_10734326 3300025909 Bacteria 767
194 Ga0207707_10012873 3300025912 Bacteria 7280
195 Ga0207695_10115330 3300025913 Bacteria 2661
196 Ga0207671_10136879 3300025914 Bacteria 1884
197 Ga0207671_10180318 3300025914 Bacteria 1643
198 Ga0207671_10909905 3300025914 Bacteria 695
199 Ga0207671_11474097 3300025914 Unclassified 526
200 Ga0207660_10012315 3300025917 Bacteria 5593
201 Ga0207660_11468117 3300025917 Unclassified 552
202 Ga0207657_10192672 3300025919 Bacteria 1643
203 Ga0207657_10408978 3300025919 Bacteria 1067
204 Ga0207652_10000887 3300025921 Bacteria 28316
205 Ga0207690_10121727 3300025932 Bacteria 1897
206 Ga0207661_10430947 3300025944 Unclassified 1199
207 Ga0207667_10005073 3300025949 Bacteria 16090
208 Ga0207640_10077605 3300025981 Bacteria 2258
209 Ga0207678_10033101 3300026067 Bacteria 4504
210 Ga0207678_10046536 3300026067 Bacteria 3752
211 Ga0207702_10006955 3300026078 Bacteria 9689
212 Ga0207702_10009280 3300026078 Bacteria 8264
213 Ga0207648_10637572 3300026089 Bacteria 984
214 Ga0207674_10045110 3300026116 Bacteria 4537
215 Ga0207674_10122080 3300026116 Bacteria 2572
216 Ga0207674_10564116 3300026116 Unclassified 1100
217 Ga0209999_1057061 3300027543 Bacteria 741
218 Ga0209983_1112379 3300027665 Bacteria 619
219 Ga0209998_10110610 3300027717 Bacteria 686
220 Ga0207428_10059691 3300027907 Bacteria 3023
221 Ga0307515_10000643 3300028794 Bacteria 80674
222 Ga0307515_10014538 3300028794 Bacteria 14575
223 Ga0307515_10024651 3300028794 Bacteria 10465
224 Ga0307515_10170593 3300028794 Bacteria 2171
225 Ga0316181_1195168 3300030744 Bacteria 921
226 Ga0307513_10354762 3300031456 Bacteria 1213
227 Ga0307513_10838271 3300031456 Bacteria 626
228 Ga0307408_102018393 3300031548 Bacteria 555
229 Ga0307516_10647421 3300031730 Bacteria 712
230 Ga0307405_10000006 3300031731 Bacteria 361477
231 Ga0307405_11120188 3300031731 Bacteria 677
232 Ga0307405_11775149 3300031731 Unclassified 548
233 Ga0307413_12047960 3300031824 Bacteria 517
234 Ga0307407_10000003 3300031903 Bacteria 271723
235 Ga0307412_10000085 3300031911 Bacteria 88692
236 Ga0307412_10923470 3300031911 Unclassified 766
237 Ga0307409_100064605 3300031995 Bacteria 2876
238 Ga0307416_100000819 3300032002 Bacteria 16274
239 Ga0307414_10000078 3300032004 Bacteria 90911
240 Ga0307414_10000510 3300032004 Bacteria 20231
241 Ga0307414_10001132 3300032004 Bacteria 13647
242 Ga0307414_10001429 3300032004 Bacteria 12403
243 Ga0307414_10101762 3300032004 Bacteria 2164
244 Ga0307414_10385866 3300032004 Bacteria 1212
245 Ga0307414_10980520 3300032004 Unclassified 777
246 Ga0307414_11186960 3300032004 Bacteria 706
247 Ga0307411_10436206 3300032005 Bacteria 1092
248 Ga0307411_10767278 3300032005 Bacteria 846
249 Ga0307507_10014221 3300033179 Bacteria 9519
250 Ga0373935_0761895 3300035692 Bacteria 714
251 Ga0395899_0004023 3300037312 Bacteria 11589
252 Ga0395899_0053655 3300037312 Bacteria 2984
253 Ga0395900_0034150 3300037418 Bacteria 5236
254 Ga0395900_0810949 3300037418 Bacteria 863
255 Ga0395900_1838074 3300037418 Bacteria 516
256 Ga0395898_0005541 3300037466 Bacteria 13617
257 Ga0395898_0045346 3300037466 Bacteria 4322
258 Ga0395905_0185335 3300037471 Bacteria 1954
259 Ga0395901_0646589 3300038443 Bacteria 1061
260 Ga0395901_0828475 3300038443 Bacteria 912
261 Ga0451791_0163352 3300041451 Unclassified 579
262 Ga0451791_0631398 3300041451 Bacteria 887
263 Ga0451793_0371445 3300041452 Bacteria 525
264 Ga0451795_0879970 3300041456 Bacteria 763
265 Ga0451849_0188467 3300041505 Bacteria 1128
266 Ga0439445_0144618 3300042004 Unclassified 690
267 Ga0450923_114421 3300042125 Bacteria 632
268 Ga0495627_051499 3300046453 Bacteria 1237
269 Ga0495627_138059 3300046453 Bacteria 683
270 Ga0495592_0205659 3300046454 Bacteria 1326
271 Ga0495629_0086686 3300046459 Bacteria 2184
272 Ga0495638_0157949 3300046460 Bacteria 1310
273 Ga0495638_0577163 3300046460 Bacteria 555
274 Ga0495651_0224811 3300046462 Bacteria 1297
275 Ga0495650_0000225 3300046471 Bacteria 117898
276 Ga0495650_0075761 3300046471 Bacteria 1309
277 Ga0495585_0000074 3300046492 Bacteria 102651
278 Ga0495585_0000323 3300046492 Bacteria 47094
279 Ga0495585_0157516 3300046492 Bacteria 1180
280 Ga0495583_0035693 3300046506 Bacteria 2371
281 Ga0495583_0167281 3300046506 Bacteria 905
282 Ga0495606_0000074 3300046507 Bacteria 170848
283 Ga0495606_0033701 3300046507 Bacteria 3529
284 Ga0495606_0051265 3300046507 Bacteria 2693
285 Ga0495606_0053134 3300046507 Bacteria 2630
286 Ga0495606_0346763 3300046507 Bacteria 789
287 Ga0495606_0377721 3300046507 Bacteria 744
288 Ga0495610_0000188 3300046512 Bacteria 69214
289 Ga0495610_0000499 3300046512 Bacteria 40154
290 Ga0495610_0022856 3300046512 Bacteria 3410
291 Ga0495616_0000806 3300046513 Bacteria 22928
292 Ga0495616_0002088 3300046513 Bacteria 13429
293 Ga0495628_0411986 3300046516 Bacteria 986
294 Ga0495648_0006718 3300046524 Bacteria 9305
295 Ga0495652_0261593 3300046529 Bacteria 1277
296 Ga0495609_0008096 3300046538 Bacteria 5178
297 Ga0495609_0367011 3300046538 Bacteria 579
298 Ga0495633_0000006 3300046558 Bacteria 326774
299 Ga0495633_0005434 3300046558 Bacteria 7785
300 Ga0495633_0087440 3300046558 Bacteria 1449
301 Ga0495668_0000011 3300046616 Bacteria 472186
302 Ga0495625_0000067 3300046660 Bacteria 171483
303 Ga0495625_0000462 3300046660 Bacteria 60985
304 Ga0495625_0000486 3300046660 Bacteria 59478
305 Ga0495625_0007386 3300046660 Bacteria 9575
306 Ga0495625_0028648 3300046660 Bacteria 4175
307 Ga0495625_0410232 3300046660 Bacteria 844
308 Ga0495661_0001183 3300046665 Bacteria 22653
309 Ga0495661_0108754 3300046665 Bacteria 1548
310 Ga0495661_0157013 3300046665 Bacteria 1224
311 Ga0495658_0126432 3300046683 Bacteria 1551
312 Ga0495671_0116509 3300046692 Bacteria 1304
313 Ga0495649_0000054 3300046694 Bacteria 107048
314 Ga0495660_0002682 3300046810 Bacteria 11256
315 Ga0495687_001083 3300047443 Bacteria 26756
316 Ga0495679_047885 3300047446 Bacteria 1295
317 Ga0495673_0163694 3300047469 Bacteria 852
318 Ga0495681_0049902 3300047470 Bacteria 1976
319 Ga0495686_0001571 3300047472 Bacteria 24245
320 Ga0495686_0004631 3300047472 Bacteria 11183
321 Ga0495686_0035242 3300047472 Bacteria 3218
322 Ga0495614_0152461 3300048089 Bacteria 1031
323 Ga0496114_0373770 3300048917 Bacteria 1262
324 Ga0496115_0192481 3300048918 Bacteria 1685
325 Ga0496122_0000837 3300048925 Bacteria 58147
326 Ga0496123_0006634 3300048926 Bacteria 11171
327 Ga0496125_0278886 3300048928 Bacteria 1037
328 Ga0496125_0579323 3300048928 Unclassified 617
329 Ga0495678_008557 3300049459 Bacteria 5149
330 Ga0495682_0019380 3300049460 Bacteria 2559
331 Ga0501257_160679 3300049686 Bacteria 625
332 Ga0501241_004551 3300049758 Bacteria 2597
333 Ga0501241_006587 3300049758 Bacteria 2136
334 nmdc:mga0k408_14434_c1 3300050493 Bacteria 4353
335 nmdc:mga0k408_22_c2 3300050493 Bacteria 93033
336 nmdc:mga0qj67_959813_c1 3300050509 Bacteria 672
337 nmdc:mga08y16_7679_c1 3300050511 Bacteria 8901
338 Ga0500635_0000482 3300053080 Bacteria 11190
339 Ga0500583_0093764 3300053092 Bacteria 1464
340 Ga0500651_0000312 3300053093 Bacteria 27929
341 Ga0500562_007087 3300053108 Bacteria 2828
342 Ga0500614_007798 3300053123 Bacteria 2262
343 Ga0500618_000148 3300053125 Bacteria 58264
344 Ga0500618_011470 3300053125 Bacteria 2349
345 Ga0500561_0048854 3300053137 Bacteria 1147
346 Ga0500564_111404 3300053138 Bacteria 1201
347 Ga0500568_0141927 3300053139 Bacteria 890
348 Ga0500588_0336892 3300053146 Unclassified 573
349 Ga0500604_0000119 3300053151 Bacteria 23992
350 Ga0500616_0027585 3300053153 Unclassified 3134
351 Ga0500622_0000075 3300053156 Bacteria 109513
352 Ga0500622_0000435 3300053156 Bacteria 39609
353 Ga0500622_0000891 3300053156 Bacteria 25423
354 Ga0500622_0047249 3300053156 Bacteria 2224
355 Ga0500624_000813 3300053157 Bacteria 7221
356 Ga0500627_0051744 3300053158 Unclassified 1792
357 Ga0500634_0220369 3300053161 Bacteria 815
358 Ga0587072_080485 3300059643 Bacteria 703

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047469 Ga0495673_0163694 Ga0495673_0163694_22_315 97
2 3300025258 Ga0209129_1006755 Ga0209129_10067553 98
3 3300013307 Ga0157372_10039852 Ga0157372_100398528 105
4 iso_pu_bacteria 2599185184 2599479988 105
5 iso_pu_bacteria 2852623160 2852625715 105
6 iso_pu_bacteria 2919437846 2919440169 105
7 iso_pu_bacteria 2928078545 2928081119 105
8 iso_pu_bacteria 2928147474 2928152460 105
9 iso_pu_bacteria 2932082852 2932087769 105
10 iso_pu_bacteria 2585427687 2586210619 106
11 iso_pu_bacteria 2738541283 2738758882 106
12 iso_pu_bacteria 2738541284 2738762028 106
13 iso_pu_bacteria 2738541302 2738854357 106
14 iso_pu_bacteria 2738543023 2739301997 106
15 iso_pu_bacteria 2739367651 2739587897 106
16 iso_pu_bacteria 2739367656 2739617466 106
17 iso_pu_bacteria 2775506987 2776615327 106
18 iso_pu_bacteria 2818991437 2819545783 106
19 iso_pu_bacteria 2842722452 2842724327 106
20 iso_pu_bacteria 2842909656 2842913538 106
21 iso_pu_bacteria 2849281842 2849282650 106
22 iso_pu_bacteria 2852627209 2852628953 106
23 iso_pu_bacteria 2857627736 2857630405 106
24 iso_pu_bacteria 2904445276 2904448455 106
25 iso_pu_bacteria 2919186247 2919189004 106
26 iso_pu_bacteria 2939664404 2939666841 106
27 iso_pu_bacteria 2945997725 2945998838 106
28 iso_pu_bacteria 2954016120 2954021286 106
29 3300005327 Ga0070658_10084782 Ga0070658_100847822 107
30 3300005336 Ga0070680_101373635 Ga0070680_1013736351 107
31 3300005345 Ga0070692_10399109 Ga0070692_103991091 107
32 3300005455 Ga0070663_100578458 Ga0070663_1005784582 107
33 3300005530 Ga0070679_101305008 Ga0070679_1013050081 107
34 3300005563 Ga0068855_101548569 Ga0068855_1015485692 107
35 3300013100 Ga0157373_10054096 Ga0157373_100540961 107
36 3300013102 Ga0157371_10094458 Ga0157371_100944583 107
37 3300013104 Ga0157370_10465166 Ga0157370_104651662 107
38 3300013105 Ga0157369_11868857 Ga0157369_118688571 107
39 3300013307 Ga0157372_11684476 Ga0157372_116844761 107
40 3300020078 Ga0206352_10337241 Ga0206352_103372411 107
41 3300020080 Ga0206350_10412288 Ga0206350_104122881 107
42 3300025909 Ga0207705_10734326 Ga0207705_107343261 107
43 3300025917 Ga0207660_11468117 Ga0207660_114681171 107
44 3300026067 Ga0207678_10046536 Ga0207678_100465362 107
45 3300037312 Ga0395899_0053655 Ga0395899_0053655_2418_2747 107
46 3300037418 Ga0395900_0810949 Ga0395900_0810949_362_691 107
47 3300037418 Ga0395900_1838074 Ga0395900_1838074_111_440 107
48 3300037466 Ga0395898_0045346 Ga0395898_0045346_1311_1640 107
49 3300004803 Ga0058862_10825505 Ga0058862_108255052 108
50 3300005327 Ga0070658_10020598 Ga0070658_100205984 108
51 3300005327 Ga0070658_10100385 Ga0070658_101003852 108
52 3300005329 Ga0070683_100162959 Ga0070683_1001629592 108
53 3300005336 Ga0070680_100008098 Ga0070680_1000080984 108
54 3300005339 Ga0070660_100194832 Ga0070660_1001948322 108
55 3300005354 Ga0070675_100799079 Ga0070675_1007990791 108
56 3300005455 Ga0070663_100017969 Ga0070663_1000179695 108
57 3300005458 Ga0070681_10027266 Ga0070681_100272662 108
58 3300005530 Ga0070679_100073738 Ga0070679_1000737384 108
59 3300005563 Ga0068855_100041312 Ga0068855_1000413122 108
60 3300005578 Ga0068854_101153458 Ga0068854_1011534582 108
61 3300005614 Ga0068856_100040266 Ga0068856_1000402662 108
62 3300013102 Ga0157371_10001204 Ga0157371_1000120412 108
63 3300013102 Ga0157371_10003294 Ga0157371_100032947 108
64 3300013102 Ga0157371_10915387 Ga0157371_109153871 108
65 3300013104 Ga0157370_11444768 Ga0157370_114447681 108
66 3300013105 Ga0157369_10001688 Ga0157369_100016886 108
67 3300013307 Ga0157372_10012239 Ga0157372_100122392 108
68 3300013307 Ga0157372_10015721 Ga0157372_100157211 108
69 3300013307 Ga0157372_10721732 Ga0157372_107217322 108
70 3300025909 Ga0207705_10002369 Ga0207705_100023697 108
71 3300025909 Ga0207705_10030405 Ga0207705_100304052 108
72 3300025912 Ga0207707_10012873 Ga0207707_100128736 108
73 3300025917 Ga0207660_10012315 Ga0207660_100123155 108
74 3300025919 Ga0207657_10192672 Ga0207657_101926722 108
75 3300025921 Ga0207652_10000887 Ga0207652_1000088712 108
76 3300025944 Ga0207661_10430947 Ga0207661_104309472 108
77 3300025949 Ga0207667_10005073 Ga0207667_100050738 108
78 3300026067 Ga0207678_10033101 Ga0207678_100331015 108
79 3300026078 Ga0207702_10009280 Ga0207702_100092806 108
80 3300026089 Ga0207648_10637572 Ga0207648_106375722 108
81 3300031456 Ga0307513_10354762 Ga0307513_103547623 108
82 3300032004 Ga0307414_10000078 Ga0307414_1000007826 108
83 3300037312 Ga0395899_0004023 Ga0395899_0004023_4903_5238 108
84 3300037418 Ga0395900_0034150 Ga0395900_0034150_2391_2726 108
85 3300037466 Ga0395898_0005541 Ga0395898_0005541_7090_7425 108
86 3300037471 Ga0395905_0185335 Ga0395905_0185335_838_1173 108
87 3300038443 Ga0395901_0646589 Ga0395901_0646589_79_414 108
88 3300049686 Ga0501257_160679 Ga0501257_160679_79_414 108
89 3300001904 JGI24736J21556_1001405 JGI24736J21556_10014054 109
90 3300001979 JGI24740J21852_10041403 JGI24740J21852_100414033 109
91 3300001989 JGI24739J22299_10199657 JGI24739J22299_101996571 109
92 3300001989 JGI24739J22299_10199769 JGI24739J22299_101997691 109
93 3300001990 JGI24737J22298_10000077 JGI24737J22298_100000775 109
94 3300001990 JGI24737J22298_10056968 JGI24737J22298_100569682 109
95 3300001990 JGI24737J22298_10137105 JGI24737J22298_101371051 109
96 3300002067 JGI24735J21928_10000005 JGI24735J21928_10000005123 109
97 3300002067 JGI24735J21928_10023968 JGI24735J21928_100239682 109
98 3300002737 JGI25162J39368_1000563 JGI25162J39368_10005639 109
99 3300003316 rootH1_10023440 rootH1_100234402 109
100 3300003320 rootH2_10194391 rootH2_101943912 109
101 3300003322 rootL2_10021894 rootL2_100218942 109
102 3300003323 rootH1_10152501 rootH1_101525013 109
103 3300003323 rootH1_10327782 rootH1_103277822 109
104 3300005288 Ga0065714_10004265 Ga0065714_100042655 109
105 3300005288 Ga0065714_10155781 Ga0065714_101557812 109
106 3300005327 Ga0070658_10168420 Ga0070658_101684202 109
107 3300005339 Ga0070660_100256435 Ga0070660_1002564351 109
108 3300005356 Ga0070674_100317739 Ga0070674_1003177392 109
109 3300005366 Ga0070659_100002565 Ga0070659_10000256514 109
110 3300005539 Ga0068853_100045019 Ga0068853_1000450194 109
111 3300005577 Ga0068857_100059357 Ga0068857_1000593574 109
112 3300005577 Ga0068857_100138715 Ga0068857_1001387152 109
113 3300006195 Ga0075366_10005756 Ga0075366_1000575611 109
114 3300006195 Ga0075366_10006727 Ga0075366_100067275 109
115 3300006237 Ga0097621_100664543 Ga0097621_1006645432 109
116 3300009093 Ga0105240_10465962 Ga0105240_104659622 109
117 3300009545 Ga0105237_10195948 Ga0105237_101959483 109
118 3300009545 Ga0105237_10229458 Ga0105237_102294581 109
119 3300009545 Ga0105237_10246298 Ga0105237_102462981 109
120 3300009545 Ga0105237_10295547 Ga0105237_102955472 109
121 3300010375 Ga0105239_10000008 Ga0105239_10000008167 109
122 3300010375 Ga0105239_10000446 Ga0105239_1000044659 109
123 3300010375 Ga0105239_10009159 Ga0105239_100091597 109
124 3300010375 Ga0105239_10018812 Ga0105239_100188128 109
125 3300010375 Ga0105239_11315001 Ga0105239_113150011 109
126 3300013100 Ga0157373_10000091 Ga0157373_1000009154 109
127 3300013100 Ga0157373_10003653 Ga0157373_1000365312 109
128 3300013102 Ga0157371_10000155 Ga0157371_1000015572 109
129 3300013102 Ga0157371_10012104 Ga0157371_100121043 109
130 3300013104 Ga0157370_10121272 Ga0157370_101212724 109
131 3300013104 Ga0157370_10364533 Ga0157370_103645332 109
132 3300013104 Ga0157370_11602112 Ga0157370_116021121 109
133 3300013105 Ga0157369_10328518 Ga0157369_103285183 109
134 3300013105 Ga0157369_10762558 Ga0157369_107625582 109
135 3300013105 Ga0157369_11373314 Ga0157369_113733141 109
136 3300013306 Ga0163162_10133830 Ga0163162_101338302 109
137 3300013306 Ga0163162_10998812 Ga0163162_109988122 109
138 3300013306 Ga0163162_11441054 Ga0163162_114410542 109
139 3300013306 Ga0163162_12869300 Ga0163162_128693002 109
140 3300013307 Ga0157372_10002228 Ga0157372_100022289 109
141 3300013307 Ga0157372_10004603 Ga0157372_100046034 109
142 3300013307 Ga0157372_10007451 Ga0157372_100074516 109
143 3300013307 Ga0157372_10094520 Ga0157372_100945203 109
144 3300017792 Ga0163161_10010774 Ga0163161_100107745 109
145 3300020077 Ga0206351_10190117 Ga0206351_101901171 109
146 3300020078 Ga0206352_10805182 Ga0206352_108051822 109
147 3300020082 Ga0206353_10082492 Ga0206353_100824921 109
148 3300020610 Ga0154015_1364402 Ga0154015_13644021 109
149 3300025233 Ga0209437_100507 Ga0209437_10050726 109
150 3300025261 Ga0209233_1000701 Ga0209233_100070114 109
151 3300025904 Ga0207647_10000135 Ga0207647_1000013526 109
152 3300025904 Ga0207647_10257612 Ga0207647_102576122 109
153 3300025909 Ga0207705_10325801 Ga0207705_103258011 109
154 3300025913 Ga0207695_10115330 Ga0207695_101153304 109
155 3300025914 Ga0207671_10136879 Ga0207671_101368791 109
156 3300025914 Ga0207671_10909905 Ga0207671_109099052 109
157 3300025914 Ga0207671_11474097 Ga0207671_114740971 109
158 3300025919 Ga0207657_10408978 Ga0207657_104089781 109
159 3300025932 Ga0207690_10121727 Ga0207690_101217272 109
160 3300025981 Ga0207640_10077605 Ga0207640_100776053 109
161 3300026116 Ga0207674_10045110 Ga0207674_100451104 109
162 3300026116 Ga0207674_10122080 Ga0207674_101220803 109
163 3300028794 Ga0307515_10000643 Ga0307515_1000064369 109
164 3300028794 Ga0307515_10024651 Ga0307515_100246518 109
165 3300028794 Ga0307515_10170593 Ga0307515_101705933 109
166 3300031730 Ga0307516_10647421 Ga0307516_106474211 109
167 3300033179 Ga0307507_10014221 Ga0307507_100142219 109
168 3300035692 Ga0373935_0761895 Ga0373935_0761895_89_427 109
169 3300038443 Ga0395901_0828475 Ga0395901_0828475_124_453 109
170 3300041452 Ga0451793_0371445 Ga0451793_0371445_51_380 109
171 3300041456 Ga0451795_0879970 Ga0451795_0879970_54_383 109
172 3300041505 Ga0451849_0188467 Ga0451849_0188467_291_620 109
173 3300046453 Ga0495627_051499 Ga0495627_051499_737_1066 109
174 3300046454 Ga0495592_0205659 Ga0495592_0205659_124_453 109
175 3300046459 Ga0495629_0086686 Ga0495629_0086686_187_516 109
176 3300046460 Ga0495638_0157949 Ga0495638_0157949_811_1140 109
177 3300046460 Ga0495638_0577163 Ga0495638_0577163_170_499 109
178 3300046462 Ga0495651_0224811 Ga0495651_0224811_397_726 109
179 3300046471 Ga0495650_0000225 Ga0495650_0000225_16225_16554 109
180 3300046471 Ga0495650_0075761 Ga0495650_0075761_687_1016 109
181 3300046492 Ga0495585_0000074 Ga0495585_0000074_37707_38036 109
182 3300046492 Ga0495585_0000323 Ga0495585_0000323_31006_31335 109
183 3300046492 Ga0495585_0157516 Ga0495585_0157516_603_932 109
184 3300046506 Ga0495583_0035693 Ga0495583_0035693_1614_1943 109
185 3300046507 Ga0495606_0000074 Ga0495606_0000074_143129_143458 109
186 3300046507 Ga0495606_0033701 Ga0495606_0033701_2676_3005 109
187 3300046507 Ga0495606_0051265 Ga0495606_0051265_2065_2394 109
188 3300046507 Ga0495606_0053134 Ga0495606_0053134_2150_2479 109
189 3300046507 Ga0495606_0377721 Ga0495606_0377721_236_565 109
190 3300046512 Ga0495610_0022856 Ga0495610_0022856_2617_2946 109
191 3300046513 Ga0495616_0000806 Ga0495616_0000806_10976_11305 109
192 3300046513 Ga0495616_0002088 Ga0495616_0002088_12823_13152 109
193 3300046516 Ga0495628_0411986 Ga0495628_0411986_473_802 109
194 3300046524 Ga0495648_0006718 Ga0495648_0006718_3575_3904 109
195 3300046529 Ga0495652_0261593 Ga0495652_0261593_845_1174 109
196 3300046538 Ga0495609_0008096 Ga0495609_0008096_2255_2584 109
197 3300046538 Ga0495609_0367011 Ga0495609_0367011_28_357 109
198 3300046558 Ga0495633_0000006 Ga0495633_0000006_245230_245559 109
199 3300046558 Ga0495633_0005434 Ga0495633_0005434_6667_6996 109
200 3300046616 Ga0495668_0000011 Ga0495668_0000011_220513_220842 109
201 3300046660 Ga0495625_0000067 Ga0495625_0000067_80211_80540 109
202 3300046660 Ga0495625_0000462 Ga0495625_0000462_48034_48363 109
203 3300046660 Ga0495625_0000486 Ga0495625_0000486_4740_5069 109
204 3300046660 Ga0495625_0007386 Ga0495625_0007386_7914_8243 109
205 3300046660 Ga0495625_0028648 Ga0495625_0028648_306_635 109
206 3300046660 Ga0495625_0410232 Ga0495625_0410232_50_379 109
207 3300046665 Ga0495661_0108754 Ga0495661_0108754_822_1151 109
208 3300046683 Ga0495658_0126432 Ga0495658_0126432_497_826 109
209 3300046692 Ga0495671_0116509 Ga0495671_0116509_684_1013 109
210 3300046694 Ga0495649_0000054 Ga0495649_0000054_80222_80551 109
211 3300046810 Ga0495660_0002682 Ga0495660_0002682_8439_8768 109
212 3300047443 Ga0495687_001083 Ga0495687_001083_17271_17600 109
213 3300047446 Ga0495679_047885 Ga0495679_047885_944_1273 109
214 3300047472 Ga0495686_0001571 Ga0495686_0001571_4812_5141 109
215 3300047472 Ga0495686_0035242 Ga0495686_0035242_2231_2560 109
216 3300048089 Ga0495614_0152461 Ga0495614_0152461_19_348 109
217 3300049459 Ga0495678_008557 Ga0495678_008557_3550_3879 109
218 3300049460 Ga0495682_0019380 Ga0495682_0019380_946_1275 109
219 3300050493 nmdc:mga0k408_14434_c1 nmdc:mga0k408_14434_c1_1325_1654 109
220 3300050493 nmdc:mga0k408_22_c2 nmdc:mga0k408_22_c2_21668_21997 109
221 3300053080 Ga0500635_0000482 Ga0500635_0000482_5456_5785 109
222 3300053123 Ga0500614_007798 Ga0500614_007798_40_369 109
223 3300053125 Ga0500618_000148 Ga0500618_000148_8472_8801 109
224 3300053125 Ga0500618_011470 Ga0500618_011470_810_1139 109
225 3300053137 Ga0500561_0048854 Ga0500561_0048854_185_514 109
226 3300053138 Ga0500564_111404 Ga0500564_111404_669_998 109
227 3300053156 Ga0500622_0000891 Ga0500622_0000891_9240_9569 109
228 3300053156 Ga0500622_0047249 Ga0500622_0047249_109_438 109
229 3300053157 Ga0500624_000813 Ga0500624_000813_673_1002 109
230 3300059643 Ga0587072_080485 Ga0587072_080485_149_478 109
231 2162886007 SwRhRL2b_contig_1363481 SwRhRL2b_0621.00000310 110
232 2162886007 SwRhRL2b_contig_3392341 SwRhRL2b_0769.00004770 110
233 3300002773 JGI25152J39213_1000006 JGI25152J39213_100000669 110
234 3300002774 JGI25150J39212_1000005 JGI25150J39212_1000005164 110
235 3300003187 JGI25151J46595_10000004 JGI25151J46595_10000004332 110
236 3300003215 JGI25153J46596_10000004 JGI25153J46596_10000004332 110
237 3300003322 rootL2_10103955 rootL2_101039552 110
238 3300003323 rootH1_10008582 rootH1_10008582136 110
239 3300003323 rootH1_10100747 rootH1_101007476 110
240 3300003323 rootH1_10127442 rootH1_101274423 110
241 3300003323 rootH1_10364027 rootH1_103640272 110
242 3300003781 Ga0055536_1000004 Ga0055536_100000452 110
243 3300003791 Ga0055530_10001269 Ga0055530_1000126912 110
244 3300004625 Ga0055543_1050969 Ga0055543_10509692 110
245 3300005262 Ga0065165_1000470 Ga0065165_100047021 110
246 3300005288 Ga0065714_10064689 Ga0065714_100646892 110
247 3300005288 Ga0065714_10066111 Ga0065714_100661116 110
248 3300005288 Ga0065714_10072693 Ga0065714_100726932 110
249 3300005288 Ga0065714_10120522 Ga0065714_101205221 110
250 3300005288 Ga0065714_10136200 Ga0065714_101362002 110
251 3300005288 Ga0065714_10155695 Ga0065714_101556952 110
252 3300005288 Ga0065714_10207260 Ga0065714_102072601 110
253 3300005289 Ga0065704_10073975 Ga0065704_100739751 110
254 3300005289 Ga0065704_10136808 Ga0065704_101368081 110
255 3300005289 Ga0065704_10858711 Ga0065704_108587111 110
256 3300005293 Ga0065715_10118966 Ga0065715_101189664 110
257 3300005356 Ga0070674_101647069 Ga0070674_1016470692 110
258 3300005436 Ga0070713_100470894 Ga0070713_1004708942 110
259 3300005544 Ga0070686_100522362 Ga0070686_1005223622 110
260 3300005577 Ga0068857_100185597 Ga0068857_1001855972 110
261 3300005614 Ga0068856_100012333 Ga0068856_1000123333 110
262 3300006844 Ga0075428_100013786 Ga0075428_1000137867 110
263 3300006846 Ga0075430_100684231 Ga0075430_1006842312 110
264 3300009011 Ga0105251_10426558 Ga0105251_104265581 110
265 3300009094 Ga0111539_10002481 Ga0111539_1000248110 110
266 3300009545 Ga0105237_10217510 Ga0105237_102175103 110
267 3300013100 Ga0157373_10000424 Ga0157373_1000042431 110
268 3300013100 Ga0157373_10018982 Ga0157373_100189826 110
269 3300013100 Ga0157373_10121334 Ga0157373_101213342 110
270 3300013100 Ga0157373_10187902 Ga0157373_101879022 110
271 3300013102 Ga0157371_10000241 Ga0157371_100002413 110
272 3300013102 Ga0157371_10030949 Ga0157371_100309494 110
273 3300013102 Ga0157371_10078407 Ga0157371_100784073 110
274 3300013102 Ga0157371_10748437 Ga0157371_107484371 110
275 3300013104 Ga0157370_10000084 Ga0157370_1000008460 110
276 3300013104 Ga0157370_10002172 Ga0157370_100021722 110
277 3300013104 Ga0157370_10023606 Ga0157370_100236061 110
278 3300013104 Ga0157370_10049416 Ga0157370_100494161 110
279 3300013104 Ga0157370_10083053 Ga0157370_100830532 110
280 3300013104 Ga0157370_10096156 Ga0157370_100961562 110
281 3300013104 Ga0157370_10178676 Ga0157370_101786764 110
282 3300013104 Ga0157370_10222325 Ga0157370_102223252 110
283 3300013105 Ga0157369_10000023 Ga0157369_1000002353 110
284 3300013296 Ga0157374_10498457 Ga0157374_104984571 110
285 3300013306 Ga0163162_10000675 Ga0163162_1000067511 110
286 3300013306 Ga0163162_12396548 Ga0163162_123965481 110
287 3300013307 Ga0157372_10529595 Ga0157372_105295952 110
288 3300013308 Ga0157375_10523854 Ga0157375_105238541 110
289 3300013308 Ga0157375_10774243 Ga0157375_107742431 110
290 3300013308 Ga0157375_12057359 Ga0157375_120573591 110
291 3300014497 Ga0182008_10000002 Ga0182008_10000002363 110
292 3300014497 Ga0182008_10000112 Ga0182008_1000011227 110
293 3300014497 Ga0182008_10004431 Ga0182008_100044312 110
294 3300014497 Ga0182008_10021751 Ga0182008_100217515 110
295 3300014497 Ga0182008_10087176 Ga0182008_100871762 110
296 3300014497 Ga0182008_10113001 Ga0182008_101130012 110
297 3300015261 Ga0182006_1000236 Ga0182006_100023614 110
298 3300015261 Ga0182006_1000666 Ga0182006_10006662 110
299 3300015261 Ga0182006_1002055 Ga0182006_10020555 110
300 3300015261 Ga0182006_1145081 Ga0182006_11450811 110
301 3300015262 Ga0182007_10000002 Ga0182007_10000002482 110
302 3300015262 Ga0182007_10007409 Ga0182007_100074097 110
303 3300015262 Ga0182007_10018782 Ga0182007_100187824 110
304 3300015262 Ga0182007_10039008 Ga0182007_100390082 110
305 3300015682 Ga0183373_1004 Ga0183373_100424 110
306 3300017792 Ga0163161_10000893 Ga0163161_1000089312 110
307 3300017792 Ga0163161_10000894 Ga0163161_1000089418 110
308 3300017792 Ga0163161_10001714 Ga0163161_100017142 110
309 3300017792 Ga0163161_10058418 Ga0163161_100584182 110
310 3300017792 Ga0163161_10265131 Ga0163161_102651312 110
311 3300017792 Ga0163161_10534279 Ga0163161_105342792 110
312 3300021361 Ga0213872_10464212 Ga0213872_104642121 110
313 3300025245 Ga0207425_1000008 Ga0207425_1000008106 110
314 3300025258 Ga0209129_1000040 Ga0209129_1000040159 110
315 3300025292 Ga0209676_1000009 Ga0209676_1000009501 110
316 3300025294 Ga0209025_1000020 Ga0209025_1000020106 110
317 3300025297 Ga0209758_1000022 Ga0209758_1000022106 110
318 3300025298 Ga0209050_1000048 Ga0209050_1000048297 110
319 3300025298 Ga0209050_1032221 Ga0209050_10322212 110
320 3300025914 Ga0207671_10180318 Ga0207671_101803181 110
321 3300026078 Ga0207702_10006955 Ga0207702_100069553 110
322 3300026116 Ga0207674_10564116 Ga0207674_105641163 110
323 3300027543 Ga0209999_1057061 Ga0209999_10570612 110
324 3300027665 Ga0209983_1112379 Ga0209983_11123791 110
325 3300027717 Ga0209998_10110610 Ga0209998_101106102 110
326 3300027907 Ga0207428_10059691 Ga0207428_100596912 110
327 3300028794 Ga0307515_10014538 Ga0307515_1001453810 110
328 3300030744 Ga0316181_1195168 Ga0316181_11951682 110
329 3300031456 Ga0307513_10838271 Ga0307513_108382711 110
330 3300031548 Ga0307408_102018393 Ga0307408_1020183932 110
331 3300031731 Ga0307405_10000006 Ga0307405_1000000613 110
332 3300031731 Ga0307405_11120188 Ga0307405_111201882 110
333 3300031731 Ga0307405_11775149 Ga0307405_117751492 110
334 3300031824 Ga0307413_12047960 Ga0307413_120479601 110
335 3300031903 Ga0307407_10000003 Ga0307407_10000003236 110
336 3300031911 Ga0307412_10000085 Ga0307412_1000008563 110
337 3300031911 Ga0307412_10923470 Ga0307412_109234701 110
338 3300031995 Ga0307409_100064605 Ga0307409_1000646051 110
339 3300032002 Ga0307416_100000819 Ga0307416_10000081911 110
340 3300032004 Ga0307414_10000510 Ga0307414_100005109 110
341 3300032004 Ga0307414_10001132 Ga0307414_1000113212 110
342 3300032004 Ga0307414_10001429 Ga0307414_100014298 110
343 3300032004 Ga0307414_10101762 Ga0307414_101017624 110
344 3300032004 Ga0307414_10385866 Ga0307414_103858663 110
345 3300032004 Ga0307414_10980520 Ga0307414_109805203 110
346 3300032004 Ga0307414_11186960 Ga0307414_111869601 110
347 3300032005 Ga0307411_10436206 Ga0307411_104362061 110
348 3300032005 Ga0307411_10767278 Ga0307411_107672781 110
349 3300041451 Ga0451791_0163352 Ga0451791_0163352_91_435 110
350 3300041451 Ga0451791_0631398 Ga0451791_0631398_341_673 110
351 3300042004 Ga0439445_0144618 Ga0439445_0144618_316_657 110
352 3300042125 Ga0450923_114421 Ga0450923_114421_16_375 110
353 3300046453 Ga0495627_138059 Ga0495627_138059_43_375 110
354 3300046506 Ga0495583_0167281 Ga0495583_0167281_505_837 110
355 3300046507 Ga0495606_0346763 Ga0495606_0346763_158_490 110
356 3300046512 Ga0495610_0000188 Ga0495610_0000188_14264_14596 110
357 3300046512 Ga0495610_0000499 Ga0495610_0000499_11863_12195 110
358 3300046558 Ga0495633_0087440 Ga0495633_0087440_119_451 110
359 3300046665 Ga0495661_0001183 Ga0495661_0001183_20010_20342 110
360 3300046665 Ga0495661_0157013 Ga0495661_0157013_844_1176 110
361 3300047470 Ga0495681_0049902 Ga0495681_0049902_1456_1788 110
362 3300047472 Ga0495686_0004631 Ga0495686_0004631_7915_8250 110
363 3300048917 Ga0496114_0373770 Ga0496114_0373770_642_977 110
364 3300048918 Ga0496115_0192481 Ga0496115_0192481_77_412 110
365 3300048925 Ga0496122_0000837 Ga0496122_0000837_20457_20789 110
366 3300048926 Ga0496123_0006634 Ga0496123_0006634_7088_7420 110
367 3300048928 Ga0496125_0278886 Ga0496125_0278886_488_820 110
368 3300048928 Ga0496125_0579323 Ga0496125_0579323_230_562 110
369 3300049758 Ga0501241_004551 Ga0501241_004551_1072_1410 110
370 3300049758 Ga0501241_006587 Ga0501241_006587_157_489 110
371 3300050509 nmdc:mga0qj67_959813_c1 nmdc:mga0qj67_959813_c1_17_367 110
372 3300050511 nmdc:mga08y16_7679_c1 nmdc:mga08y16_7679_c1_1549_1926 110
373 3300053092 Ga0500583_0093764 Ga0500583_0093764_254_598 110
374 3300053093 Ga0500651_0000312 Ga0500651_0000312_17343_17675 110
375 3300053108 Ga0500562_007087 Ga0500562_007087_1713_2057 110
376 3300053139 Ga0500568_0141927 Ga0500568_0141927_25_357 110
377 3300053146 Ga0500588_0336892 Ga0500588_0336892_184_525 110
378 3300053151 Ga0500604_0000119 Ga0500604_0000119_8018_8362 110
379 3300053153 Ga0500616_0027585 Ga0500616_0027585_2774_3118 110
380 3300053156 Ga0500622_0000075 Ga0500622_0000075_13352_13696 110
381 3300053156 Ga0500622_0000435 Ga0500622_0000435_25883_26227 110
382 3300053158 Ga0500627_0051744 Ga0500627_0051744_33_377 110
383 3300053161 Ga0500634_0220369 Ga0500634_0220369_181_513 110

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11009

BrxC

Monothiol bacilliredoxin BrxC

5

119

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
3iv4-assembly1.cif.gz_A a putative oxidoreductase with a thioredoxin fold 0.8786 5 106
2oe3-assembly1.cif.gz_A error: ('connection aborted.', connectionreseterror(104, 'connection reset by peer')) 0.8144 3 109
4dss-assembly1.cif.gz_B crystal structure of peroxiredoxin ahp1 from saccharomyces cerevisiae in complex with thioredoxin trx2 0.8102 2 109
5ykw-assembly1.cif.gz_A structural basis of the thiol resolving mechanism in yeast mitochondrial 1-cys peroxiredoxin via glutathione/thioredoxin systems 0.8058 3 109
2voc-assembly1.cif.gz_A thioredoxin a active site mutants form mixed disulfide dimers that resemble enzyme-substrate reaction intermediate 0.8043 2 109
ID Description Score Start End Superfamily
af_Q2G066_1_106_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8923 2 106 3.40.30.10
af_Q2G066_1_106_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8615 2 106 3.40.30.10
3ul3B01 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8295 20 109 3.40.30.10
af_Q2FV89_2_105_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8269 4 109 3.40.30.10
af_A0A0R0K134_277_390_3.40.30.10 Alpha Beta;3-Layer(aba) Sandwich;Glutaredoxin;Glutaredoxin 0.8186 10 109 3.40.30.10
ID Description Score Start End GO Terms
AF-A0A1I0TG39-F1-model_v4 Bacillithiol system protein YtxJ 0.993 1 110
AF-A0A2A2S0J8-F1-model_v4 Thioredoxin family protein 0.9877 1 108
AF-A0A1I0TG39-F1-model_v4 Bacillithiol system protein YtxJ 0.984 1 110
AF-A0A2T5J4S9-F1-model_v4 Bacillithiol system protein YtxJ 0.9822 1 108
AF-A0A2A2S0J8-F1-model_v4 Thioredoxin family protein 0.9699 1 108

Feature Viewer

pLDDT pTM Quality
96.52 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map