F429534

General Info

Members Datasets Scaffolds Average Seq Length
383 184 383 469

Family's Representative Sequence

Representative Sequence 3300005843|Ga0068860_100017322|Ga0068860_1000173224
Length 493
Sequence MVFYPNFIAIIITMHYYTPKLKLLLLIPFFALACGTGPDKTDKKDTPSAADPLARASRKDSSGWIYVHLEGSPSDIGYQHGYLLAEDIDTTLQALSTFLQHETKKDWEFYRHCAASFLWPKVDSEYKAEINGIVAGLKAKHKNYDSLDITALNAQEELAYYYVPQLMDKQKPGSGDNKAPGNCSAFIATGSYTKDGKIIIGHNNWTSYMIGQHWNVIADIVPDKGSHMLMDCMPGYIHSGDDFVITSNGILITETTITQFKGFDSTQTPEFVRARKSAQYANSIDDVIRLFVTGNNGGYANDWLIGDIKTNEVAKLELGLKDYKVWRSKDTAIAGSNFASDPKLIKEETTFSTTDPTTSPNARKKRMEQLLLVDLKGKIDLEQGQKIEADHLDVTRHTNANNKCVVCGHVDEDKKGCMEWDWPAYYPGGAVQSKITTADLAKDLKLWAHMGHPCGQDFIAAPFYKLHPEYAWQAKYLTALRAYPWTLFETKPR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
3 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
9 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
12 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
13 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
14 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
18 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
19 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
20 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
21 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
22 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
34 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
46 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
55 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
56 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
57 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
58 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
59 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
64 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
65 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
66 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
67 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
68 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
69 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
70 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
71 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
72 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
73 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
74 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
75 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
76 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
77 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
78 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
86 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
87 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
90 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
91 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
92 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
93 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
94 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
95 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
96 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
97 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
143 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
144 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
145 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
146 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
147 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
148 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
149 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
150 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
151 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
152 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
159 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
160 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
161 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
164 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
165 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
166 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
167 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
168 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
169 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
170 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
171 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
172 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
173 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
174 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
175 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
176 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
177 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
178 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
179 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
180 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
181 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
182 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
183 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
184 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.52
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.79
Nodule 0
Rhizoplane 0.26
Rhizosphere 87.21
Stem 0
Stem Tuber 0
Unclassified 5.74

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10024878 3300001979 Bacteria 2024
2 JGI24744J21845_10007427 3300002077 Bacteria 2265
3 JGI25162J39368_1001033 3300002737 Bacteria 17196
4 JGI25406J46586_10000891 3300003203 Bacteria 14043
5 JGI25165J46597_1000678 3300003214 Bacteria 27401
6 JGI25153J46596_10014113 3300003215 Unclassified 3340
7 rootH2_10003984 3300003320 Bacteria 13672
8 rootH2_10010257 3300003320 Bacteria 3231
9 rootH2_10012322 3300003320 Bacteria 30567
10 rootH2_10019694 3300003320 Bacteria 26743
11 rootH2_10060489 3300003320 Bacteria 5673
12 rootH2_10082380 3300003320 Bacteria 4443
13 rootH1_10002303 3300003323 Bacteria 27478
14 rootH1_10064719 3300003323 Bacteria 4262
15 rootH1_10091166 3300003323 Bacteria 4456
16 JGI25160J50197_1004449 3300003354 Bacteria 6062
17 Ga0055526_1009755 3300003771 Bacteria 4567
18 Ga0055528_1001348 3300003790 Bacteria 15180
19 Ga0055530_10005304 3300003791 Bacteria 6188
20 Ga0058863_11409933 3300004799 Bacteria 3062
21 Ga0058862_12260637 3300004803 Bacteria 2016
22 Ga0065165_1000127 3300005262 Bacteria 129837
23 Ga0065714_10007844 3300005288 Bacteria 4690
24 Ga0065712_10076262 3300005290 Unclassified 3694
25 Ga0070658_10000153 3300005327 Bacteria 60625
26 Ga0070658_10103732 3300005327 Bacteria 2352
27 Ga0070676_10004225 3300005328 Bacteria 7543
28 Ga0070676_10007843 3300005328 Bacteria 5739
29 Ga0070676_10022171 3300005328 Unclassified 3560
30 Ga0070683_100000329 3300005329 Bacteria 32745
31 Ga0070683_100014341 3300005329 Bacteria 6931
32 Ga0070683_100018315 3300005329 Bacteria 6200
33 Ga0070690_100023911 3300005330 Bacteria 3753
34 Ga0070670_100006244 3300005331 Bacteria 10083
35 Ga0068869_100027695 3300005334 Bacteria 3953
36 Ga0070680_100002040 3300005336 Bacteria 14896
37 Ga0068868_100000726 3300005338 Bacteria 22242
38 Ga0068868_100024954 3300005338 Unclassified 4540
39 Ga0068868_100123120 3300005338 Bacteria 2116
40 Ga0070660_100108592 3300005339 Bacteria 2205
41 Ga0070689_100019987 3300005340 Bacteria 4962
42 Ga0070689_100044019 3300005340 Bacteria 3434
43 Ga0070687_100011272 3300005343 Bacteria 3906
44 Ga0070661_100000537 3300005344 Bacteria 29079
45 Ga0070675_100017851 3300005354 Bacteria 5644
46 Ga0070671_100004940 3300005355 Bacteria 10606
47 Ga0070671_100137328 3300005355 Bacteria 2061
48 Ga0070673_100006095 3300005364 Bacteria 7813
49 Ga0070659_100000375 3300005366 Bacteria 33764
50 Ga0070667_100028970 3300005367 Unclassified 4611
51 Ga0070667_100095018 3300005367 Bacteria 2569
52 Ga0070678_100006885 3300005456 Bacteria 6707
53 Ga0070662_100002650 3300005457 Bacteria 11037
54 Ga0070662_100009876 3300005457 Bacteria 6253
55 Ga0070662_100153931 3300005457 Bacteria 1793
56 Ga0070681_10053940 3300005458 Bacteria 4006
57 Ga0068867_100001333 3300005459 Bacteria 17102
58 Ga0068867_100003263 3300005459 Bacteria 11430
59 Ga0070685_10014014 3300005466 Bacteria 4242
60 Ga0070685_10018137 3300005466 Unclassified 3779
61 Ga0070698_100001240 3300005471 Bacteria 28441
62 Ga0070698_100015839 3300005471 Bacteria 7962
63 Ga0070679_100005927 3300005530 Bacteria 11355
64 Ga0070684_100001858 3300005535 Bacteria 15463
65 Ga0070684_100053747 3300005535 Bacteria 3508
66 Ga0068853_100008148 3300005539 Bacteria 8410
67 Ga0068853_100020667 3300005539 Bacteria 5476
68 Ga0068853_100058802 3300005539 Bacteria 3320
69 Ga0068853_100066776 3300005539 Unclassified 3124
70 Ga0070665_100000372 3300005548 Bacteria 66748
71 Ga0070665_100014535 3300005548 Bacteria 7898
72 Ga0070665_100290173 3300005548 Bacteria 1638
73 Ga0068855_100000224 3300005563 Bacteria 72367
74 Ga0068855_100000341 3300005563 Bacteria 57937
75 Ga0068855_100002344 3300005563 Bacteria 23381
76 Ga0068855_100065723 3300005563 Bacteria 4229
77 Ga0068855_100137266 3300005563 Bacteria 2789
78 Ga0068855_100307796 3300005563 Bacteria 1753
79 Ga0070664_100002488 3300005564 Bacteria 14847
80 Ga0070664_100064981 3300005564 Bacteria 3112
81 Ga0070664_100078451 3300005564 Bacteria 2841
82 Ga0068857_100054142 3300005577 Bacteria 3560
83 Ga0068854_100123533 3300005578 Bacteria 1968
84 Ga0068856_100001358 3300005614 Bacteria 25722
85 Ga0068856_100003057 3300005614 Bacteria 17112
86 Ga0068856_100015071 3300005614 Bacteria 7468
87 Ga0068856_100032847 3300005614 Bacteria 5082
88 Ga0068856_100223760 3300005614 Bacteria 1897
89 Ga0068852_100000197 3300005616 Bacteria 41267
90 Ga0068852_100007464 3300005616 Bacteria 7979
91 Ga0068852_100033980 3300005616 Bacteria 4241
92 Ga0068852_100061913 3300005616 Bacteria 3253
93 Ga0068859_100036769 3300005617 Unclassified 4915
94 Ga0068859_100078746 3300005617 Bacteria 3336
95 Ga0068859_100116098 3300005617 Bacteria 2741
96 Ga0068864_100015939 3300005618 Bacteria 6255
97 Ga0068864_100017832 3300005618 Bacteria 5921
98 Ga0068864_100028548 3300005618 Bacteria 4718
99 Ga0068864_100034223 3300005618 Bacteria 4320
100 Ga0068866_10034795 3300005718 Unclassified 2456
101 Ga0068858_100107060 3300005842 Bacteria 2609
102 Ga0068858_100144842 3300005842 Bacteria 2231
103 Ga0068860_100000060 3300005843 Bacteria 195631
104 Ga0068860_100017322 3300005843 Bacteria 7020
105 Ga0068860_100101866 3300005843 Bacteria 2739
106 Ga0081539_10001586 3300005985 Bacteria 37565
107 Ga0097621_100001155 3300006237 Bacteria 18347
108 Ga0097621_100010363 3300006237 Bacteria 6815
109 Ga0097621_100105447 3300006237 Bacteria 2377
110 Ga0097621_100105555 3300006237 Bacteria 2375
111 Ga0068871_100000141 3300006358 Bacteria 46656
112 Ga0075428_100017514 3300006844 Bacteria 7915
113 Ga0068865_100000847 3300006881 Bacteria 17301
114 Ga0097620_100036770 3300006931 Unclassified 4915
115 Ga0097620_100078743 3300006931 Bacteria 3336
116 Ga0097620_100116096 3300006931 Bacteria 2741
117 Ga0105240_10000100 3300009093 Bacteria 176640
118 Ga0105240_10000268 3300009093 Bacteria 102828
119 Ga0105240_10000570 3300009093 Bacteria 68288
120 Ga0105240_10005272 3300009093 Bacteria 19301
121 Ga0105240_10025992 3300009093 Bacteria 7689
122 Ga0105240_10028314 3300009093 Bacteria 7320
123 Ga0105240_10028879 3300009093 Bacteria 7234
124 Ga0105240_10101158 3300009093 Unclassified 3506
125 Ga0105240_10122090 3300009093 Bacteria 3136
126 Ga0105245_10060655 3300009098 Bacteria 3407
127 Ga0105241_10002013 3300009174 Bacteria 15372
128 Ga0105241_10003868 3300009174 Bacteria 11099
129 Ga0105241_10004311 3300009174 Bacteria 10519
130 Ga0105241_10005560 3300009174 Bacteria 9308
131 Ga0105241_10028951 3300009174 Bacteria 4128
132 Ga0105241_10120579 3300009174 Bacteria 2111
133 Ga0105241_10220062 3300009174 Bacteria 1595
134 Ga0105242_10056851 3300009176 Unclassified 3202
135 Ga0105242_10113823 3300009176 Bacteria 2311
136 Ga0105248_10260468 3300009177 Unclassified 1952
137 Ga0105248_10291379 3300009177 Bacteria 1838
138 Ga0105237_10006232 3300009545 Bacteria 13286
139 Ga0105237_10006561 3300009545 Bacteria 12869
140 Ga0105237_10013534 3300009545 Bacteria 8550
141 Ga0105237_10017183 3300009545 Bacteria 7505
142 Ga0105237_10019257 3300009545 Bacteria 7050
143 Ga0105237_10150572 3300009545 Bacteria 2323
144 Ga0105237_10209306 3300009545 Bacteria 1950
145 Ga0105238_10002725 3300009551 Bacteria 17595
146 Ga0105238_10018791 3300009551 Bacteria 7036
147 Ga0105238_10021406 3300009551 Bacteria 6587
148 Ga0105238_10106565 3300009551 Bacteria 2784
149 Ga0105249_10001205 3300009553 Bacteria 22829
150 Ga0105249_10008771 3300009553 Bacteria 8824
151 Ga0105249_10010240 3300009553 Bacteria 8235
152 Ga0105249_10011122 3300009553 Bacteria 7906
153 Ga0105239_10000811 3300010375 Bacteria 44304
154 Ga0105239_10001523 3300010375 Bacteria 30768
155 Ga0105239_10003552 3300010375 Bacteria 19067
156 Ga0105239_10007261 3300010375 Bacteria 12728
157 Ga0105239_10016202 3300010375 Bacteria 8246
158 Ga0105239_10075621 3300010375 Unclassified 3703
159 Ga0105239_10137540 3300010375 Bacteria 2720
160 Ga0105246_10080985 3300011119 Bacteria 2313
161 Ga0105246_10143618 3300011119 Bacteria 1798
162 Ga0157373_10028143 3300013100 Bacteria 4055
163 Ga0157373_10044183 3300013100 Bacteria 3181
164 Ga0157373_10046238 3300013100 Bacteria 3105
165 Ga0157371_10066284 3300013102 Bacteria 2557
166 Ga0157370_10001825 3300013104 Bacteria 26235
167 Ga0157370_10009749 3300013104 Bacteria 10198
168 Ga0157370_10101212 3300013104 Bacteria 2699
169 Ga0157370_10230227 3300013104 Bacteria 1715
170 Ga0157369_10068298 3300013105 Bacteria 3818
171 Ga0157374_10000004 3300013296 Bacteria 759774
172 Ga0157374_10004899 3300013296 Bacteria 11233
173 Ga0157374_10007946 3300013296 Bacteria 9060
174 Ga0157374_10009267 3300013296 Bacteria 8440
175 Ga0157374_10018679 3300013296 Bacteria 6123
176 Ga0157374_10027177 3300013296 Bacteria 5158
177 Ga0157374_10028471 3300013296 Bacteria 5047
178 Ga0157378_10009438 3300013297 Bacteria 8503
179 Ga0157378_10064296 3300013297 Bacteria 3281
180 Ga0157378_10179900 3300013297 Bacteria 1989
181 Ga0163162_10001202 3300013306 Bacteria 24155
182 Ga0163162_10004888 3300013306 Bacteria 12922
183 Ga0163162_10054377 3300013306 Bacteria 4027
184 Ga0157372_10007279 3300013307 Bacteria 11785
185 Ga0157372_10058353 3300013307 Unclassified 4314
186 Ga0157372_10095588 3300013307 Bacteria 3385
187 Ga0157372_10096978 3300013307 Bacteria 3361
188 Ga0157372_10113150 3300013307 Bacteria 3110
189 Ga0157375_10006512 3300013308 Bacteria 10164
190 Ga0157375_10043043 3300013308 Bacteria 4376
191 Ga0157375_10048419 3300013308 Unclassified 4158
192 Ga0157375_10192959 3300013308 Unclassified 2192
193 Ga0157375_10339557 3300013308 Bacteria 1667
194 Ga0163163_10114118 3300014325 Bacteria 2732
195 Ga0163163_10151995 3300014325 Bacteria 2358
196 Ga0157377_10015702 3300014745 Bacteria 3881
197 Ga0157377_10050567 3300014745 Bacteria 2341
198 Ga0157379_10032127 3300014968 Bacteria 4678
199 Ga0157376_10001335 3300014969 Bacteria 16278
200 Ga0157376_10032526 3300014969 Bacteria 4189
201 Ga0157376_10035560 3300014969 Bacteria 4030
202 Ga0163161_10010401 3300017792 Bacteria 6442
203 Ga0163161_10042247 3300017792 Bacteria 3278
204 Ga0209563_105246 3300025230 Bacteria 2374
205 Ga0207427_100025 3300025231 Bacteria 433726
206 Ga0209437_100010 3300025233 Bacteria 838447
207 Ga0209233_1000017 3300025261 Bacteria 898076
208 Ga0209455_1001523 3300025272 Bacteria 10351
209 Ga0209673_1000034 3300025273 Bacteria 328788
210 Ga0209675_1025421 3300025291 Bacteria 1493
211 Ga0209564_1004382 3300025295 Bacteria 8668
212 Ga0209758_1004388 3300025297 Bacteria 11777
213 Ga0209050_1000673 3300025298 Bacteria 51628
214 Ga0207426_1000329 3300025302 Bacteria 90476
215 Ga0209051_1029713 3300025303 Bacteria 2134
216 Ga0209257_1001183 3300025304 Bacteria 32997
217 Ga0207680_10003322 3300025903 Bacteria 7576
218 Ga0207647_10008184 3300025904 Bacteria 7513
219 Ga0207647_10022722 3300025904 Unclassified 4161
220 Ga0207645_10000035 3300025907 Bacteria 89345
221 Ga0207645_10000821 3300025907 Bacteria 26045
222 Ga0207645_10015292 3300025907 Bacteria 5104
223 Ga0207705_10000108 3300025909 Bacteria 93501
224 Ga0207654_10005764 3300025911 Bacteria 6254
225 Ga0207654_10043314 3300025911 Bacteria 2551
226 Ga0207707_10014728 3300025912 Bacteria 6814
227 Ga0207695_10000027 3300025913 Bacteria 612456
228 Ga0207695_10000073 3300025913 Bacteria 312565
229 Ga0207695_10000164 3300025913 Bacteria 196777
230 Ga0207695_10000775 3300025913 Bacteria 60574
231 Ga0207695_10024707 3300025913 Bacteria 6749
232 Ga0207695_10026501 3300025913 Bacteria 6470
233 Ga0207695_10034063 3300025913 Bacteria 5546
234 Ga0207695_10081046 3300025913 Bacteria 3286
235 Ga0207695_10083883 3300025913 Unclassified 3218
236 Ga0207695_10144145 3300025913 Bacteria 2328
237 Ga0207695_10162202 3300025913 Bacteria 2166
238 Ga0207671_10004251 3300025914 Bacteria 13785
239 Ga0207671_10009599 3300025914 Bacteria 8066
240 Ga0207671_10011844 3300025914 Bacteria 7057
241 Ga0207671_10033281 3300025914 Bacteria 3835
242 Ga0207671_10040152 3300025914 Unclassified 3464
243 Ga0207671_10041850 3300025914 Bacteria 3391
244 Ga0207671_10070512 3300025914 Bacteria 2606
245 Ga0207671_10096872 3300025914 Bacteria 2230
246 Ga0207662_10020460 3300025918 Bacteria 3777
247 Ga0207657_10025916 3300025919 Bacteria 5399
248 Ga0207657_10045102 3300025919 Bacteria 3871
249 Ga0207657_10057330 3300025919 Bacteria 3356
250 Ga0207649_10028757 3300025920 Bacteria 3276
251 Ga0207649_10087521 3300025920 Bacteria 2032
252 Ga0207681_10043129 3300025923 Unclassified 3018
253 Ga0207694_10035422 3300025924 Unclassified 3829
254 Ga0207650_10122252 3300025925 Bacteria 2028
255 Ga0207659_10184466 3300025926 Bacteria 1656
256 Ga0207687_10048534 3300025927 Bacteria 2948
257 Ga0207644_10023288 3300025931 Bacteria 4240
258 Ga0207644_10104999 3300025931 Bacteria 2128
259 Ga0207690_10002170 3300025932 Bacteria 11970
260 Ga0207706_10001112 3300025933 Bacteria 27374
261 Ga0207706_10009220 3300025933 Bacteria 9066
262 Ga0207706_10051986 3300025933 Bacteria 3618
263 Ga0207706_10059535 3300025933 Bacteria 3363
264 Ga0207706_10134510 3300025933 Bacteria 2174
265 Ga0207686_10000566 3300025934 Bacteria 23556
266 Ga0207686_10103684 3300025934 Bacteria 1904
267 Ga0207670_10043839 3300025936 Bacteria 2957
268 Ga0207704_10000036 3300025938 Bacteria 94574
269 Ga0207704_10078093 3300025938 Unclassified 2128
270 Ga0207689_10017871 3300025942 Bacteria 5989
271 Ga0207689_10146260 3300025942 Unclassified 1947
272 Ga0207661_10009743 3300025944 Bacteria 6900
273 Ga0207661_10021094 3300025944 Bacteria 4880
274 Ga0207661_10047939 3300025944 Bacteria 3393
275 Ga0207661_10059286 3300025944 Unclassified 3084
276 Ga0207661_10078576 3300025944 Bacteria 2717
277 Ga0207679_10000751 3300025945 Bacteria 21527
278 Ga0207679_10001121 3300025945 Bacteria 17095
279 Ga0207679_10162320 3300025945 Bacteria 1831
280 Ga0207667_10000266 3300025949 Bacteria 72382
281 Ga0207667_10000411 3300025949 Bacteria 57956
282 Ga0207667_10001830 3300025949 Bacteria 26721
283 Ga0207667_10012886 3300025949 Bacteria 9606
284 Ga0207667_10013280 3300025949 Bacteria 9434
285 Ga0207667_10106915 3300025949 Bacteria 2886
286 Ga0207651_10013629 3300025960 Bacteria 4660
287 Ga0207651_10070789 3300025960 Bacteria 2469
288 Ga0207712_10005253 3300025961 Bacteria 8191
289 Ga0207712_10005755 3300025961 Bacteria 7814
290 Ga0207712_10006416 3300025961 Bacteria 7422
291 Ga0207640_10034093 3300025981 Bacteria 3174
292 Ga0207658_10075663 3300025986 Unclassified 2562
293 Ga0207703_10043044 3300026035 Bacteria 3623
294 Ga0207639_10078824 3300026041 Bacteria 2601
295 Ga0207639_10139983 3300026041 Bacteria 2015
296 Ga0207639_10175668 3300026041 Unclassified 1818
297 Ga0207702_10001407 3300026078 Bacteria 24021
298 Ga0207702_10004956 3300026078 Bacteria 11696
299 Ga0207641_10005426 3300026088 Bacteria 10884
300 Ga0207648_10006086 3300026089 Bacteria 12032
301 Ga0207648_10013332 3300026089 Bacteria 7653
302 Ga0207676_10002842 3300026095 Bacteria 12326
303 Ga0207676_10022021 3300026095 Bacteria 4683
304 Ga0207674_10042338 3300026116 Bacteria 4704
305 Ga0207674_10079879 3300026116 Bacteria 3274
306 Ga0207674_10084035 3300026116 Bacteria 3182
307 Ga0207674_10230029 3300026116 Bacteria 1802
308 Ga0207675_100016558 3300026118 Bacteria 6884
309 Ga0207675_100036164 3300026118 Bacteria 4606
310 Ga0207675_100038705 3300026118 Bacteria 4450
311 Ga0207683_10000982 3300026121 Bacteria 26175
312 Ga0207683_10002737 3300026121 Bacteria 15399
313 Ga0207683_10085551 3300026121 Bacteria 2803
314 Ga0207698_10010995 3300026142 Bacteria 5850
315 Ga0207698_10036047 3300026142 Bacteria 3626
316 Ga0207698_10083920 3300026142 Bacteria 2580
317 Ga0268266_10000658 3300028379 Bacteria 46741
318 Ga0268266_10017916 3300028379 Bacteria 6037
319 Ga0268266_10068549 3300028379 Bacteria 3072
320 Ga0268264_10000243 3300028381 Bacteria 102854
321 Ga0268264_10011532 3300028381 Bacteria 7302
322 Ga0268264_10055834 3300028381 Unclassified 3300
323 Ga0268264_10177847 3300028381 Unclassified 1930
324 Ga0307517_10004407 3300028786 Bacteria 21615
325 Ga0307515_10003374 3300028794 Bacteria 33668
326 Ga0307515_10019936 3300028794 Bacteria 12013
327 Ga0265338_10022351 3300028800 Bacteria 6551
328 Ga0307511_10001438 3300030521 Bacteria 25120
329 Ga0265327_10000099 3300031251 Bacteria 190474
330 Ga0265327_10071456 3300031251 Bacteria 1736
331 Ga0307509_10036410 3300031507 Bacteria 5388
332 Ga0307508_10185407 3300031616 Bacteria 1683
333 Ga0307516_10000330 3300031730 Bacteria 61733
334 Ga0307516_10035988 3300031730 Bacteria 4960
335 Ga0307507_10000034 3300033179 Bacteria 188697
336 Ga0307510_10000366 3300033180 Bacteria 42784
337 Ga0307510_10001319 3300033180 Bacteria 27054
338 Ga0307510_10080817 3300033180 Bacteria 3158
339 Ga0373941_0011630 3300035115 Bacteria 2279
340 Ga0373935_0146306 3300035692 Bacteria 1600
341 Ga0395899_0000034 3300037312 Bacteria 302623
342 Ga0395899_0006152 3300037312 Bacteria 9303
343 Ga0395900_0000346 3300037418 Bacteria 68020
344 Ga0395900_0001482 3300037418 Bacteria 28015
345 Ga0395900_0022444 3300037418 Bacteria 6455
346 Ga0395905_0000528 3300037471 Bacteria 52404
347 Ga0395905_0002267 3300037471 Bacteria 21602
348 Ga0395901_0000351 3300038443 Bacteria 56004
349 Ga0395901_0009231 3300038443 Bacteria 9995
350 Ga0436365_0518530 3300039437 Bacteria 6270
351 Ga0436361_0167348 3300039447 Bacteria 7226
352 Ga0466972_0012980 3300044658 Bacteria 4186
353 Ga0453683_0000182 3300044673 Bacteria 86933
354 Ga0466961_0021970 3300044693 Unclassified 4106
355 Ga0453684_0104849 3300044712 Bacteria 3450
356 Ga0453684_0348993 3300044712 Unclassified 1669
357 Ga0466971_0042273 3300044719 Bacteria 2048
358 Ga0451576_0000903 3300045051 Bacteria 56269
359 Ga0451576_0004314 3300045051 Bacteria 18572
360 Ga0451576_0026580 3300045051 Bacteria 6224
361 Ga0495638_0006439 3300046460 Bacteria 8543
362 Ga0495585_0006589 3300046492 Bacteria 7178
363 Ga0495616_0004750 3300046513 Bacteria 8514
364 Ga0495628_0000313 3300046516 Bacteria 43821
365 Ga0495648_0003901 3300046524 Bacteria 12927
366 Ga0495609_0062244 3300046538 Bacteria 1648
367 Ga0495633_0000072 3300046558 Bacteria 131197
368 Ga0495668_0000165 3300046616 Bacteria 98016
369 Ga0495611_0000757 3300046648 Bacteria 18182
370 Ga0495625_0001492 3300046660 Bacteria 28147
371 Ga0495625_0004553 3300046660 Bacteria 13050
372 Ga0495625_0107198 3300046660 Bacteria 1912
373 Ga0495683_0011808 3300047323 Bacteria 4593
374 Ga0495687_000014 3300047443 Bacteria 366896
375 Ga0495687_000233 3300047443 Bacteria 77056
376 Ga0496115_0120099 3300048918 Bacteria 2162
377 Ga0495678_017508 3300049459 Bacteria 3246
378 Ga0495619_0137540 3300053085 Bacteria 1681
379 Ga0500583_0001816 3300053092 Bacteria 6255
380 Ga0500608_000343 3300053122 Bacteria 18061
381 Ga0500618_000005 3300053125 Bacteria 253092
382 Ga0500564_068060 3300053138 Bacteria 1609
383 Ga0500622_0007330 3300053156 Bacteria 6274

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300026116 Ga0207674_10079879 Ga0207674_100798792 379
2 3300025911 Ga0207654_10005764 Ga0207654_100057642 401
3 3300005331 Ga0070670_100006244 Ga0070670_1000062445 425
4 3300005618 Ga0068864_100028548 Ga0068864_1000285483 425
5 3300025961 Ga0207712_10006416 Ga0207712_100064163 425
6 3300026095 Ga0207676_10022021 Ga0207676_100220213 425
7 3300044712 Ga0453684_0348993 Ga0453684_0348993_316_1629 432
8 3300053138 Ga0500564_068060 Ga0500564_068060_58_1377 439
9 3300009098 Ga0105245_10060655 Ga0105245_100606552 440
10 3300031730 Ga0307516_10035988 Ga0307516_100359883 443
11 3300025927 Ga0207687_10048534 Ga0207687_100485343 450
12 3300044658 Ga0466972_0012980 Ga0466972_0012980_1507_2910 450
13 3300005618 Ga0068864_100015939 Ga0068864_1000159392 452
14 3300009545 Ga0105237_10019257 Ga0105237_100192574 454
15 3300025914 Ga0207671_10011844 Ga0207671_100118444 454
16 3300003320 rootH2_10060489 rootH2_100604892 455
17 3300005366 Ga0070659_100000375 Ga0070659_10000037539 456
18 3300005466 Ga0070685_10018137 Ga0070685_100181374 456
19 3300005617 Ga0068859_100116098 Ga0068859_1001160982 456
20 3300006931 Ga0097620_100116096 Ga0097620_1001160962 456
21 3300025932 Ga0207690_10002170 Ga0207690_1000217015 456
22 3300005843 Ga0068860_100000060 Ga0068860_10000006039 457
23 3300009174 Ga0105241_10220062 Ga0105241_102200622 457
24 3300013306 Ga0163162_10004888 Ga0163162_100048885 457
25 3300028381 Ga0268264_10000243 Ga0268264_1000024361 457
26 3300044673 Ga0453683_0000182 Ga0453683_0000182_56555_57964 457
27 3300044712 Ga0453684_0104849 Ga0453684_0104849_959_2368 457
28 3300045051 Ga0451576_0000903 Ga0451576_0000903_28461_29870 457
29 3300045051 Ga0451576_0004314 Ga0451576_0004314_12553_13962 457
30 3300046460 Ga0495638_0006439 Ga0495638_0006439_5573_6973 457
31 3300046524 Ga0495648_0003901 Ga0495648_0003901_9907_11307 457
32 3300047443 Ga0495687_000014 Ga0495687_000014_278797_280197 457
33 3300053092 Ga0500583_0001816 Ga0500583_0001816_1725_3125 457
34 3300053156 Ga0500622_0007330 Ga0500622_0007330_614_2014 457
35 3300002077 JGI24744J21845_10007427 JGI24744J21845_100074271 458
36 3300005328 Ga0070676_10004225 Ga0070676_100042252 458
37 3300005340 Ga0070689_100044019 Ga0070689_1000440191 458
38 3300005354 Ga0070675_100017851 Ga0070675_1000178513 458
39 3300005364 Ga0070673_100006095 Ga0070673_1000060957 458
40 3300005456 Ga0070678_100006885 Ga0070678_1000068854 458
41 3300005457 Ga0070662_100002650 Ga0070662_1000026501 458
42 3300005459 Ga0068867_100001333 Ga0068867_1000013335 458
43 3300005535 Ga0070684_100001858 Ga0070684_10000185812 458
44 3300005539 Ga0068853_100058802 Ga0068853_1000588022 458
45 3300005564 Ga0070664_100064981 Ga0070664_1000649812 458
46 3300005616 Ga0068852_100007464 Ga0068852_1000074646 458
47 3300005618 Ga0068864_100017832 Ga0068864_1000178322 458
48 3300006237 Ga0097621_100001155 Ga0097621_10000115513 458
49 3300006358 Ga0068871_100000141 Ga0068871_10000014140 458
50 3300006881 Ga0068865_100000847 Ga0068865_1000008477 458
51 3300009174 Ga0105241_10003868 Ga0105241_100038687 458
52 3300009174 Ga0105241_10005560 Ga0105241_100055604 458
53 3300009545 Ga0105237_10006232 Ga0105237_100062328 458
54 3300009545 Ga0105237_10017183 Ga0105237_100171835 458
55 3300009551 Ga0105238_10021406 Ga0105238_100214062 458
56 3300011119 Ga0105246_10143618 Ga0105246_101436182 458
57 3300013105 Ga0157369_10068298 Ga0157369_100682983 458
58 3300013296 Ga0157374_10004899 Ga0157374_100048995 458
59 3300013296 Ga0157374_10009267 Ga0157374_100092676 458
60 3300013296 Ga0157374_10027177 Ga0157374_100271773 458
61 3300013297 Ga0157378_10009438 Ga0157378_100094384 458
62 3300013307 Ga0157372_10096978 Ga0157372_100969783 458
63 3300013308 Ga0157375_10339557 Ga0157375_103395572 458
64 3300014745 Ga0157377_10015702 Ga0157377_100157022 458
65 3300025907 Ga0207645_10000035 Ga0207645_1000003541 458
66 3300025913 Ga0207695_10144145 Ga0207695_101441452 458
67 3300025914 Ga0207671_10004251 Ga0207671_1000425112 458
68 3300025914 Ga0207671_10096872 Ga0207671_100968721 458
69 3300025920 Ga0207649_10087521 Ga0207649_100875213 458
70 3300025926 Ga0207659_10184466 Ga0207659_101844661 458
71 3300025933 Ga0207706_10001112 Ga0207706_1000111224 458
72 3300025933 Ga0207706_10051986 Ga0207706_100519863 458
73 3300025936 Ga0207670_10043839 Ga0207670_100438392 458
74 3300025938 Ga0207704_10000036 Ga0207704_1000003689 458
75 3300025944 Ga0207661_10021094 Ga0207661_100210943 458
76 3300025945 Ga0207679_10001121 Ga0207679_1000112115 458
77 3300025960 Ga0207651_10013629 Ga0207651_100136295 458
78 3300025960 Ga0207651_10070789 Ga0207651_100707892 458
79 3300026089 Ga0207648_10006086 Ga0207648_100060863 458
80 3300026095 Ga0207676_10002842 Ga0207676_100028424 458
81 3300026116 Ga0207674_10042338 Ga0207674_100423382 458
82 3300026121 Ga0207683_10000982 Ga0207683_1000098214 458
83 3300026142 Ga0207698_10083920 Ga0207698_100839202 458
84 3300033180 Ga0307510_10080817 Ga0307510_100808172 458
85 3300045051 Ga0451576_0026580 Ga0451576_0026580_2960_4378 458
86 3300003320 rootH2_10082380 rootH2_100823802 459
87 3300005563 Ga0068855_100000341 Ga0068855_1000003417 459
88 3300005614 Ga0068856_100032847 Ga0068856_1000328474 459
89 3300009545 Ga0105237_10150572 Ga0105237_101505721 459
90 3300010375 Ga0105239_10075621 Ga0105239_100756213 459
91 3300013296 Ga0157374_10018679 Ga0157374_100186794 459
92 3300025914 Ga0207671_10033281 Ga0207671_100332814 459
93 3300025914 Ga0207671_10070512 Ga0207671_100705121 459
94 3300025949 Ga0207667_10000411 Ga0207667_100004116 459
95 3300031730 Ga0307516_10000330 Ga0307516_1000033044 459
96 3300035692 Ga0373935_0146306 Ga0373935_0146306_122_1540 459
97 3300046660 Ga0495625_0004553 Ga0495625_0004553_10906_12312 459
98 3300048918 Ga0496115_0120099 Ga0496115_0120099_490_1878 459
99 3300002737 JGI25162J39368_1001033 JGI25162J39368_100103322 460
100 3300003214 JGI25165J46597_1000678 JGI25165J46597_100067832 460
101 3300003320 rootH2_10003984 rootH2_1000398411 460
102 3300003320 rootH2_10010257 rootH2_100102572 460
103 3300003320 rootH2_10012322 rootH2_100123228 460
104 3300003320 rootH2_10019694 rootH2_1001969420 460
105 3300003323 rootH1_10002303 rootH1_1000230318 460
106 3300003323 rootH1_10091166 rootH1_100911663 460
107 3300004799 Ga0058863_11409933 Ga0058863_114099332 460
108 3300004803 Ga0058862_12260637 Ga0058862_122606372 460
109 3300005288 Ga0065714_10007844 Ga0065714_100078443 460
110 3300005327 Ga0070658_10000153 Ga0070658_1000015373 460
111 3300005329 Ga0070683_100018315 Ga0070683_1000183157 460
112 3300005336 Ga0070680_100002040 Ga0070680_10000204014 460
113 3300005355 Ga0070671_100004940 Ga0070671_1000049404 460
114 3300005458 Ga0070681_10053940 Ga0070681_100539403 460
115 3300005530 Ga0070679_100005927 Ga0070679_1000059275 460
116 3300005548 Ga0070665_100000372 Ga0070665_10000037253 460
117 3300005563 Ga0068855_100065723 Ga0068855_1000657233 460
118 3300005563 Ga0068855_100137266 Ga0068855_1001372661 460
119 3300005614 Ga0068856_100001358 Ga0068856_10000135831 460
120 3300005614 Ga0068856_100003057 Ga0068856_10000305719 460
121 3300005616 Ga0068852_100000197 Ga0068852_10000019725 460
122 3300006237 Ga0097621_100105555 Ga0097621_1001055552 460
123 3300009093 Ga0105240_10000100 Ga0105240_1000010034 460
124 3300009093 Ga0105240_10000268 Ga0105240_1000026817 460
125 3300009093 Ga0105240_10005272 Ga0105240_100052726 460
126 3300009093 Ga0105240_10028879 Ga0105240_100288794 460
127 3300009093 Ga0105240_10122090 Ga0105240_101220903 460
128 3300009545 Ga0105237_10006561 Ga0105237_100065615 460
129 3300009551 Ga0105238_10106565 Ga0105238_101065651 460
130 3300010375 Ga0105239_10000811 Ga0105239_1000081113 460
131 3300010375 Ga0105239_10003552 Ga0105239_100035523 460
132 3300011119 Ga0105246_10080985 Ga0105246_100809852 460
133 3300013100 Ga0157373_10044183 Ga0157373_100441833 460
134 3300013104 Ga0157370_10009749 Ga0157370_100097497 460
135 3300013104 Ga0157370_10101212 Ga0157370_101012124 460
136 3300013296 Ga0157374_10000004 Ga0157374_10000004292 460
137 3300013306 Ga0163162_10001202 Ga0163162_1000120211 460
138 3300013307 Ga0157372_10007279 Ga0157372_100072797 460
139 3300013307 Ga0157372_10095588 Ga0157372_100955882 460
140 3300013308 Ga0157375_10043043 Ga0157375_100430432 460
141 3300014969 Ga0157376_10001335 Ga0157376_1000133517 460
142 3300025230 Ga0209563_105246 Ga0209563_1052463 460
143 3300025231 Ga0207427_100025 Ga0207427_100025341 460
144 3300025233 Ga0209437_100010 Ga0209437_100010603 460
145 3300025261 Ga0209233_1000017 Ga0209233_1000017616 460
146 3300025904 Ga0207647_10008184 Ga0207647_100081843 460
147 3300025909 Ga0207705_10000108 Ga0207705_1000010839 460
148 3300025912 Ga0207707_10014728 Ga0207707_100147286 460
149 3300025913 Ga0207695_10000027 Ga0207695_10000027371 460
150 3300025913 Ga0207695_10000073 Ga0207695_1000007314 460
151 3300025913 Ga0207695_10000164 Ga0207695_1000016499 460
152 3300025913 Ga0207695_10081046 Ga0207695_100810463 460
153 3300025913 Ga0207695_10162202 Ga0207695_101622022 460
154 3300025914 Ga0207671_10009599 Ga0207671_100095998 460
155 3300025914 Ga0207671_10041850 Ga0207671_100418503 460
156 3300025919 Ga0207657_10025916 Ga0207657_100259162 460
157 3300025919 Ga0207657_10057330 Ga0207657_100573302 460
158 3300025931 Ga0207644_10023288 Ga0207644_100232886 460
159 3300025944 Ga0207661_10078576 Ga0207661_100785761 460
160 3300025949 Ga0207667_10001830 Ga0207667_1000183016 460
161 3300025949 Ga0207667_10106915 Ga0207667_101069152 460
162 3300025981 Ga0207640_10034093 Ga0207640_100340933 460
163 3300026078 Ga0207702_10001407 Ga0207702_1000140728 460
164 3300026078 Ga0207702_10004956 Ga0207702_100049569 460
165 3300026142 Ga0207698_10010995 Ga0207698_100109953 460
166 3300026142 Ga0207698_10036047 Ga0207698_100360472 460
167 3300028379 Ga0268266_10000658 Ga0268266_1000065853 460
168 3300028786 Ga0307517_10004407 Ga0307517_1000440710 460
169 3300028794 Ga0307515_10003374 Ga0307515_1000337433 460
170 3300028794 Ga0307515_10019936 Ga0307515_100199368 460
171 3300030521 Ga0307511_10001438 Ga0307511_1000143812 460
172 3300033179 Ga0307507_10000034 Ga0307507_1000003497 460
173 3300033180 Ga0307510_10000366 Ga0307510_1000036636 460
174 3300035115 Ga0373941_0011630 Ga0373941_0011630_88_1491 460
175 3300037312 Ga0395899_0000034 Ga0395899_0000034_15443_16858 460
176 3300037312 Ga0395899_0006152 Ga0395899_0006152_3670_5070 460
177 3300037418 Ga0395900_0000346 Ga0395900_0000346_56238_57638 460
178 3300037418 Ga0395900_0022444 Ga0395900_0022444_2434_3831 460
179 3300037471 Ga0395905_0000528 Ga0395905_0000528_10366_11766 460
180 3300037471 Ga0395905_0002267 Ga0395905_0002267_1540_2937 460
181 3300038443 Ga0395901_0000351 Ga0395901_0000351_9867_11267 460
182 3300038443 Ga0395901_0009231 Ga0395901_0009231_2924_4321 460
183 3300039447 Ga0436361_0167348 Ga0436361_0167348_4357_5757 460
184 3300044693 Ga0466961_0021970 Ga0466961_0021970_612_2015 460
185 3300044719 Ga0466971_0042273 Ga0466971_0042273_626_2029 460
186 3300046492 Ga0495585_0006589 Ga0495585_0006589_5603_7024 460
187 3300046513 Ga0495616_0004750 Ga0495616_0004750_234_1655 460
188 3300046538 Ga0495609_0062244 Ga0495609_0062244_170_1591 460
189 3300046558 Ga0495633_0000072 Ga0495633_0000072_68047_69468 460
190 3300046616 Ga0495668_0000165 Ga0495668_0000165_17997_19418 460
191 3300046660 Ga0495625_0001492 Ga0495625_0001492_25675_27096 460
192 3300046660 Ga0495625_0107198 Ga0495625_0107198_335_1756 460
193 3300047323 Ga0495683_0011808 Ga0495683_0011808_3040_4440 460
194 3300047443 Ga0495687_000233 Ga0495687_000233_47303_48706 460
195 3300049459 Ga0495678_017508 Ga0495678_017508_657_2078 460
196 3300053122 Ga0500608_000343 Ga0500608_000343_7217_8617 460
197 3300053125 Ga0500618_000005 Ga0500618_000005_239730_241151 460
198 3300005563 Ga0068855_100000224 Ga0068855_10000022441 461
199 3300025949 Ga0207667_10000266 Ga0207667_1000026639 461
200 3300031616 Ga0307508_10185407 Ga0307508_101854071 461
201 3300037418 Ga0395900_0001482 Ga0395900_0001482_12693_14090 461
202 3300005548 Ga0070665_100290173 Ga0070665_1002901731 462
203 3300009093 Ga0105240_10000570 Ga0105240_1000057028 462
204 3300009174 Ga0105241_10002013 Ga0105241_1000201311 462
205 3300009174 Ga0105241_10028951 Ga0105241_100289512 462
206 3300009551 Ga0105238_10002725 Ga0105238_1000272513 462
207 3300010375 Ga0105239_10137540 Ga0105239_101375402 462
208 3300013297 Ga0157378_10179900 Ga0157378_101799001 462
209 3300013307 Ga0157372_10058353 Ga0157372_100583533 462
210 3300025272 Ga0209455_1001523 Ga0209455_100152312 462
211 3300025911 Ga0207654_10043314 Ga0207654_100433143 462
212 3300025913 Ga0207695_10000775 Ga0207695_1000077546 462
213 3300025913 Ga0207695_10034063 Ga0207695_100340638 462
214 3300025924 Ga0207694_10035422 Ga0207694_100354222 462
215 3300025949 Ga0207667_10013280 Ga0207667_100132803 462
216 3300026041 Ga0207639_10139983 Ga0207639_101399832 462
217 3300028800 Ga0265338_10022351 Ga0265338_100223518 462
218 3300031507 Ga0307509_10036410 Ga0307509_100364102 462
219 3300039437 Ga0436365_0518530 Ga0436365_0518530_4773_6170 462
220 3300003215 JGI25153J46596_10014113 JGI25153J46596_100141132 463
221 3300003354 JGI25160J50197_1004449 JGI25160J50197_10044494 463
222 3300003771 Ga0055526_1009755 Ga0055526_10097552 463
223 3300003790 Ga0055528_1001348 Ga0055528_10013486 463
224 3300003791 Ga0055530_10005304 Ga0055530_100053044 463
225 3300005262 Ga0065165_1000127 Ga0065165_100012753 463
226 3300005843 Ga0068860_100017322 Ga0068860_1000173224 463
227 3300009093 Ga0105240_10028314 Ga0105240_100283145 463
228 3300009545 Ga0105237_10013534 Ga0105237_100135347 463
229 3300009553 Ga0105249_10001205 Ga0105249_1000120517 463
230 3300009553 Ga0105249_10011122 Ga0105249_100111225 463
231 3300010375 Ga0105239_10016202 Ga0105239_100162027 463
232 3300014969 Ga0157376_10035560 Ga0157376_100355602 463
233 3300025273 Ga0209673_1000034 Ga0209673_100003413 463
234 3300025291 Ga0209675_1025421 Ga0209675_10254211 463
235 3300025295 Ga0209564_1004382 Ga0209564_10043822 463
236 3300025297 Ga0209758_1004388 Ga0209758_10043888 463
237 3300025298 Ga0209050_1000673 Ga0209050_100067337 463
238 3300025302 Ga0207426_1000329 Ga0207426_100032947 463
239 3300025303 Ga0209051_1029713 Ga0209051_10297132 463
240 3300025304 Ga0209257_1001183 Ga0209257_10011838 463
241 3300025913 Ga0207695_10024707 Ga0207695_100247074 463
242 3300025913 Ga0207695_10026501 Ga0207695_100265015 463
243 3300025923 Ga0207681_10043129 Ga0207681_100431294 463
244 3300028381 Ga0268264_10011532 Ga0268264_100115325 463
245 3300031251 Ga0265327_10000099 Ga0265327_1000009955 463
246 3300003323 rootH1_10064719 rootH1_100647192 464
247 3300005290 Ga0065712_10076262 Ga0065712_100762623 464
248 3300005328 Ga0070676_10022171 Ga0070676_100221714 464
249 3300005338 Ga0068868_100024954 Ga0068868_1000249543 464
250 3300005343 Ga0070687_100011272 Ga0070687_1000112725 464
251 3300005466 Ga0070685_10014014 Ga0070685_100140144 464
252 3300005471 Ga0070698_100001240 Ga0070698_1000012402 464
253 3300005471 Ga0070698_100015839 Ga0070698_1000158399 464
254 3300005539 Ga0068853_100066776 Ga0068853_1000667762 464
255 3300005563 Ga0068855_100002344 Ga0068855_10000234413 464
256 3300005577 Ga0068857_100054142 Ga0068857_1000541422 464
257 3300005614 Ga0068856_100015071 Ga0068856_1000150713 464
258 3300005617 Ga0068859_100078746 Ga0068859_1000787463 464
259 3300006237 Ga0097621_100010363 Ga0097621_1000103637 464
260 3300006844 Ga0075428_100017514 Ga0075428_1000175145 464
261 3300006931 Ga0097620_100078743 Ga0097620_1000787433 464
262 3300009093 Ga0105240_10101158 Ga0105240_101011582 464
263 3300009174 Ga0105241_10004311 Ga0105241_100043114 464
264 3300009176 Ga0105242_10056851 Ga0105242_100568512 464
265 3300009176 Ga0105242_10113823 Ga0105242_101138231 464
266 3300009177 Ga0105248_10260468 Ga0105248_102604682 464
267 3300009545 Ga0105237_10209306 Ga0105237_102093062 464
268 3300009553 Ga0105249_10008771 Ga0105249_100087714 464
269 3300009553 Ga0105249_10010240 Ga0105249_1001024011 464
270 3300010375 Ga0105239_10001523 Ga0105239_100015238 464
271 3300013297 Ga0157378_10064296 Ga0157378_100642963 464
272 3300013307 Ga0157372_10113150 Ga0157372_101131503 464
273 3300014325 Ga0163163_10151995 Ga0163163_101519952 464
274 3300017792 Ga0163161_10042247 Ga0163161_100422472 464
275 3300025907 Ga0207645_10000821 Ga0207645_100008217 464
276 3300025913 Ga0207695_10083883 Ga0207695_100838832 464
277 3300025914 Ga0207671_10040152 Ga0207671_100401523 464
278 3300025918 Ga0207662_10020460 Ga0207662_100204605 464
279 3300025925 Ga0207650_10122252 Ga0207650_101222522 464
280 3300025933 Ga0207706_10134510 Ga0207706_101345103 464
281 3300025934 Ga0207686_10000566 Ga0207686_100005666 464
282 3300025938 Ga0207704_10078093 Ga0207704_100780932 464
283 3300025949 Ga0207667_10012886 Ga0207667_100128863 464
284 3300025961 Ga0207712_10005253 Ga0207712_1000525311 464
285 3300025961 Ga0207712_10005755 Ga0207712_100057559 464
286 3300026041 Ga0207639_10175668 Ga0207639_101756682 464
287 3300026088 Ga0207641_10005426 Ga0207641_100054269 464
288 3300026089 Ga0207648_10013332 Ga0207648_100133326 464
289 3300026116 Ga0207674_10084035 Ga0207674_100840353 464
290 3300026116 Ga0207674_10230029 Ga0207674_102300291 464
291 3300026118 Ga0207675_100036164 Ga0207675_1000361642 464
292 3300026118 Ga0207675_100038705 Ga0207675_1000387054 464
293 3300026121 Ga0207683_10002737 Ga0207683_100027376 464
294 3300028379 Ga0268266_10068549 Ga0268266_100685491 464
295 3300028381 Ga0268264_10055834 Ga0268264_100558342 464
296 3300028381 Ga0268264_10177847 Ga0268264_101778472 464
297 3300046516 Ga0495628_0000313 Ga0495628_0000313_35068_36486 464
298 3300005328 Ga0070676_10007843 Ga0070676_100078434 465
299 3300005329 Ga0070683_100000329 Ga0070683_1000003298 465
300 3300005330 Ga0070690_100023911 Ga0070690_1000239114 465
301 3300005334 Ga0068869_100027695 Ga0068869_1000276954 465
302 3300005338 Ga0068868_100000726 Ga0068868_10000072610 465
303 3300005338 Ga0068868_100123120 Ga0068868_1001231201 465
304 3300005340 Ga0070689_100019987 Ga0070689_1000199871 465
305 3300005344 Ga0070661_100000537 Ga0070661_10000053722 465
306 3300005355 Ga0070671_100137328 Ga0070671_1001373282 465
307 3300005367 Ga0070667_100095018 Ga0070667_1000950182 465
308 3300005457 Ga0070662_100009876 Ga0070662_1000098763 465
309 3300005459 Ga0068867_100003263 Ga0068867_1000032632 465
310 3300005535 Ga0070684_100053747 Ga0070684_1000537473 465
311 3300005539 Ga0068853_100020667 Ga0068853_1000206674 465
312 3300005548 Ga0070665_100014535 Ga0070665_1000145354 465
313 3300005564 Ga0070664_100002488 Ga0070664_1000024887 465
314 3300005564 Ga0070664_100078451 Ga0070664_1000784512 465
315 3300005578 Ga0068854_100123533 Ga0068854_1001235332 465
316 3300005614 Ga0068856_100223760 Ga0068856_1002237601 465
317 3300005616 Ga0068852_100033980 Ga0068852_1000339803 465
318 3300005617 Ga0068859_100036769 Ga0068859_1000367694 465
319 3300005618 Ga0068864_100034223 Ga0068864_1000342232 465
320 3300005718 Ga0068866_10034795 Ga0068866_100347952 465
321 3300005842 Ga0068858_100107060 Ga0068858_1001070602 465
322 3300005842 Ga0068858_100144842 Ga0068858_1001448422 465
323 3300005843 Ga0068860_100101866 Ga0068860_1001018662 465
324 3300006931 Ga0097620_100036770 Ga0097620_1000367702 465
325 3300009174 Ga0105241_10120579 Ga0105241_101205792 465
326 3300009177 Ga0105248_10291379 Ga0105248_102913792 465
327 3300013100 Ga0157373_10028143 Ga0157373_100281433 465
328 3300013104 Ga0157370_10001825 Ga0157370_100018258 465
329 3300013296 Ga0157374_10007946 Ga0157374_100079463 465
330 3300013306 Ga0163162_10054377 Ga0163162_100543771 465
331 3300013308 Ga0157375_10006512 Ga0157375_100065122 465
332 3300013308 Ga0157375_10048419 Ga0157375_100484194 465
333 3300013308 Ga0157375_10192959 Ga0157375_101929592 465
334 3300014325 Ga0163163_10114118 Ga0163163_101141182 465
335 3300014968 Ga0157379_10032127 Ga0157379_100321273 465
336 3300014969 Ga0157376_10032526 Ga0157376_100325262 465
337 3300017792 Ga0163161_10010401 Ga0163161_100104014 465
338 3300025903 Ga0207680_10003322 Ga0207680_100033226 465
339 3300025907 Ga0207645_10015292 Ga0207645_100152922 465
340 3300025920 Ga0207649_10028757 Ga0207649_100287573 465
341 3300025931 Ga0207644_10104999 Ga0207644_101049992 465
342 3300025933 Ga0207706_10009220 Ga0207706_100092202 465
343 3300025942 Ga0207689_10017871 Ga0207689_100178714 465
344 3300025942 Ga0207689_10146260 Ga0207689_101462601 465
345 3300025944 Ga0207661_10047939 Ga0207661_100479393 465
346 3300025944 Ga0207661_10059286 Ga0207661_100592863 465
347 3300025945 Ga0207679_10000751 Ga0207679_100007516 465
348 3300025945 Ga0207679_10162320 Ga0207679_101623202 465
349 3300026035 Ga0207703_10043044 Ga0207703_100430442 465
350 3300026041 Ga0207639_10078824 Ga0207639_100788242 465
351 3300026118 Ga0207675_100016558 Ga0207675_1000165585 465
352 3300026121 Ga0207683_10085551 Ga0207683_100855512 465
353 3300028379 Ga0268266_10017916 Ga0268266_100179163 465
354 3300053085 Ga0495619_0137540 Ga0495619_0137540_225_1631 465
355 3300003203 JGI25406J46586_10000891 JGI25406J46586_1000089110 467
356 3300005327 Ga0070658_10103732 Ga0070658_101037321 467
357 3300005329 Ga0070683_100014341 Ga0070683_1000143415 467
358 3300005339 Ga0070660_100108592 Ga0070660_1001085922 467
359 3300005457 Ga0070662_100153931 Ga0070662_1001539312 467
360 3300005563 Ga0068855_100307796 Ga0068855_1003077962 467
361 3300005616 Ga0068852_100061913 Ga0068852_1000619132 467
362 3300005985 Ga0081539_10001586 Ga0081539_1000158627 467
363 3300006237 Ga0097621_100105447 Ga0097621_1001054471 467
364 3300013100 Ga0157373_10046238 Ga0157373_100462383 467
365 3300013102 Ga0157371_10066284 Ga0157371_100662843 467
366 3300013104 Ga0157370_10230227 Ga0157370_102302271 467
367 3300013296 Ga0157374_10028471 Ga0157374_100284713 467
368 3300014745 Ga0157377_10050567 Ga0157377_100505672 467
369 3300025919 Ga0207657_10045102 Ga0207657_100451022 467
370 3300025933 Ga0207706_10059535 Ga0207706_100595352 467
371 3300025944 Ga0207661_10009743 Ga0207661_100097434 467
372 3300031251 Ga0265327_10071456 Ga0265327_100714561 467
373 3300046648 Ga0495611_0000757 Ga0495611_0000757_5767_7182 467
374 3300005539 Ga0068853_100008148 Ga0068853_1000081481 469
375 3300009093 Ga0105240_10025992 Ga0105240_100259924 469
376 3300009551 Ga0105238_10018791 Ga0105238_100187914 469
377 3300025934 Ga0207686_10103684 Ga0207686_101036841 469
378 3300033180 Ga0307510_10001319 Ga0307510_100013198 469
379 3300005367 Ga0070667_100028970 Ga0070667_1000289702 470
380 3300025986 Ga0207658_10075663 Ga0207658_100756632 470
381 3300001979 JGI24740J21852_10024878 JGI24740J21852_100248782 471
382 3300010375 Ga0105239_10007261 Ga0105239_1000726111 471
383 3300025904 Ga0207647_10022722 Ga0207647_100227224 471

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04916

Phospholip_B

Phospholipase B

79

343

0.82

Structural Annotation

Top 5 Hits

ID Description Score Start End
2x1c-assembly2.cif.gz_B the crystal structure of precursor acyl coenzyme a:isopenicillin n acyltransferase from penicillium chrysogenum 0.8579 46 433
2x1e-assembly2.cif.gz_B the crystal structure of mature acyl coenzyme a:isopenicillin n acyltransferase from penicillium chrysogenum in complex 6- aminopenicillanic acid 0.8529 46 433
2x1e-assembly3.cif.gz_C the crystal structure of mature acyl coenzyme a:isopenicillin n acyltransferase from penicillium chrysogenum in complex 6- aminopenicillanic acid 0.8407 46 433
2x1e-assembly1.cif.gz_A the crystal structure of mature acyl coenzyme a:isopenicillin n acyltransferase from penicillium chrysogenum in complex 6- aminopenicillanic acid 0.8339 46 433
3gvz-assembly2.cif.gz_B crystal structure of the protein cv2077 from chromobacterium violaceum. northeast structural genomics consortium target cvr62 0.8231 163 433
ID Description Score Start End Superfamily
3gvzB00 Alpha Beta;4-Layer Sandwich;Penicillin V Acylase; Chain A;Penicillin V Acylase; Chain A 0.8205 163 433 3.60.60.10
af_Q9BL07_46_577_3.60.60.30 Alpha Beta;4-Layer Sandwich;Penicillin V Acylase; Chain A; 0.7983 36 441 3.60.60.30
af_Q54PS7_44_568_3.60.60.30 Alpha Beta;4-Layer Sandwich;Penicillin V Acylase; Chain A; 0.7658 36 470 3.60.60.30
af_Q550U9_28_561_3.60.60.30 Alpha Beta;4-Layer Sandwich;Penicillin V Acylase; Chain A; 0.7594 36 470 3.60.60.30
af_Q8C0E3_415_593_2.60.120.920 Mainly Beta;Sandwich;Jelly Rolls;SPRY domain 0.7537 281 311 2.60.120.920
ID Description Score Start End GO Terms
AF-A0A537J8U5-F1-model_v4 Peptidase C45 0.9949 66 471 GO:0004620
GO:0005576
GO:0009395
AF-A0A2V7WPB5-F1-model_v4 Peptidase C45 0.9913 169 470 GO:0004620
GO:0005576
GO:0009395
AF-A0A537J8U5-F1-model_v4 Peptidase C45 0.9876 66 471 GO:0004620
GO:0005576
GO:0009395
AF-A0A1F5AGZ7-F1-model_v4 Peptidase M1 membrane alanine aminopeptidase domain-containing protein 0.9861 210 471 GO:0004620
GO:0016042
AF-A0A3D0QDT7-F1-model_v4 Peptidase C45 0.9834 385 471

Feature Viewer

pLDDT pTM Quality
92.56 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map