F429541

General Info

Members Datasets Scaffolds Average Seq Length
383 202 766 252

Family's Representative Sequence

Representative Sequence 3300005985|Ga0081539_10008126|Ga0081539_100081267
Length 268
Sequence MSPLLTADLESRCDLLRSLHRPGAPLLLPNAWDVATARAVVAAGFPVVATTSGGVAGALGYEDHEGAPADEMLAAAARIARGVDVPVTVDAEAGYGMEPAELVAALRAAGAAGCNLEDTDHAAGRLREPDRHAEWLRAVRQAASEEGYGIVINARVDVFVGPFFAGGGPGTQDELVPEALRRANAYIEAGVDCVYPILLWESDALRRFAAEVRGPWNAVRMPQAASLAELSALGVARVSWGPLLYRDAMAHFEAELASLQEPGPGGAG

Samples

Sample ID Description Type Environment
1 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
12 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
20 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
26 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
30 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
31 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
32 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
33 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
34 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
35 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
36 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
39 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
47 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
52 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
53 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
54 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
55 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
56 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
57 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
58 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
59 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
60 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
63 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
64 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
65 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
94 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
95 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
96 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
97 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
98 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
99 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
100 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
101 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
102 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
103 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
104 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
105 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
106 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
107 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
108 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
109 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
110 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
111 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
114 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
115 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
116 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
117 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
120 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
121 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
122 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
123 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
124 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
125 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
129 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
132 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
133 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
134 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
137 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
138 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
143 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
144 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
145 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
146 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
147 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
148 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
149 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
150 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
151 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
152 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
153 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
154 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
155 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
156 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
157 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
158 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
159 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
162 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
163 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
164 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
165 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
166 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
167 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
168 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
169 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
173 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
177 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
180 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
181 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
182 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
183 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
184 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
187 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
188 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
189 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
194 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
195 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
196 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
197 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
198 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
199 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
200 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
201 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
202 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.04
Nodule 0
Rhizoplane 9.92
Rhizosphere 88.25
Stem 0
Stem Tuber 0
Unclassified 2.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0081539_10008126 3300005985 Bacteria 9264
2 JGI25406J46586_10041919 3300003203 Bacteria 1607
3 JGI25407J50210_10000340 3300003373 Bacteria 8740
4 JGI25407J50210_10004081 3300003373 Bacteria 3546
5 JGI25407J50210_10010679 3300003373 Bacteria 2339
6 Ga0070683_100014251 3300005329 Bacteria 6949
7 Ga0070683_100064546 3300005329 Bacteria 3409
8 Ga0070683_100196852 3300005329 Bacteria 1914
9 Ga0070683_100431254 3300005329 Bacteria 1258
10 Ga0070690_100314313 3300005330 Bacteria 1127
11 Ga0070682_100060956 3300005337 Bacteria 2387
12 Ga0068868_100100667 3300005338 Bacteria 2338
13 Ga0070689_100018228 3300005340 Bacteria 5166
14 Ga0070687_100039932 3300005343 Bacteria 2361
15 Ga0070687_100237041 3300005343 Bacteria 1126
16 Ga0070668_100035541 3300005347 Bacteria 3800
17 Ga0070667_100119509 3300005367 Bacteria 2292
18 Ga0070709_10196333 3300005434 Bacteria 1427
19 Ga0070714_100026802 3300005435 Bacteria 4765
20 Ga0070714_100289330 3300005435 Bacteria 1524
21 Ga0070713_100311603 3300005436 Bacteria 1451
22 Ga0070713_100327578 3300005436 Bacteria 1416
23 Ga0070713_100705935 3300005436 Unclassified 963
24 Ga0070713_100826038 3300005436 Bacteria 889
25 Ga0070710_10007143 3300005437 Bacteria 5396
26 Ga0070711_100007362 3300005439 Bacteria 6696
27 Ga0070711_100067704 3300005439 Bacteria 2506
28 Ga0070705_100049907 3300005440 Bacteria 2432
29 Ga0070705_100377737 3300005440 Bacteria 1042
30 Ga0070700_100064161 3300005441 Bacteria 2326
31 Ga0070700_100193592 3300005441 Bacteria 1423
32 Ga0070681_10225474 3300005458 Bacteria 1789
33 Ga0068867_100017528 3300005459 Bacteria 5087
34 Ga0070685_10028349 3300005466 Bacteria 3101
35 Ga0070685_10403810 3300005466 Bacteria 947
36 Ga0070698_100101948 3300005471 Bacteria 2841
37 Ga0070684_100452760 3300005535 Bacteria 1186
38 Ga0068853_100428736 3300005539 Bacteria 1241
39 Ga0070704_100717300 3300005549 Bacteria 888
40 Ga0068854_100110614 3300005578 Bacteria 2072
41 Ga0068856_100097410 3300005614 Bacteria 2930
42 Ga0070702_100005396 3300005615 Bacteria 5949
43 Ga0068852_100504741 3300005616 Bacteria 1205
44 Ga0068859_100081043 3300005617 Bacteria 3287
45 Ga0068866_10065454 3300005718 Bacteria 1901
46 Ga0068861_100346734 3300005719 Bacteria 1301
47 Ga0068870_10052664 3300005840 Bacteria 2159
48 Ga0068863_100349307 3300005841 Bacteria 1440
49 Ga0068858_100057425 3300005842 Bacteria 3597
50 Ga0068860_100121830 3300005843 Bacteria 2498
51 Ga0068860_100201520 3300005843 Bacteria 1929
52 Ga0068860_100272844 3300005843 Bacteria 1651
53 Ga0081455_10025298 3300005937 Bacteria 5483
54 Ga0081455_10027196 3300005937 Bacteria 5243
55 Ga0081538_10000523 3300005981 Bacteria 42849
56 Ga0081538_10001721 3300005981 Bacteria 22267
57 Ga0081538_10001911 3300005981 Bacteria 20890
58 Ga0081538_10002281 3300005981 Bacteria 18953
59 Ga0081538_10002863 3300005981 Bacteria 16503
60 Ga0081538_10006092 3300005981 Bacteria 10715
61 Ga0081538_10007557 3300005981 Bacteria 9383
62 Ga0081538_10012621 3300005981 Bacteria 6762
63 Ga0081538_10015333 3300005981 Bacteria 5940
64 Ga0081538_10102400 3300005981 Bacteria 1437
65 Ga0081538_10174764 3300005981 Bacteria 930
66 Ga0081540_1019017 3300005983 Bacteria 4193
67 Ga0081539_10002537 3300005985 Bacteria 25456
68 Ga0081539_10023299 3300005985 Bacteria 4060
69 Ga0081539_10042505 3300005985 Bacteria 2646
70 Ga0081539_10066403 3300005985 Bacteria 1955
71 Ga0081539_10069499 3300005985 Bacteria 1895
72 Ga0070717_10115277 3300006028 Bacteria 2296
73 Ga0075363_100078144 3300006048 Bacteria 1807
74 Ga0075364_10050731 3300006051 Bacteria 2709
75 Ga0070716_100012346 3300006173 Bacteria 4328
76 Ga0070712_100005120 3300006175 Bacteria 8114
77 Ga0070712_100080470 3300006175 Bacteria 2358
78 Ga0075434_100073118 3300006871 Bacteria 3421
79 Ga0097620_100081040 3300006931 Bacteria 3287
80 Ga0075435_100059282 3300007076 Bacteria 3103
81 Ga0105240_10823303 3300009093 Bacteria 1004
82 Ga0105245_10009076 3300009098 Bacteria 8663
83 Ga0105245_10138354 3300009098 Bacteria 2291
84 Ga0105245_10169909 3300009098 Bacteria 2076
85 Ga0105247_10031226 3300009101 Bacteria 3232
86 Ga0105243_10053781 3300009148 Bacteria 3194
87 Ga0105243_10111240 3300009148 Bacteria 2292
88 Ga0105243_10284008 3300009148 Bacteria 1492
89 Ga0105243_10500924 3300009148 Bacteria 1151
90 Ga0105248_10112058 3300009177 Bacteria 3077
91 Ga0105249_10078366 3300009553 Bacteria 3066
92 Ga0105239_10276284 3300010375 Bacteria 1890
93 Ga0105246_10077264 3300011119 Bacteria 2361
94 Ga0105246_10115550 3300011119 Bacteria 1979
95 Ga0105246_10362724 3300011119 Unclassified 1191
96 Ga0157369_10305394 3300013105 Bacteria 1655
97 Ga0163162_10491323 3300013306 Bacteria 1358
98 Ga0157372_11098828 3300013307 Bacteria 920
99 Ga0157375_10025385 3300013308 Bacteria 5505
100 Ga0163163_10182250 3300014325 Bacteria 2147
101 Ga0157380_10250510 3300014326 Bacteria 1603
102 Ga0157380_10793832 3300014326 Bacteria 963
103 Ga0157377_10012713 3300014745 Bacteria 4241
104 Ga0157379_10061874 3300014968 Bacteria 3348
105 Ga0224712_10142691 3300022467 Bacteria 1055
106 Ga0207692_10059708 3300025898 Bacteria 1970
107 Ga0207642_10037690 3300025899 Bacteria 2085
108 Ga0207710_10156213 3300025900 Bacteria 1109
109 Ga0207688_10014271 3300025901 Bacteria 4323
110 Ga0207688_10319510 3300025901 Bacteria 952
111 Ga0207693_10020967 3300025915 Bacteria 5195
112 Ga0207693_10020983 3300025915 Bacteria 5193
113 Ga0207693_10081791 3300025915 Bacteria 2529
114 Ga0207663_10063406 3300025916 Bacteria 2353
115 Ga0207663_10128132 3300025916 Bacteria 1749
116 Ga0207663_10258042 3300025916 Bacteria 1286
117 Ga0207663_10350034 3300025916 Bacteria 1118
118 Ga0207662_10066547 3300025918 Bacteria 2171
119 Ga0207659_10674373 3300025926 Bacteria 884
120 Ga0207700_10279515 3300025928 Bacteria 1436
121 Ga0207700_10367599 3300025928 Bacteria 1255
122 Ga0207664_10006405 3300025929 Bacteria 8097
123 Ga0207644_10231427 3300025931 Bacteria 1469
124 Ga0207709_10012996 3300025935 Bacteria 4590
125 Ga0207709_10031545 3300025935 Bacteria 3096
126 Ga0207669_10381959 3300025937 Unclassified 1098
127 Ga0207704_10266889 3300025938 Unclassified 1294
128 Ga0207704_10307284 3300025938 Bacteria 1217
129 Ga0207665_10050189 3300025939 Bacteria 2805
130 Ga0207665_10132011 3300025939 Bacteria 1774
131 Ga0207691_10137129 3300025940 Bacteria 2157
132 Ga0207661_10213557 3300025944 Bacteria 1702
133 Ga0207661_10401747 3300025944 Bacteria 1242
134 Ga0207661_10812373 3300025944 Bacteria 861
135 Ga0207712_10103219 3300025961 Bacteria 2124
136 Ga0207668_10027326 3300025972 Bacteria 3716
137 Ga0207640_10425288 3300025981 Bacteria 1088
138 Ga0207677_10071563 3300026023 Unclassified 2448
139 Ga0207677_10304539 3300026023 Bacteria 1318
140 Ga0207678_10627697 3300026067 Bacteria 943
141 Ga0207708_10084684 3300026075 Bacteria 2438
142 Ga0207708_10092453 3300026075 Bacteria 2334
143 Ga0207708_10096277 3300026075 Bacteria 2287
144 Ga0207702_10119020 3300026078 Bacteria 2361
145 Ga0207702_10362520 3300026078 Bacteria 1389
146 Ga0207648_10029729 3300026089 Bacteria 4845
147 Ga0207648_10039329 3300026089 Bacteria 4159
148 Ga0207648_10339722 3300026089 Bacteria 1352
149 Ga0207675_100126252 3300026118 Bacteria 2423
150 Ga0207675_100281934 3300026118 Bacteria 1615
151 Ga0268265_10043201 3300028380 Bacteria 3349
152 Ga0268265_10064108 3300028380 Bacteria 2830
153 Ga0268264_10129474 3300028381 Bacteria 2235
154 Ga0268264_10148881 3300028381 Bacteria 2096
155 Ga0307410_10238674 3300031852 Bacteria 1407
156 Ga0307406_10038700 3300031901 Bacteria 2954
157 Ga0307406_10064634 3300031901 Bacteria 2375
158 Ga0307406_10099525 3300031901 Bacteria 1977
159 Ga0307406_10138546 3300031901 Bacteria 1719
160 Ga0307407_10088775 3300031903 Bacteria 1889
161 Ga0307407_10122892 3300031903 Bacteria 1649
162 Ga0307409_100289406 3300031995 Bacteria 1518
163 Ga0307416_100133187 3300032002 Bacteria 2242
164 Ga0307415_100017332 3300032126 Bacteria 4316
165 Ga0307415_100176136 3300032126 Bacteria 1673
166 Ga0307415_100315581 3300032126 Bacteria 1301
167 Ga0307415_100356052 3300032126 Bacteria 1234
168 Ga0373926_0002522 3300035083 Bacteria 5813
169 Ga0373944_0001687 3300035089 Bacteria 5588
170 Ga0373923_0022502 3300035111 Bacteria 2473
171 Ga0373936_0001189 3300035113 Bacteria 9367
172 Ga0373945_0000081 3300035116 Bacteria 21933
173 Ga0373943_0000186 3300035170 Bacteria 24935
174 Ga0373946_0000031 3300035171 Bacteria 37176
175 Ga0373931_0070185 3300035691 Bacteria 1911
176 Ga0373935_0000471 3300035692 Bacteria 21011
177 Ga0373935_0264027 3300035692 Bacteria 1208
178 Ga0373927_0008352 3300035695 Bacteria 6969
179 Ga0373927_0243832 3300035695 Bacteria 1181
180 Ga0373933_0068035 3300035724 Bacteria 2162
181 Ga0373947_0000100 3300035725 Bacteria 43717
182 Ga0373947_0289453 3300035725 Bacteria 1090
183 Ga0373937_0004316 3300036401 Bacteria 12058
184 Ga0373937_0098208 3300036401 Bacteria 2716
185 Ga0373925_0002891 3300037068 Bacteria 13565
186 Ga0373925_0014932 3300037068 Bacteria 5613
187 Ga0395898_0049487 3300037466 Bacteria 4118
188 Ga0395898_0143694 3300037466 Bacteria 2284
189 Ga0395898_0152980 3300037466 Bacteria 2207
190 Ga0395901_0006095 3300038443 Bacteria 12214
191 Ga0395901_0097880 3300038443 Bacteria 3076
192 Ga0395901_0123031 3300038443 Bacteria 2726
193 Ga0395901_0411485 3300038443 Bacteria 1388
194 Ga0395901_0523005 3300038443 Bacteria 1205
195 Ga0395901_0581137 3300038443 Bacteria 1132
196 Ga0395901_0865847 3300038443 Bacteria 888
197 Ga0395901_0906458 3300038443 Bacteria 863
198 Ga0439448_0034649 3300042005 Bacteria 1614
199 Ga0439458_0032942 3300042157 Bacteria 1240
200 Ga0439464_0005039 3300042439 Bacteria 3397
201 Ga0466967_0145472 3300045976 Bacteria 2211
202 Ga0466967_0510866 3300045976 Bacteria 1180
203 Ga0495592_0031154 3300046454 Bacteria 4032
204 Ga0495592_0081675 3300046454 Bacteria 2337
205 Ga0495641_0027931 3300046461 Bacteria 2736
206 Ga0495641_0230924 3300046461 Bacteria 830
207 Ga0495651_0014392 3300046462 Bacteria 6117
208 Ga0495651_0090218 3300046462 Bacteria 2299
209 Ga0495664_0000681 3300046477 Bacteria 17265
210 Ga0495608_0091940 3300046511 Bacteria 1961
211 Ga0495608_0131569 3300046511 Bacteria 1601
212 Ga0495618_0006138 3300046514 Bacteria 7287
213 Ga0495620_0152365 3300046515 Bacteria 901
214 Ga0495628_0017784 3300046516 Bacteria 5905
215 Ga0495628_0068451 3300046516 Bacteria 2770
216 Ga0495630_0001158 3300046517 Bacteria 18203
217 Ga0495652_0002747 3300046529 Bacteria 17799
218 Ga0495665_0090791 3300046531 Bacteria 1605
219 Ga0495640_0032108 3300046533 Bacteria 3742
220 Ga0495640_0219307 3300046533 Bacteria 1200
221 Ga0495645_0213420 3300046543 Unclassified 1302
222 Ga0495645_0347617 3300046543 Bacteria 956
223 Ga0495667_0000291 3300046559 Bacteria 32352
224 Ga0495667_0043192 3300046559 Bacteria 2987
225 Ga0495667_0060308 3300046559 Bacteria 2488
226 Ga0495668_0192589 3300046616 Bacteria 1117
227 Ga0495634_0035293 3300046642 Bacteria 3426
228 Ga0495634_0083158 3300046642 Bacteria 2090
229 Ga0495635_0000840 3300046663 Bacteria 20096
230 Ga0495635_0048130 3300046663 Bacteria 2939
231 Ga0495635_0171330 3300046663 Bacteria 1476
232 Ga0495657_0033736 3300046675 Bacteria 3561
233 Ga0495657_0035518 3300046675 Bacteria 3453
234 Ga0495657_0077853 3300046675 Bacteria 2150
235 Ga0495599_0060835 3300046678 Bacteria 2361
236 Ga0495623_0030574 3300046679 Bacteria 3465
237 Ga0495646_0018918 3300046680 Bacteria 4361
238 Ga0495658_0290009 3300046683 Bacteria 1034
239 Ga0495624_0001653 3300046690 Bacteria 17092
240 Ga0495600_0041235 3300046809 Bacteria 3008
241 Ga0495600_0044198 3300046809 Bacteria 2907
242 Ga0495604_0005131 3300047317 Bacteria 10365
243 Ga0495604_0389723 3300047317 Bacteria 919
244 Ga0495674_0000276 3300047319 Bacteria 44078
245 Ga0495674_0389160 3300047319 Bacteria 1127
246 Ga0495676_0007306 3300047321 Bacteria 10134
247 Ga0495680_0003021 3300047322 Bacteria 16778
248 Ga0495680_0004502 3300047322 Bacteria 13329
249 Ga0495680_0043558 3300047322 Bacteria 3552
250 Ga0495684_0001168 3300047471 Bacteria 21121
251 Ga0495684_0005881 3300047471 Bacteria 9528
252 Ga0495602_0006740 3300048088 Bacteria 12055
253 Ga0496100_0635838 3300048903 Bacteria 830
254 Ga0496101_0016164 3300048904 Bacteria 5038
255 Ga0496101_0054479 3300048904 Bacteria 2888
256 Ga0496102_0021009 3300048905 Bacteria 5772
257 Ga0496102_0038419 3300048905 Bacteria 4320
258 Ga0496102_0141435 3300048905 Bacteria 2257
259 Ga0496104_0002043 3300048907 Bacteria 17529
260 Ga0496104_0038303 3300048907 Bacteria 4486
261 Ga0496104_0142226 3300048907 Bacteria 2305
262 Ga0496104_0218784 3300048907 Bacteria 1817
263 Ga0496105_0076355 3300048908 Bacteria 2766
264 Ga0496105_0383977 3300048908 Bacteria 1117
265 Ga0496105_0462062 3300048908 Bacteria 1001
266 Ga0496105_0786683 3300048908 Bacteria 724
267 Ga0496106_0009621 3300048909 Bacteria 7139
268 Ga0496106_0029197 3300048909 Bacteria 4109
269 Ga0496107_0005013 3300048910 Bacteria 9019
270 Ga0496107_0009112 3300048910 Bacteria 6882
271 Ga0496108_0001143 3300048911 Bacteria 20720
272 Ga0496108_0210313 3300048911 Bacteria 1689
273 Ga0496108_0477155 3300048911 Unclassified 1090
274 Ga0496109_0002380 3300048912 Bacteria 15713
275 Ga0496109_0005162 3300048912 Bacteria 10898
276 Ga0496109_0021198 3300048912 Bacteria 5745
277 Ga0496109_0091811 3300048912 Bacteria 2808
278 Ga0496109_0261874 3300048912 Bacteria 1629
279 Ga0496109_0292236 3300048912 Bacteria 1536
280 Ga0496109_0513688 3300048912 Bacteria 1131
281 Ga0496110_0140838 3300048913 Bacteria 2180
282 Ga0496110_0228510 3300048913 Bacteria 1692
283 Ga0496110_0444733 3300048913 Unclassified 1181
284 Ga0496111_0043279 3300048914 Bacteria 3236
285 Ga0496112_0001597 3300048915 Bacteria 17518
286 Ga0496112_0037460 3300048915 Bacteria 4733
287 Ga0496112_0630054 3300048915 Bacteria 1003
288 Ga0496112_0710197 3300048915 Bacteria 933
289 Ga0496113_0011585 3300048916 Bacteria 5892
290 Ga0496115_0401438 3300048918 Bacteria 1112
291 Ga0496119_0139158 3300048922 Bacteria 1313
292 Ga0496121_0005784 3300048924 Bacteria 15689
293 Ga0496126_0069845 3300048929 Bacteria 3131
294 Ga0501031_0031589 3300049568 Bacteria 3454
295 Ga0501032_0081935 3300049569 Bacteria 2147
296 Ga0501036_0020245 3300049572 Bacteria 5588
297 Ga0501036_0040206 3300049572 Bacteria 3955
298 Ga0501036_0100247 3300049572 Bacteria 2450
299 Ga0501038_0284094 3300049574 Bacteria 1302
300 Ga0501039_0010244 3300049575 Bacteria 7144
301 Ga0501039_0021375 3300049575 Bacteria 4965
302 Ga0501039_0051227 3300049575 Bacteria 3195
303 Ga0501039_0138260 3300049575 Bacteria 1913
304 Ga0501039_0216703 3300049575 Bacteria 1505
305 Ga0501039_0412574 3300049575 Bacteria 1061
306 Ga0501040_0015685 3300049576 Bacteria 5009
307 Ga0501040_0097692 3300049576 Bacteria 2046
308 Ga0501040_0490581 3300049576 Bacteria 885
309 Ga0501041_0056770 3300049577 Bacteria 2393
310 Ga0501041_0098390 3300049577 Bacteria 1809
311 Ga0501041_0288052 3300049577 Bacteria 1034
312 Ga0501041_0307793 3300049577 Bacteria 999
313 Ga0501042_0011566 3300049578 Bacteria 5958
314 Ga0501042_0063140 3300049578 Bacteria 2647
315 Ga0501042_0095961 3300049578 Bacteria 2130
316 Ga0501042_0108713 3300049578 Bacteria 1996
317 Ga0501042_0145699 3300049578 Bacteria 1707
318 Ga0501043_0070096 3300049579 Bacteria 2754
319 Ga0501046_0020850 3300049580 Bacteria 5412
320 Ga0501046_0067723 3300049580 Bacteria 2780
321 Ga0501046_0112119 3300049580 Bacteria 2083
322 Ga0501048_0015367 3300049582 Bacteria 5653
323 Ga0501048_0107544 3300049582 Bacteria 1969
324 Ga0501048_0167035 3300049582 Bacteria 1558
325 Ga0501067_0324910 3300049583 Bacteria 857
326 Ga0501070_0069353 3300049586 Bacteria 2919
327 Ga0501071_0012676 3300049587 Bacteria 5730
328 Ga0501071_0031009 3300049587 Bacteria 3786
329 Ga0501071_0145093 3300049587 Bacteria 1769
330 Ga0501071_0156785 3300049587 Bacteria 1700
331 Ga0501072_0004088 3300049588 Bacteria 11041
332 Ga0501072_0021307 3300049588 Bacteria 5027
333 Ga0501072_0029524 3300049588 Bacteria 4284
334 Ga0501072_0100108 3300049588 Bacteria 2304
335 Ga0501072_0588899 3300049588 Bacteria 877
336 Ga0501073_0276659 3300049589 Bacteria 1158
337 Ga0501074_0082149 3300049590 Bacteria 2311
338 Ga0501074_0534530 3300049590 Unclassified 830
339 Ga0501075_0009524 3300049591 Bacteria 6798
340 Ga0501075_0067189 3300049591 Bacteria 2707
341 Ga0501075_0068614 3300049591 Bacteria 2679
342 Ga0501075_0074203 3300049591 Bacteria 2573
343 Ga0501076_0020484 3300049592 Bacteria 5064
344 Ga0501076_0041692 3300049592 Bacteria 3612
345 Ga0501077_0115246 3300049593 Bacteria 1703
346 Ga0501077_0287334 3300049593 Unclassified 1047
347 Ga0501077_0346290 3300049593 Bacteria 948
348 Ga0501079_0038126 3300049741 Bacteria 3707
349 Ga0501079_0091611 3300049741 Bacteria 2355
350 Ga0501079_0130168 3300049741 Bacteria 1958
351 Ga0501081_0021097 3300049743 Bacteria 4347
352 Ga0501081_0111044 3300049743 Bacteria 1945
353 Ga0501081_0166578 3300049743 Bacteria 1590
354 Ga0501081_0251989 3300049743 Bacteria 1289
355 Ga0501083_0158701 3300049744 Bacteria 1480
356 Ga0501035_0464353 3300049822 Bacteria 1046
357 Ga0501045_0001389 3300049824 Bacteria 16150
358 Ga0501045_0031516 3300049824 Bacteria 3840
359 Ga0501045_0090649 3300049824 Bacteria 2259
360 nmdc:mga03n38_105279_c1 3300050490 Bacteria 1366
361 nmdc:mga00v17_58103_c1 3300050491 Bacteria 2368
362 nmdc:mga05p37_346041_c1 3300050507 Bacteria 1751
363 nmdc:mga09592_259634_c1 3300050508 Bacteria 1506
364 nmdc:mga0qj67_110790_c1 3300050509 Bacteria 2216
365 nmdc:mga06r32_243807_c1 3300050510 Bacteria 1784
366 nmdc:mga08y16_85396_c1 3300050511 Bacteria 3289
367 nmdc:mga0n895_1062230_c1 3300050512 Bacteria 788
368 nmdc:mga0n895_535056_c1 3300050512 Bacteria 1178
369 Ga0495601_0233281 3300053077 Bacteria 1202
370 Ga0501084_0042078 3300054114 Bacteria 3821
371 Ga0501084_0082617 3300054114 Bacteria 2696
372 Ga0501084_0138451 3300054114 Bacteria 2049
373 Ga0501084_0531095 3300054114 Bacteria 994
374 Ga0501082_0052770 3300060353 Bacteria 3505
375 Ga0501082_0065191 3300060353 Bacteria 3137
376 Ga0501082_0164743 3300060353 Bacteria 1926
377 Ga0501082_0220204 3300060353 Bacteria 1651
378 Ga0501082_0315638 3300060353 Unclassified 1361
379 Ga0501082_0350867 3300060353 Bacteria 1286
380 Ga0530510_0004297 3300061734 Bacteria 9858
381 Ga0530510_0012485 3300061734 Bacteria 5966
382 Ga0530510_0043507 3300061734 Bacteria 3244
383 Ga0530510_0115358 3300061734 Bacteria 1969
384 Ga0081539_10008126
385 JGI25406J46586_10041919
386 JGI25407J50210_10000340
387 JGI25407J50210_10004081
388 JGI25407J50210_10010679
389 Ga0070683_100014251
390 Ga0070683_100064546
391 Ga0070683_100196852
392 Ga0070683_100431254
393 Ga0070690_100314313
394 Ga0070682_100060956
395 Ga0068868_100100667
396 Ga0070689_100018228
397 Ga0070687_100039932
398 Ga0070687_100237041
399 Ga0070668_100035541
400 Ga0070667_100119509
401 Ga0070709_10196333
402 Ga0070714_100026802
403 Ga0070714_100289330
404 Ga0070713_100311603
405 Ga0070713_100327578
406 Ga0070713_100705935
407 Ga0070713_100826038
408 Ga0070710_10007143
409 Ga0070711_100007362
410 Ga0070711_100067704
411 Ga0070705_100049907
412 Ga0070705_100377737
413 Ga0070700_100064161
414 Ga0070700_100193592
415 Ga0070681_10225474
416 Ga0068867_100017528
417 Ga0070685_10028349
418 Ga0070685_10403810
419 Ga0070698_100101948
420 Ga0070684_100452760
421 Ga0068853_100428736
422 Ga0070704_100717300
423 Ga0068854_100110614
424 Ga0068856_100097410
425 Ga0070702_100005396
426 Ga0068852_100504741
427 Ga0068859_100081043
428 Ga0068866_10065454
429 Ga0068861_100346734
430 Ga0068870_10052664
431 Ga0068863_100349307
432 Ga0068858_100057425
433 Ga0068860_100121830
434 Ga0068860_100201520
435 Ga0068860_100272844
436 Ga0081455_10025298
437 Ga0081455_10027196
438 Ga0081538_10000523
439 Ga0081538_10001721
440 Ga0081538_10001911
441 Ga0081538_10002281
442 Ga0081538_10002863
443 Ga0081538_10006092
444 Ga0081538_10007557
445 Ga0081538_10012621
446 Ga0081538_10015333
447 Ga0081538_10102400
448 Ga0081538_10174764
449 Ga0081540_1019017
450 Ga0081539_10002537
451 Ga0081539_10023299
452 Ga0081539_10042505
453 Ga0081539_10066403
454 Ga0081539_10069499
455 Ga0070717_10115277
456 Ga0075363_100078144
457 Ga0075364_10050731
458 Ga0070716_100012346
459 Ga0070712_100005120
460 Ga0070712_100080470
461 Ga0075434_100073118
462 Ga0097620_100081040
463 Ga0075435_100059282
464 Ga0105240_10823303
465 Ga0105245_10009076
466 Ga0105245_10138354
467 Ga0105245_10169909
468 Ga0105247_10031226
469 Ga0105243_10053781
470 Ga0105243_10111240
471 Ga0105243_10284008
472 Ga0105243_10500924
473 Ga0105248_10112058
474 Ga0105249_10078366
475 Ga0105239_10276284
476 Ga0105246_10077264
477 Ga0105246_10115550
478 Ga0105246_10362724
479 Ga0157369_10305394
480 Ga0163162_10491323
481 Ga0157372_11098828
482 Ga0157375_10025385
483 Ga0163163_10182250
484 Ga0157380_10250510
485 Ga0157380_10793832
486 Ga0157377_10012713
487 Ga0157379_10061874
488 Ga0224712_10142691
489 Ga0207692_10059708
490 Ga0207642_10037690
491 Ga0207710_10156213
492 Ga0207688_10014271
493 Ga0207688_10319510
494 Ga0207693_10020967
495 Ga0207693_10020983
496 Ga0207693_10081791
497 Ga0207663_10063406
498 Ga0207663_10128132
499 Ga0207663_10258042
500 Ga0207663_10350034
501 Ga0207662_10066547
502 Ga0207659_10674373
503 Ga0207700_10279515
504 Ga0207700_10367599
505 Ga0207664_10006405
506 Ga0207644_10231427
507 Ga0207709_10012996
508 Ga0207709_10031545
509 Ga0207669_10381959
510 Ga0207704_10266889
511 Ga0207704_10307284
512 Ga0207665_10050189
513 Ga0207665_10132011
514 Ga0207691_10137129
515 Ga0207661_10213557
516 Ga0207661_10401747
517 Ga0207661_10812373
518 Ga0207712_10103219
519 Ga0207668_10027326
520 Ga0207640_10425288
521 Ga0207677_10071563
522 Ga0207677_10304539
523 Ga0207678_10627697
524 Ga0207708_10084684
525 Ga0207708_10092453
526 Ga0207708_10096277
527 Ga0207702_10119020
528 Ga0207702_10362520
529 Ga0207648_10029729
530 Ga0207648_10039329
531 Ga0207648_10339722
532 Ga0207675_100126252
533 Ga0207675_100281934
534 Ga0268265_10043201
535 Ga0268265_10064108
536 Ga0268264_10129474
537 Ga0268264_10148881
538 Ga0307410_10238674
539 Ga0307406_10038700
540 Ga0307406_10064634
541 Ga0307406_10099525
542 Ga0307406_10138546
543 Ga0307407_10088775
544 Ga0307407_10122892
545 Ga0307409_100289406
546 Ga0307416_100133187
547 Ga0307415_100017332
548 Ga0307415_100176136
549 Ga0307415_100315581
550 Ga0307415_100356052
551 Ga0373926_0002522
552 Ga0373944_0001687
553 Ga0373923_0022502
554 Ga0373936_0001189
555 Ga0373945_0000081
556 Ga0373943_0000186
557 Ga0373946_0000031
558 Ga0373931_0070185
559 Ga0373935_0000471
560 Ga0373935_0264027
561 Ga0373927_0008352
562 Ga0373927_0243832
563 Ga0373933_0068035
564 Ga0373947_0000100
565 Ga0373947_0289453
566 Ga0373937_0004316
567 Ga0373937_0098208
568 Ga0373925_0002891
569 Ga0373925_0014932
570 Ga0395898_0049487
571 Ga0395898_0143694
572 Ga0395898_0152980
573 Ga0395901_0006095
574 Ga0395901_0097880
575 Ga0395901_0123031
576 Ga0395901_0411485
577 Ga0395901_0523005
578 Ga0395901_0581137
579 Ga0395901_0865847
580 Ga0395901_0906458
581 Ga0439448_0034649
582 Ga0439458_0032942
583 Ga0439464_0005039
584 Ga0466967_0145472
585 Ga0466967_0510866
586 Ga0495592_0031154
587 Ga0495592_0081675
588 Ga0495641_0027931
589 Ga0495641_0230924
590 Ga0495651_0014392
591 Ga0495651_0090218
592 Ga0495664_0000681
593 Ga0495608_0091940
594 Ga0495608_0131569
595 Ga0495618_0006138
596 Ga0495620_0152365
597 Ga0495628_0017784
598 Ga0495628_0068451
599 Ga0495630_0001158
600 Ga0495652_0002747
601 Ga0495665_0090791
602 Ga0495640_0032108
603 Ga0495640_0219307
604 Ga0495645_0213420
605 Ga0495645_0347617
606 Ga0495667_0000291
607 Ga0495667_0043192
608 Ga0495667_0060308
609 Ga0495668_0192589
610 Ga0495634_0035293
611 Ga0495634_0083158
612 Ga0495635_0000840
613 Ga0495635_0048130
614 Ga0495635_0171330
615 Ga0495657_0033736
616 Ga0495657_0035518
617 Ga0495657_0077853
618 Ga0495599_0060835
619 Ga0495623_0030574
620 Ga0495646_0018918
621 Ga0495658_0290009
622 Ga0495624_0001653
623 Ga0495600_0041235
624 Ga0495600_0044198
625 Ga0495604_0005131
626 Ga0495604_0389723
627 Ga0495674_0000276
628 Ga0495674_0389160
629 Ga0495676_0007306
630 Ga0495680_0003021
631 Ga0495680_0004502
632 Ga0495680_0043558
633 Ga0495684_0001168
634 Ga0495684_0005881
635 Ga0495602_0006740
636 Ga0496100_0635838
637 Ga0496101_0016164
638 Ga0496101_0054479
639 Ga0496102_0021009
640 Ga0496102_0038419
641 Ga0496102_0141435
642 Ga0496104_0002043
643 Ga0496104_0038303
644 Ga0496104_0142226
645 Ga0496104_0218784
646 Ga0496105_0076355
647 Ga0496105_0383977
648 Ga0496105_0462062
649 Ga0496105_0786683
650 Ga0496106_0009621
651 Ga0496106_0029197
652 Ga0496107_0005013
653 Ga0496107_0009112
654 Ga0496108_0001143
655 Ga0496108_0210313
656 Ga0496108_0477155
657 Ga0496109_0002380
658 Ga0496109_0005162
659 Ga0496109_0021198
660 Ga0496109_0091811
661 Ga0496109_0261874
662 Ga0496109_0292236
663 Ga0496109_0513688
664 Ga0496110_0140838
665 Ga0496110_0228510
666 Ga0496110_0444733
667 Ga0496111_0043279
668 Ga0496112_0001597
669 Ga0496112_0037460
670 Ga0496112_0630054
671 Ga0496112_0710197
672 Ga0496113_0011585
673 Ga0496115_0401438
674 Ga0496119_0139158
675 Ga0496121_0005784
676 Ga0496126_0069845
677 Ga0501031_0031589
678 Ga0501032_0081935
679 Ga0501036_0020245
680 Ga0501036_0040206
681 Ga0501036_0100247
682 Ga0501038_0284094
683 Ga0501039_0010244
684 Ga0501039_0021375
685 Ga0501039_0051227
686 Ga0501039_0138260
687 Ga0501039_0216703
688 Ga0501039_0412574
689 Ga0501040_0015685
690 Ga0501040_0097692
691 Ga0501040_0490581
692 Ga0501041_0056770
693 Ga0501041_0098390
694 Ga0501041_0288052
695 Ga0501041_0307793
696 Ga0501042_0011566
697 Ga0501042_0063140
698 Ga0501042_0095961
699 Ga0501042_0108713
700 Ga0501042_0145699
701 Ga0501043_0070096
702 Ga0501046_0020850
703 Ga0501046_0067723
704 Ga0501046_0112119
705 Ga0501048_0015367
706 Ga0501048_0107544
707 Ga0501048_0167035
708 Ga0501067_0324910
709 Ga0501070_0069353
710 Ga0501071_0012676
711 Ga0501071_0031009
712 Ga0501071_0145093
713 Ga0501071_0156785
714 Ga0501072_0004088
715 Ga0501072_0021307
716 Ga0501072_0029524
717 Ga0501072_0100108
718 Ga0501072_0588899
719 Ga0501073_0276659
720 Ga0501074_0082149
721 Ga0501074_0534530
722 Ga0501075_0009524
723 Ga0501075_0067189
724 Ga0501075_0068614
725 Ga0501075_0074203
726 Ga0501076_0020484
727 Ga0501076_0041692
728 Ga0501077_0115246
729 Ga0501077_0287334
730 Ga0501077_0346290
731 Ga0501079_0038126
732 Ga0501079_0091611
733 Ga0501079_0130168
734 Ga0501081_0021097
735 Ga0501081_0111044
736 Ga0501081_0166578
737 Ga0501081_0251989
738 Ga0501083_0158701
739 Ga0501035_0464353
740 Ga0501045_0001389
741 Ga0501045_0031516
742 Ga0501045_0090649
743 nmdc:mga03n38_105279_c1
744 nmdc:mga00v17_58103_c1
745 nmdc:mga05p37_346041_c1
746 nmdc:mga09592_259634_c1
747 nmdc:mga0qj67_110790_c1
748 nmdc:mga06r32_243807_c1
749 nmdc:mga08y16_85396_c1
750 nmdc:mga0n895_1062230_c1
751 nmdc:mga0n895_535056_c1
752 Ga0495601_0233281
753 Ga0501084_0042078
754 Ga0501084_0082617
755 Ga0501084_0138451
756 Ga0501084_0531095
757 Ga0501082_0052770
758 Ga0501082_0065191
759 Ga0501082_0164743
760 Ga0501082_0220204
761 Ga0501082_0315638
762 Ga0501082_0350867
763 Ga0530510_0004297
764 Ga0530510_0012485
765 Ga0530510_0043507
766 Ga0530510_0115358

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13714

PEP_mutase

Phosphoenolpyruvate phosphomutase

16

260

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mg4-assembly1.cif.gz_A crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9426 9 258
4mg4-assembly4.cif.gz_D crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9397 11 257
4mg4-assembly2.cif.gz_F crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9335 10 258
4mg4-assembly1.cif.gz_H crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9327 12 258
4mg4-assembly4.cif.gz_D crystal structure of a putative phosphonomutase from burkholderia cenocepacia j2315 0.9286 11 257
ID Description Score Start End Superfamily
4mg4B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9439 9 258 3.20.20.60
4mg4B00 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9257 9 258 3.20.20.60
af_P9WLN9_1_257_3.20.20.60 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9227 17 260 3.20.20.60
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.9014 7 241 3.20.20.60
2ze3A01 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Phosphoenolpyruvate-binding domains 0.8939 7 241 3.20.20.60
ID Description Score Start End GO Terms
AF-A0A7W1Q6P3-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9879 9 143 GO:0016829
AF-A0A7Y9LC68-F1-model_v4 2-methylisocitrate lyase-like PEP mutase family enzyme 0.9858 9 258 GO:0016829
AF-A0A3E0HDE9-F1-model_v4 2-methylisocitrate lyase-like PEP mutase family enzyme 0.9816 8 259 GO:0016829
AF-A0A2Z3JKF4-F1-model_v4 Putative carboxyvinyl-carboxyphosphonate phosphorylmutase (EC 2.7.8.23) 0.9768 9 116 GO:0008807
AF-A0A7W1Q6P3-F1-model_v4 Isocitrate lyase/phosphoenolpyruvate mutase family protein 0.9735 9 143 GO:0016829

Map