F429534
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 383 | 184 | 383 | 469 |
Family's Representative Sequence
| Representative Sequence | 3300005843|Ga0068860_100017322|Ga0068860_1000173224 |
| Length | 493 |
| Sequence | MVFYPNFIAIIITMHYYTPKLKLLLLIPFFALACGTGPDKTDKKDTPSAADPLARASRKDSSGWIYVHLEGSPSDIGYQHGYLLAEDIDTTLQALSTFLQHETKKDWEFYRHCAASFLWPKVDSEYKAEINGIVAGLKAKHKNYDSLDITALNAQEELAYYYVPQLMDKQKPGSGDNKAPGNCSAFIATGSYTKDGKIIIGHNNWTSYMIGQHWNVIADIVPDKGSHMLMDCMPGYIHSGDDFVITSNGILITETTITQFKGFDSTQTPEFVRARKSAQYANSIDDVIRLFVTGNNGGYANDWLIGDIKTNEVAKLELGLKDYKVWRSKDTAIAGSNFASDPKLIKEETTFSTTDPTTSPNARKKRMEQLLLVDLKGKIDLEQGQKIEADHLDVTRHTNANNKCVVCGHVDEDKKGCMEWDWPAYYPGGAVQSKITTADLAKDLKLWAHMGHPCGQDFIAAPFYKLHPEYAWQAKYLTALRAYPWTLFETKPR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 3 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 8 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 9 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 12 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 13 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 14 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 18 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 22 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 25 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 26 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 28 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 29 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 42 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 43 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 44 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 46 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 48 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 49 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 50 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 51 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 52 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 53 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 54 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 55 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 56 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 57 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 58 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 59 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 60 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 61 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 62 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 63 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 64 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 65 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 66 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 67 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 68 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 69 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 70 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 71 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 72 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 73 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 74 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 75 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 76 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 77 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 78 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 79 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 80 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 81 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 82 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 83 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 84 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 85 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 86 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 87 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 88 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 89 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 90 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 91 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 92 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 93 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 94 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 95 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 96 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 97 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 98 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 99 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 142 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 143 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 144 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 145 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 146 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 147 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 148 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 149 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 150 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 151 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 152 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 153 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 154 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 155 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 156 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 157 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 158 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 159 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 160 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 161 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 162 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 163 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 164 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 165 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 171 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 172 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 173 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 174 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 175 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 176 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 177 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 178 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 179 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 180 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 181 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 182 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 183 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 184 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.48 |
| Metatranscriptomes | 0.52 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 6.79 |
| Nodule | 0 |
| Rhizoplane | 0.26 |
| Rhizosphere | 87.21 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.74 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10024878 | 3300001979 | Bacteria | 2024 |
| 2 | JGI24744J21845_10007427 | 3300002077 | Bacteria | 2265 |
| 3 | JGI25162J39368_1001033 | 3300002737 | Bacteria | 17196 |
| 4 | JGI25406J46586_10000891 | 3300003203 | Bacteria | 14043 |
| 5 | JGI25165J46597_1000678 | 3300003214 | Bacteria | 27401 |
| 6 | JGI25153J46596_10014113 | 3300003215 | Unclassified | 3340 |
| 7 | rootH2_10003984 | 3300003320 | Bacteria | 13672 |
| 8 | rootH2_10010257 | 3300003320 | Bacteria | 3231 |
| 9 | rootH2_10012322 | 3300003320 | Bacteria | 30567 |
| 10 | rootH2_10019694 | 3300003320 | Bacteria | 26743 |
| 11 | rootH2_10060489 | 3300003320 | Bacteria | 5673 |
| 12 | rootH2_10082380 | 3300003320 | Bacteria | 4443 |
| 13 | rootH1_10002303 | 3300003323 | Bacteria | 27478 |
| 14 | rootH1_10064719 | 3300003323 | Bacteria | 4262 |
| 15 | rootH1_10091166 | 3300003323 | Bacteria | 4456 |
| 16 | JGI25160J50197_1004449 | 3300003354 | Bacteria | 6062 |
| 17 | Ga0055526_1009755 | 3300003771 | Bacteria | 4567 |
| 18 | Ga0055528_1001348 | 3300003790 | Bacteria | 15180 |
| 19 | Ga0055530_10005304 | 3300003791 | Bacteria | 6188 |
| 20 | Ga0058863_11409933 | 3300004799 | Bacteria | 3062 |
| 21 | Ga0058862_12260637 | 3300004803 | Bacteria | 2016 |
| 22 | Ga0065165_1000127 | 3300005262 | Bacteria | 129837 |
| 23 | Ga0065714_10007844 | 3300005288 | Bacteria | 4690 |
| 24 | Ga0065712_10076262 | 3300005290 | Unclassified | 3694 |
| 25 | Ga0070658_10000153 | 3300005327 | Bacteria | 60625 |
| 26 | Ga0070658_10103732 | 3300005327 | Bacteria | 2352 |
| 27 | Ga0070676_10004225 | 3300005328 | Bacteria | 7543 |
| 28 | Ga0070676_10007843 | 3300005328 | Bacteria | 5739 |
| 29 | Ga0070676_10022171 | 3300005328 | Unclassified | 3560 |
| 30 | Ga0070683_100000329 | 3300005329 | Bacteria | 32745 |
| 31 | Ga0070683_100014341 | 3300005329 | Bacteria | 6931 |
| 32 | Ga0070683_100018315 | 3300005329 | Bacteria | 6200 |
| 33 | Ga0070690_100023911 | 3300005330 | Bacteria | 3753 |
| 34 | Ga0070670_100006244 | 3300005331 | Bacteria | 10083 |
| 35 | Ga0068869_100027695 | 3300005334 | Bacteria | 3953 |
| 36 | Ga0070680_100002040 | 3300005336 | Bacteria | 14896 |
| 37 | Ga0068868_100000726 | 3300005338 | Bacteria | 22242 |
| 38 | Ga0068868_100024954 | 3300005338 | Unclassified | 4540 |
| 39 | Ga0068868_100123120 | 3300005338 | Bacteria | 2116 |
| 40 | Ga0070660_100108592 | 3300005339 | Bacteria | 2205 |
| 41 | Ga0070689_100019987 | 3300005340 | Bacteria | 4962 |
| 42 | Ga0070689_100044019 | 3300005340 | Bacteria | 3434 |
| 43 | Ga0070687_100011272 | 3300005343 | Bacteria | 3906 |
| 44 | Ga0070661_100000537 | 3300005344 | Bacteria | 29079 |
| 45 | Ga0070675_100017851 | 3300005354 | Bacteria | 5644 |
| 46 | Ga0070671_100004940 | 3300005355 | Bacteria | 10606 |
| 47 | Ga0070671_100137328 | 3300005355 | Bacteria | 2061 |
| 48 | Ga0070673_100006095 | 3300005364 | Bacteria | 7813 |
| 49 | Ga0070659_100000375 | 3300005366 | Bacteria | 33764 |
| 50 | Ga0070667_100028970 | 3300005367 | Unclassified | 4611 |
| 51 | Ga0070667_100095018 | 3300005367 | Bacteria | 2569 |
| 52 | Ga0070678_100006885 | 3300005456 | Bacteria | 6707 |
| 53 | Ga0070662_100002650 | 3300005457 | Bacteria | 11037 |
| 54 | Ga0070662_100009876 | 3300005457 | Bacteria | 6253 |
| 55 | Ga0070662_100153931 | 3300005457 | Bacteria | 1793 |
| 56 | Ga0070681_10053940 | 3300005458 | Bacteria | 4006 |
| 57 | Ga0068867_100001333 | 3300005459 | Bacteria | 17102 |
| 58 | Ga0068867_100003263 | 3300005459 | Bacteria | 11430 |
| 59 | Ga0070685_10014014 | 3300005466 | Bacteria | 4242 |
| 60 | Ga0070685_10018137 | 3300005466 | Unclassified | 3779 |
| 61 | Ga0070698_100001240 | 3300005471 | Bacteria | 28441 |
| 62 | Ga0070698_100015839 | 3300005471 | Bacteria | 7962 |
| 63 | Ga0070679_100005927 | 3300005530 | Bacteria | 11355 |
| 64 | Ga0070684_100001858 | 3300005535 | Bacteria | 15463 |
| 65 | Ga0070684_100053747 | 3300005535 | Bacteria | 3508 |
| 66 | Ga0068853_100008148 | 3300005539 | Bacteria | 8410 |
| 67 | Ga0068853_100020667 | 3300005539 | Bacteria | 5476 |
| 68 | Ga0068853_100058802 | 3300005539 | Bacteria | 3320 |
| 69 | Ga0068853_100066776 | 3300005539 | Unclassified | 3124 |
| 70 | Ga0070665_100000372 | 3300005548 | Bacteria | 66748 |
| 71 | Ga0070665_100014535 | 3300005548 | Bacteria | 7898 |
| 72 | Ga0070665_100290173 | 3300005548 | Bacteria | 1638 |
| 73 | Ga0068855_100000224 | 3300005563 | Bacteria | 72367 |
| 74 | Ga0068855_100000341 | 3300005563 | Bacteria | 57937 |
| 75 | Ga0068855_100002344 | 3300005563 | Bacteria | 23381 |
| 76 | Ga0068855_100065723 | 3300005563 | Bacteria | 4229 |
| 77 | Ga0068855_100137266 | 3300005563 | Bacteria | 2789 |
| 78 | Ga0068855_100307796 | 3300005563 | Bacteria | 1753 |
| 79 | Ga0070664_100002488 | 3300005564 | Bacteria | 14847 |
| 80 | Ga0070664_100064981 | 3300005564 | Bacteria | 3112 |
| 81 | Ga0070664_100078451 | 3300005564 | Bacteria | 2841 |
| 82 | Ga0068857_100054142 | 3300005577 | Bacteria | 3560 |
| 83 | Ga0068854_100123533 | 3300005578 | Bacteria | 1968 |
| 84 | Ga0068856_100001358 | 3300005614 | Bacteria | 25722 |
| 85 | Ga0068856_100003057 | 3300005614 | Bacteria | 17112 |
| 86 | Ga0068856_100015071 | 3300005614 | Bacteria | 7468 |
| 87 | Ga0068856_100032847 | 3300005614 | Bacteria | 5082 |
| 88 | Ga0068856_100223760 | 3300005614 | Bacteria | 1897 |
| 89 | Ga0068852_100000197 | 3300005616 | Bacteria | 41267 |
| 90 | Ga0068852_100007464 | 3300005616 | Bacteria | 7979 |
| 91 | Ga0068852_100033980 | 3300005616 | Bacteria | 4241 |
| 92 | Ga0068852_100061913 | 3300005616 | Bacteria | 3253 |
| 93 | Ga0068859_100036769 | 3300005617 | Unclassified | 4915 |
| 94 | Ga0068859_100078746 | 3300005617 | Bacteria | 3336 |
| 95 | Ga0068859_100116098 | 3300005617 | Bacteria | 2741 |
| 96 | Ga0068864_100015939 | 3300005618 | Bacteria | 6255 |
| 97 | Ga0068864_100017832 | 3300005618 | Bacteria | 5921 |
| 98 | Ga0068864_100028548 | 3300005618 | Bacteria | 4718 |
| 99 | Ga0068864_100034223 | 3300005618 | Bacteria | 4320 |
| 100 | Ga0068866_10034795 | 3300005718 | Unclassified | 2456 |
| 101 | Ga0068858_100107060 | 3300005842 | Bacteria | 2609 |
| 102 | Ga0068858_100144842 | 3300005842 | Bacteria | 2231 |
| 103 | Ga0068860_100000060 | 3300005843 | Bacteria | 195631 |
| 104 | Ga0068860_100017322 | 3300005843 | Bacteria | 7020 |
| 105 | Ga0068860_100101866 | 3300005843 | Bacteria | 2739 |
| 106 | Ga0081539_10001586 | 3300005985 | Bacteria | 37565 |
| 107 | Ga0097621_100001155 | 3300006237 | Bacteria | 18347 |
| 108 | Ga0097621_100010363 | 3300006237 | Bacteria | 6815 |
| 109 | Ga0097621_100105447 | 3300006237 | Bacteria | 2377 |
| 110 | Ga0097621_100105555 | 3300006237 | Bacteria | 2375 |
| 111 | Ga0068871_100000141 | 3300006358 | Bacteria | 46656 |
| 112 | Ga0075428_100017514 | 3300006844 | Bacteria | 7915 |
| 113 | Ga0068865_100000847 | 3300006881 | Bacteria | 17301 |
| 114 | Ga0097620_100036770 | 3300006931 | Unclassified | 4915 |
| 115 | Ga0097620_100078743 | 3300006931 | Bacteria | 3336 |
| 116 | Ga0097620_100116096 | 3300006931 | Bacteria | 2741 |
| 117 | Ga0105240_10000100 | 3300009093 | Bacteria | 176640 |
| 118 | Ga0105240_10000268 | 3300009093 | Bacteria | 102828 |
| 119 | Ga0105240_10000570 | 3300009093 | Bacteria | 68288 |
| 120 | Ga0105240_10005272 | 3300009093 | Bacteria | 19301 |
| 121 | Ga0105240_10025992 | 3300009093 | Bacteria | 7689 |
| 122 | Ga0105240_10028314 | 3300009093 | Bacteria | 7320 |
| 123 | Ga0105240_10028879 | 3300009093 | Bacteria | 7234 |
| 124 | Ga0105240_10101158 | 3300009093 | Unclassified | 3506 |
| 125 | Ga0105240_10122090 | 3300009093 | Bacteria | 3136 |
| 126 | Ga0105245_10060655 | 3300009098 | Bacteria | 3407 |
| 127 | Ga0105241_10002013 | 3300009174 | Bacteria | 15372 |
| 128 | Ga0105241_10003868 | 3300009174 | Bacteria | 11099 |
| 129 | Ga0105241_10004311 | 3300009174 | Bacteria | 10519 |
| 130 | Ga0105241_10005560 | 3300009174 | Bacteria | 9308 |
| 131 | Ga0105241_10028951 | 3300009174 | Bacteria | 4128 |
| 132 | Ga0105241_10120579 | 3300009174 | Bacteria | 2111 |
| 133 | Ga0105241_10220062 | 3300009174 | Bacteria | 1595 |
| 134 | Ga0105242_10056851 | 3300009176 | Unclassified | 3202 |
| 135 | Ga0105242_10113823 | 3300009176 | Bacteria | 2311 |
| 136 | Ga0105248_10260468 | 3300009177 | Unclassified | 1952 |
| 137 | Ga0105248_10291379 | 3300009177 | Bacteria | 1838 |
| 138 | Ga0105237_10006232 | 3300009545 | Bacteria | 13286 |
| 139 | Ga0105237_10006561 | 3300009545 | Bacteria | 12869 |
| 140 | Ga0105237_10013534 | 3300009545 | Bacteria | 8550 |
| 141 | Ga0105237_10017183 | 3300009545 | Bacteria | 7505 |
| 142 | Ga0105237_10019257 | 3300009545 | Bacteria | 7050 |
| 143 | Ga0105237_10150572 | 3300009545 | Bacteria | 2323 |
| 144 | Ga0105237_10209306 | 3300009545 | Bacteria | 1950 |
| 145 | Ga0105238_10002725 | 3300009551 | Bacteria | 17595 |
| 146 | Ga0105238_10018791 | 3300009551 | Bacteria | 7036 |
| 147 | Ga0105238_10021406 | 3300009551 | Bacteria | 6587 |
| 148 | Ga0105238_10106565 | 3300009551 | Bacteria | 2784 |
| 149 | Ga0105249_10001205 | 3300009553 | Bacteria | 22829 |
| 150 | Ga0105249_10008771 | 3300009553 | Bacteria | 8824 |
| 151 | Ga0105249_10010240 | 3300009553 | Bacteria | 8235 |
| 152 | Ga0105249_10011122 | 3300009553 | Bacteria | 7906 |
| 153 | Ga0105239_10000811 | 3300010375 | Bacteria | 44304 |
| 154 | Ga0105239_10001523 | 3300010375 | Bacteria | 30768 |
| 155 | Ga0105239_10003552 | 3300010375 | Bacteria | 19067 |
| 156 | Ga0105239_10007261 | 3300010375 | Bacteria | 12728 |
| 157 | Ga0105239_10016202 | 3300010375 | Bacteria | 8246 |
| 158 | Ga0105239_10075621 | 3300010375 | Unclassified | 3703 |
| 159 | Ga0105239_10137540 | 3300010375 | Bacteria | 2720 |
| 160 | Ga0105246_10080985 | 3300011119 | Bacteria | 2313 |
| 161 | Ga0105246_10143618 | 3300011119 | Bacteria | 1798 |
| 162 | Ga0157373_10028143 | 3300013100 | Bacteria | 4055 |
| 163 | Ga0157373_10044183 | 3300013100 | Bacteria | 3181 |
| 164 | Ga0157373_10046238 | 3300013100 | Bacteria | 3105 |
| 165 | Ga0157371_10066284 | 3300013102 | Bacteria | 2557 |
| 166 | Ga0157370_10001825 | 3300013104 | Bacteria | 26235 |
| 167 | Ga0157370_10009749 | 3300013104 | Bacteria | 10198 |
| 168 | Ga0157370_10101212 | 3300013104 | Bacteria | 2699 |
| 169 | Ga0157370_10230227 | 3300013104 | Bacteria | 1715 |
| 170 | Ga0157369_10068298 | 3300013105 | Bacteria | 3818 |
| 171 | Ga0157374_10000004 | 3300013296 | Bacteria | 759774 |
| 172 | Ga0157374_10004899 | 3300013296 | Bacteria | 11233 |
| 173 | Ga0157374_10007946 | 3300013296 | Bacteria | 9060 |
| 174 | Ga0157374_10009267 | 3300013296 | Bacteria | 8440 |
| 175 | Ga0157374_10018679 | 3300013296 | Bacteria | 6123 |
| 176 | Ga0157374_10027177 | 3300013296 | Bacteria | 5158 |
| 177 | Ga0157374_10028471 | 3300013296 | Bacteria | 5047 |
| 178 | Ga0157378_10009438 | 3300013297 | Bacteria | 8503 |
| 179 | Ga0157378_10064296 | 3300013297 | Bacteria | 3281 |
| 180 | Ga0157378_10179900 | 3300013297 | Bacteria | 1989 |
| 181 | Ga0163162_10001202 | 3300013306 | Bacteria | 24155 |
| 182 | Ga0163162_10004888 | 3300013306 | Bacteria | 12922 |
| 183 | Ga0163162_10054377 | 3300013306 | Bacteria | 4027 |
| 184 | Ga0157372_10007279 | 3300013307 | Bacteria | 11785 |
| 185 | Ga0157372_10058353 | 3300013307 | Unclassified | 4314 |
| 186 | Ga0157372_10095588 | 3300013307 | Bacteria | 3385 |
| 187 | Ga0157372_10096978 | 3300013307 | Bacteria | 3361 |
| 188 | Ga0157372_10113150 | 3300013307 | Bacteria | 3110 |
| 189 | Ga0157375_10006512 | 3300013308 | Bacteria | 10164 |
| 190 | Ga0157375_10043043 | 3300013308 | Bacteria | 4376 |
| 191 | Ga0157375_10048419 | 3300013308 | Unclassified | 4158 |
| 192 | Ga0157375_10192959 | 3300013308 | Unclassified | 2192 |
| 193 | Ga0157375_10339557 | 3300013308 | Bacteria | 1667 |
| 194 | Ga0163163_10114118 | 3300014325 | Bacteria | 2732 |
| 195 | Ga0163163_10151995 | 3300014325 | Bacteria | 2358 |
| 196 | Ga0157377_10015702 | 3300014745 | Bacteria | 3881 |
| 197 | Ga0157377_10050567 | 3300014745 | Bacteria | 2341 |
| 198 | Ga0157379_10032127 | 3300014968 | Bacteria | 4678 |
| 199 | Ga0157376_10001335 | 3300014969 | Bacteria | 16278 |
| 200 | Ga0157376_10032526 | 3300014969 | Bacteria | 4189 |
| 201 | Ga0157376_10035560 | 3300014969 | Bacteria | 4030 |
| 202 | Ga0163161_10010401 | 3300017792 | Bacteria | 6442 |
| 203 | Ga0163161_10042247 | 3300017792 | Bacteria | 3278 |
| 204 | Ga0209563_105246 | 3300025230 | Bacteria | 2374 |
| 205 | Ga0207427_100025 | 3300025231 | Bacteria | 433726 |
| 206 | Ga0209437_100010 | 3300025233 | Bacteria | 838447 |
| 207 | Ga0209233_1000017 | 3300025261 | Bacteria | 898076 |
| 208 | Ga0209455_1001523 | 3300025272 | Bacteria | 10351 |
| 209 | Ga0209673_1000034 | 3300025273 | Bacteria | 328788 |
| 210 | Ga0209675_1025421 | 3300025291 | Bacteria | 1493 |
| 211 | Ga0209564_1004382 | 3300025295 | Bacteria | 8668 |
| 212 | Ga0209758_1004388 | 3300025297 | Bacteria | 11777 |
| 213 | Ga0209050_1000673 | 3300025298 | Bacteria | 51628 |
| 214 | Ga0207426_1000329 | 3300025302 | Bacteria | 90476 |
| 215 | Ga0209051_1029713 | 3300025303 | Bacteria | 2134 |
| 216 | Ga0209257_1001183 | 3300025304 | Bacteria | 32997 |
| 217 | Ga0207680_10003322 | 3300025903 | Bacteria | 7576 |
| 218 | Ga0207647_10008184 | 3300025904 | Bacteria | 7513 |
| 219 | Ga0207647_10022722 | 3300025904 | Unclassified | 4161 |
| 220 | Ga0207645_10000035 | 3300025907 | Bacteria | 89345 |
| 221 | Ga0207645_10000821 | 3300025907 | Bacteria | 26045 |
| 222 | Ga0207645_10015292 | 3300025907 | Bacteria | 5104 |
| 223 | Ga0207705_10000108 | 3300025909 | Bacteria | 93501 |
| 224 | Ga0207654_10005764 | 3300025911 | Bacteria | 6254 |
| 225 | Ga0207654_10043314 | 3300025911 | Bacteria | 2551 |
| 226 | Ga0207707_10014728 | 3300025912 | Bacteria | 6814 |
| 227 | Ga0207695_10000027 | 3300025913 | Bacteria | 612456 |
| 228 | Ga0207695_10000073 | 3300025913 | Bacteria | 312565 |
| 229 | Ga0207695_10000164 | 3300025913 | Bacteria | 196777 |
| 230 | Ga0207695_10000775 | 3300025913 | Bacteria | 60574 |
| 231 | Ga0207695_10024707 | 3300025913 | Bacteria | 6749 |
| 232 | Ga0207695_10026501 | 3300025913 | Bacteria | 6470 |
| 233 | Ga0207695_10034063 | 3300025913 | Bacteria | 5546 |
| 234 | Ga0207695_10081046 | 3300025913 | Bacteria | 3286 |
| 235 | Ga0207695_10083883 | 3300025913 | Unclassified | 3218 |
| 236 | Ga0207695_10144145 | 3300025913 | Bacteria | 2328 |
| 237 | Ga0207695_10162202 | 3300025913 | Bacteria | 2166 |
| 238 | Ga0207671_10004251 | 3300025914 | Bacteria | 13785 |
| 239 | Ga0207671_10009599 | 3300025914 | Bacteria | 8066 |
| 240 | Ga0207671_10011844 | 3300025914 | Bacteria | 7057 |
| 241 | Ga0207671_10033281 | 3300025914 | Bacteria | 3835 |
| 242 | Ga0207671_10040152 | 3300025914 | Unclassified | 3464 |
| 243 | Ga0207671_10041850 | 3300025914 | Bacteria | 3391 |
| 244 | Ga0207671_10070512 | 3300025914 | Bacteria | 2606 |
| 245 | Ga0207671_10096872 | 3300025914 | Bacteria | 2230 |
| 246 | Ga0207662_10020460 | 3300025918 | Bacteria | 3777 |
| 247 | Ga0207657_10025916 | 3300025919 | Bacteria | 5399 |
| 248 | Ga0207657_10045102 | 3300025919 | Bacteria | 3871 |
| 249 | Ga0207657_10057330 | 3300025919 | Bacteria | 3356 |
| 250 | Ga0207649_10028757 | 3300025920 | Bacteria | 3276 |
| 251 | Ga0207649_10087521 | 3300025920 | Bacteria | 2032 |
| 252 | Ga0207681_10043129 | 3300025923 | Unclassified | 3018 |
| 253 | Ga0207694_10035422 | 3300025924 | Unclassified | 3829 |
| 254 | Ga0207650_10122252 | 3300025925 | Bacteria | 2028 |
| 255 | Ga0207659_10184466 | 3300025926 | Bacteria | 1656 |
| 256 | Ga0207687_10048534 | 3300025927 | Bacteria | 2948 |
| 257 | Ga0207644_10023288 | 3300025931 | Bacteria | 4240 |
| 258 | Ga0207644_10104999 | 3300025931 | Bacteria | 2128 |
| 259 | Ga0207690_10002170 | 3300025932 | Bacteria | 11970 |
| 260 | Ga0207706_10001112 | 3300025933 | Bacteria | 27374 |
| 261 | Ga0207706_10009220 | 3300025933 | Bacteria | 9066 |
| 262 | Ga0207706_10051986 | 3300025933 | Bacteria | 3618 |
| 263 | Ga0207706_10059535 | 3300025933 | Bacteria | 3363 |
| 264 | Ga0207706_10134510 | 3300025933 | Bacteria | 2174 |
| 265 | Ga0207686_10000566 | 3300025934 | Bacteria | 23556 |
| 266 | Ga0207686_10103684 | 3300025934 | Bacteria | 1904 |
| 267 | Ga0207670_10043839 | 3300025936 | Bacteria | 2957 |
| 268 | Ga0207704_10000036 | 3300025938 | Bacteria | 94574 |
| 269 | Ga0207704_10078093 | 3300025938 | Unclassified | 2128 |
| 270 | Ga0207689_10017871 | 3300025942 | Bacteria | 5989 |
| 271 | Ga0207689_10146260 | 3300025942 | Unclassified | 1947 |
| 272 | Ga0207661_10009743 | 3300025944 | Bacteria | 6900 |
| 273 | Ga0207661_10021094 | 3300025944 | Bacteria | 4880 |
| 274 | Ga0207661_10047939 | 3300025944 | Bacteria | 3393 |
| 275 | Ga0207661_10059286 | 3300025944 | Unclassified | 3084 |
| 276 | Ga0207661_10078576 | 3300025944 | Bacteria | 2717 |
| 277 | Ga0207679_10000751 | 3300025945 | Bacteria | 21527 |
| 278 | Ga0207679_10001121 | 3300025945 | Bacteria | 17095 |
| 279 | Ga0207679_10162320 | 3300025945 | Bacteria | 1831 |
| 280 | Ga0207667_10000266 | 3300025949 | Bacteria | 72382 |
| 281 | Ga0207667_10000411 | 3300025949 | Bacteria | 57956 |
| 282 | Ga0207667_10001830 | 3300025949 | Bacteria | 26721 |
| 283 | Ga0207667_10012886 | 3300025949 | Bacteria | 9606 |
| 284 | Ga0207667_10013280 | 3300025949 | Bacteria | 9434 |
| 285 | Ga0207667_10106915 | 3300025949 | Bacteria | 2886 |
| 286 | Ga0207651_10013629 | 3300025960 | Bacteria | 4660 |
| 287 | Ga0207651_10070789 | 3300025960 | Bacteria | 2469 |
| 288 | Ga0207712_10005253 | 3300025961 | Bacteria | 8191 |
| 289 | Ga0207712_10005755 | 3300025961 | Bacteria | 7814 |
| 290 | Ga0207712_10006416 | 3300025961 | Bacteria | 7422 |
| 291 | Ga0207640_10034093 | 3300025981 | Bacteria | 3174 |
| 292 | Ga0207658_10075663 | 3300025986 | Unclassified | 2562 |
| 293 | Ga0207703_10043044 | 3300026035 | Bacteria | 3623 |
| 294 | Ga0207639_10078824 | 3300026041 | Bacteria | 2601 |
| 295 | Ga0207639_10139983 | 3300026041 | Bacteria | 2015 |
| 296 | Ga0207639_10175668 | 3300026041 | Unclassified | 1818 |
| 297 | Ga0207702_10001407 | 3300026078 | Bacteria | 24021 |
| 298 | Ga0207702_10004956 | 3300026078 | Bacteria | 11696 |
| 299 | Ga0207641_10005426 | 3300026088 | Bacteria | 10884 |
| 300 | Ga0207648_10006086 | 3300026089 | Bacteria | 12032 |
| 301 | Ga0207648_10013332 | 3300026089 | Bacteria | 7653 |
| 302 | Ga0207676_10002842 | 3300026095 | Bacteria | 12326 |
| 303 | Ga0207676_10022021 | 3300026095 | Bacteria | 4683 |
| 304 | Ga0207674_10042338 | 3300026116 | Bacteria | 4704 |
| 305 | Ga0207674_10079879 | 3300026116 | Bacteria | 3274 |
| 306 | Ga0207674_10084035 | 3300026116 | Bacteria | 3182 |
| 307 | Ga0207674_10230029 | 3300026116 | Bacteria | 1802 |
| 308 | Ga0207675_100016558 | 3300026118 | Bacteria | 6884 |
| 309 | Ga0207675_100036164 | 3300026118 | Bacteria | 4606 |
| 310 | Ga0207675_100038705 | 3300026118 | Bacteria | 4450 |
| 311 | Ga0207683_10000982 | 3300026121 | Bacteria | 26175 |
| 312 | Ga0207683_10002737 | 3300026121 | Bacteria | 15399 |
| 313 | Ga0207683_10085551 | 3300026121 | Bacteria | 2803 |
| 314 | Ga0207698_10010995 | 3300026142 | Bacteria | 5850 |
| 315 | Ga0207698_10036047 | 3300026142 | Bacteria | 3626 |
| 316 | Ga0207698_10083920 | 3300026142 | Bacteria | 2580 |
| 317 | Ga0268266_10000658 | 3300028379 | Bacteria | 46741 |
| 318 | Ga0268266_10017916 | 3300028379 | Bacteria | 6037 |
| 319 | Ga0268266_10068549 | 3300028379 | Bacteria | 3072 |
| 320 | Ga0268264_10000243 | 3300028381 | Bacteria | 102854 |
| 321 | Ga0268264_10011532 | 3300028381 | Bacteria | 7302 |
| 322 | Ga0268264_10055834 | 3300028381 | Unclassified | 3300 |
| 323 | Ga0268264_10177847 | 3300028381 | Unclassified | 1930 |
| 324 | Ga0307517_10004407 | 3300028786 | Bacteria | 21615 |
| 325 | Ga0307515_10003374 | 3300028794 | Bacteria | 33668 |
| 326 | Ga0307515_10019936 | 3300028794 | Bacteria | 12013 |
| 327 | Ga0265338_10022351 | 3300028800 | Bacteria | 6551 |
| 328 | Ga0307511_10001438 | 3300030521 | Bacteria | 25120 |
| 329 | Ga0265327_10000099 | 3300031251 | Bacteria | 190474 |
| 330 | Ga0265327_10071456 | 3300031251 | Bacteria | 1736 |
| 331 | Ga0307509_10036410 | 3300031507 | Bacteria | 5388 |
| 332 | Ga0307508_10185407 | 3300031616 | Bacteria | 1683 |
| 333 | Ga0307516_10000330 | 3300031730 | Bacteria | 61733 |
| 334 | Ga0307516_10035988 | 3300031730 | Bacteria | 4960 |
| 335 | Ga0307507_10000034 | 3300033179 | Bacteria | 188697 |
| 336 | Ga0307510_10000366 | 3300033180 | Bacteria | 42784 |
| 337 | Ga0307510_10001319 | 3300033180 | Bacteria | 27054 |
| 338 | Ga0307510_10080817 | 3300033180 | Bacteria | 3158 |
| 339 | Ga0373941_0011630 | 3300035115 | Bacteria | 2279 |
| 340 | Ga0373935_0146306 | 3300035692 | Bacteria | 1600 |
| 341 | Ga0395899_0000034 | 3300037312 | Bacteria | 302623 |
| 342 | Ga0395899_0006152 | 3300037312 | Bacteria | 9303 |
| 343 | Ga0395900_0000346 | 3300037418 | Bacteria | 68020 |
| 344 | Ga0395900_0001482 | 3300037418 | Bacteria | 28015 |
| 345 | Ga0395900_0022444 | 3300037418 | Bacteria | 6455 |
| 346 | Ga0395905_0000528 | 3300037471 | Bacteria | 52404 |
| 347 | Ga0395905_0002267 | 3300037471 | Bacteria | 21602 |
| 348 | Ga0395901_0000351 | 3300038443 | Bacteria | 56004 |
| 349 | Ga0395901_0009231 | 3300038443 | Bacteria | 9995 |
| 350 | Ga0436365_0518530 | 3300039437 | Bacteria | 6270 |
| 351 | Ga0436361_0167348 | 3300039447 | Bacteria | 7226 |
| 352 | Ga0466972_0012980 | 3300044658 | Bacteria | 4186 |
| 353 | Ga0453683_0000182 | 3300044673 | Bacteria | 86933 |
| 354 | Ga0466961_0021970 | 3300044693 | Unclassified | 4106 |
| 355 | Ga0453684_0104849 | 3300044712 | Bacteria | 3450 |
| 356 | Ga0453684_0348993 | 3300044712 | Unclassified | 1669 |
| 357 | Ga0466971_0042273 | 3300044719 | Bacteria | 2048 |
| 358 | Ga0451576_0000903 | 3300045051 | Bacteria | 56269 |
| 359 | Ga0451576_0004314 | 3300045051 | Bacteria | 18572 |
| 360 | Ga0451576_0026580 | 3300045051 | Bacteria | 6224 |
| 361 | Ga0495638_0006439 | 3300046460 | Bacteria | 8543 |
| 362 | Ga0495585_0006589 | 3300046492 | Bacteria | 7178 |
| 363 | Ga0495616_0004750 | 3300046513 | Bacteria | 8514 |
| 364 | Ga0495628_0000313 | 3300046516 | Bacteria | 43821 |
| 365 | Ga0495648_0003901 | 3300046524 | Bacteria | 12927 |
| 366 | Ga0495609_0062244 | 3300046538 | Bacteria | 1648 |
| 367 | Ga0495633_0000072 | 3300046558 | Bacteria | 131197 |
| 368 | Ga0495668_0000165 | 3300046616 | Bacteria | 98016 |
| 369 | Ga0495611_0000757 | 3300046648 | Bacteria | 18182 |
| 370 | Ga0495625_0001492 | 3300046660 | Bacteria | 28147 |
| 371 | Ga0495625_0004553 | 3300046660 | Bacteria | 13050 |
| 372 | Ga0495625_0107198 | 3300046660 | Bacteria | 1912 |
| 373 | Ga0495683_0011808 | 3300047323 | Bacteria | 4593 |
| 374 | Ga0495687_000014 | 3300047443 | Bacteria | 366896 |
| 375 | Ga0495687_000233 | 3300047443 | Bacteria | 77056 |
| 376 | Ga0496115_0120099 | 3300048918 | Bacteria | 2162 |
| 377 | Ga0495678_017508 | 3300049459 | Bacteria | 3246 |
| 378 | Ga0495619_0137540 | 3300053085 | Bacteria | 1681 |
| 379 | Ga0500583_0001816 | 3300053092 | Bacteria | 6255 |
| 380 | Ga0500608_000343 | 3300053122 | Bacteria | 18061 |
| 381 | Ga0500618_000005 | 3300053125 | Bacteria | 253092 |
| 382 | Ga0500564_068060 | 3300053138 | Bacteria | 1609 |
| 383 | Ga0500622_0007330 | 3300053156 | Bacteria | 6274 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300026116 | Ga0207674_10079879 | Ga0207674_100798792 | 379 |
| 2 | 3300025911 | Ga0207654_10005764 | Ga0207654_100057642 | 401 |
| 3 | 3300005331 | Ga0070670_100006244 | Ga0070670_1000062445 | 425 |
| 4 | 3300005618 | Ga0068864_100028548 | Ga0068864_1000285483 | 425 |
| 5 | 3300025961 | Ga0207712_10006416 | Ga0207712_100064163 | 425 |
| 6 | 3300026095 | Ga0207676_10022021 | Ga0207676_100220213 | 425 |
| 7 | 3300044712 | Ga0453684_0348993 | Ga0453684_0348993_316_1629 | 432 |
| 8 | 3300053138 | Ga0500564_068060 | Ga0500564_068060_58_1377 | 439 |
| 9 | 3300009098 | Ga0105245_10060655 | Ga0105245_100606552 | 440 |
| 10 | 3300031730 | Ga0307516_10035988 | Ga0307516_100359883 | 443 |
| 11 | 3300025927 | Ga0207687_10048534 | Ga0207687_100485343 | 450 |
| 12 | 3300044658 | Ga0466972_0012980 | Ga0466972_0012980_1507_2910 | 450 |
| 13 | 3300005618 | Ga0068864_100015939 | Ga0068864_1000159392 | 452 |
| 14 | 3300009545 | Ga0105237_10019257 | Ga0105237_100192574 | 454 |
| 15 | 3300025914 | Ga0207671_10011844 | Ga0207671_100118444 | 454 |
| 16 | 3300003320 | rootH2_10060489 | rootH2_100604892 | 455 |
| 17 | 3300005366 | Ga0070659_100000375 | Ga0070659_10000037539 | 456 |
| 18 | 3300005466 | Ga0070685_10018137 | Ga0070685_100181374 | 456 |
| 19 | 3300005617 | Ga0068859_100116098 | Ga0068859_1001160982 | 456 |
| 20 | 3300006931 | Ga0097620_100116096 | Ga0097620_1001160962 | 456 |
| 21 | 3300025932 | Ga0207690_10002170 | Ga0207690_1000217015 | 456 |
| 22 | 3300005843 | Ga0068860_100000060 | Ga0068860_10000006039 | 457 |
| 23 | 3300009174 | Ga0105241_10220062 | Ga0105241_102200622 | 457 |
| 24 | 3300013306 | Ga0163162_10004888 | Ga0163162_100048885 | 457 |
| 25 | 3300028381 | Ga0268264_10000243 | Ga0268264_1000024361 | 457 |
| 26 | 3300044673 | Ga0453683_0000182 | Ga0453683_0000182_56555_57964 | 457 |
| 27 | 3300044712 | Ga0453684_0104849 | Ga0453684_0104849_959_2368 | 457 |
| 28 | 3300045051 | Ga0451576_0000903 | Ga0451576_0000903_28461_29870 | 457 |
| 29 | 3300045051 | Ga0451576_0004314 | Ga0451576_0004314_12553_13962 | 457 |
| 30 | 3300046460 | Ga0495638_0006439 | Ga0495638_0006439_5573_6973 | 457 |
| 31 | 3300046524 | Ga0495648_0003901 | Ga0495648_0003901_9907_11307 | 457 |
| 32 | 3300047443 | Ga0495687_000014 | Ga0495687_000014_278797_280197 | 457 |
| 33 | 3300053092 | Ga0500583_0001816 | Ga0500583_0001816_1725_3125 | 457 |
| 34 | 3300053156 | Ga0500622_0007330 | Ga0500622_0007330_614_2014 | 457 |
| 35 | 3300002077 | JGI24744J21845_10007427 | JGI24744J21845_100074271 | 458 |
| 36 | 3300005328 | Ga0070676_10004225 | Ga0070676_100042252 | 458 |
| 37 | 3300005340 | Ga0070689_100044019 | Ga0070689_1000440191 | 458 |
| 38 | 3300005354 | Ga0070675_100017851 | Ga0070675_1000178513 | 458 |
| 39 | 3300005364 | Ga0070673_100006095 | Ga0070673_1000060957 | 458 |
| 40 | 3300005456 | Ga0070678_100006885 | Ga0070678_1000068854 | 458 |
| 41 | 3300005457 | Ga0070662_100002650 | Ga0070662_1000026501 | 458 |
| 42 | 3300005459 | Ga0068867_100001333 | Ga0068867_1000013335 | 458 |
| 43 | 3300005535 | Ga0070684_100001858 | Ga0070684_10000185812 | 458 |
| 44 | 3300005539 | Ga0068853_100058802 | Ga0068853_1000588022 | 458 |
| 45 | 3300005564 | Ga0070664_100064981 | Ga0070664_1000649812 | 458 |
| 46 | 3300005616 | Ga0068852_100007464 | Ga0068852_1000074646 | 458 |
| 47 | 3300005618 | Ga0068864_100017832 | Ga0068864_1000178322 | 458 |
| 48 | 3300006237 | Ga0097621_100001155 | Ga0097621_10000115513 | 458 |
| 49 | 3300006358 | Ga0068871_100000141 | Ga0068871_10000014140 | 458 |
| 50 | 3300006881 | Ga0068865_100000847 | Ga0068865_1000008477 | 458 |
| 51 | 3300009174 | Ga0105241_10003868 | Ga0105241_100038687 | 458 |
| 52 | 3300009174 | Ga0105241_10005560 | Ga0105241_100055604 | 458 |
| 53 | 3300009545 | Ga0105237_10006232 | Ga0105237_100062328 | 458 |
| 54 | 3300009545 | Ga0105237_10017183 | Ga0105237_100171835 | 458 |
| 55 | 3300009551 | Ga0105238_10021406 | Ga0105238_100214062 | 458 |
| 56 | 3300011119 | Ga0105246_10143618 | Ga0105246_101436182 | 458 |
| 57 | 3300013105 | Ga0157369_10068298 | Ga0157369_100682983 | 458 |
| 58 | 3300013296 | Ga0157374_10004899 | Ga0157374_100048995 | 458 |
| 59 | 3300013296 | Ga0157374_10009267 | Ga0157374_100092676 | 458 |
| 60 | 3300013296 | Ga0157374_10027177 | Ga0157374_100271773 | 458 |
| 61 | 3300013297 | Ga0157378_10009438 | Ga0157378_100094384 | 458 |
| 62 | 3300013307 | Ga0157372_10096978 | Ga0157372_100969783 | 458 |
| 63 | 3300013308 | Ga0157375_10339557 | Ga0157375_103395572 | 458 |
| 64 | 3300014745 | Ga0157377_10015702 | Ga0157377_100157022 | 458 |
| 65 | 3300025907 | Ga0207645_10000035 | Ga0207645_1000003541 | 458 |
| 66 | 3300025913 | Ga0207695_10144145 | Ga0207695_101441452 | 458 |
| 67 | 3300025914 | Ga0207671_10004251 | Ga0207671_1000425112 | 458 |
| 68 | 3300025914 | Ga0207671_10096872 | Ga0207671_100968721 | 458 |
| 69 | 3300025920 | Ga0207649_10087521 | Ga0207649_100875213 | 458 |
| 70 | 3300025926 | Ga0207659_10184466 | Ga0207659_101844661 | 458 |
| 71 | 3300025933 | Ga0207706_10001112 | Ga0207706_1000111224 | 458 |
| 72 | 3300025933 | Ga0207706_10051986 | Ga0207706_100519863 | 458 |
| 73 | 3300025936 | Ga0207670_10043839 | Ga0207670_100438392 | 458 |
| 74 | 3300025938 | Ga0207704_10000036 | Ga0207704_1000003689 | 458 |
| 75 | 3300025944 | Ga0207661_10021094 | Ga0207661_100210943 | 458 |
| 76 | 3300025945 | Ga0207679_10001121 | Ga0207679_1000112115 | 458 |
| 77 | 3300025960 | Ga0207651_10013629 | Ga0207651_100136295 | 458 |
| 78 | 3300025960 | Ga0207651_10070789 | Ga0207651_100707892 | 458 |
| 79 | 3300026089 | Ga0207648_10006086 | Ga0207648_100060863 | 458 |
| 80 | 3300026095 | Ga0207676_10002842 | Ga0207676_100028424 | 458 |
| 81 | 3300026116 | Ga0207674_10042338 | Ga0207674_100423382 | 458 |
| 82 | 3300026121 | Ga0207683_10000982 | Ga0207683_1000098214 | 458 |
| 83 | 3300026142 | Ga0207698_10083920 | Ga0207698_100839202 | 458 |
| 84 | 3300033180 | Ga0307510_10080817 | Ga0307510_100808172 | 458 |
| 85 | 3300045051 | Ga0451576_0026580 | Ga0451576_0026580_2960_4378 | 458 |
| 86 | 3300003320 | rootH2_10082380 | rootH2_100823802 | 459 |
| 87 | 3300005563 | Ga0068855_100000341 | Ga0068855_1000003417 | 459 |
| 88 | 3300005614 | Ga0068856_100032847 | Ga0068856_1000328474 | 459 |
| 89 | 3300009545 | Ga0105237_10150572 | Ga0105237_101505721 | 459 |
| 90 | 3300010375 | Ga0105239_10075621 | Ga0105239_100756213 | 459 |
| 91 | 3300013296 | Ga0157374_10018679 | Ga0157374_100186794 | 459 |
| 92 | 3300025914 | Ga0207671_10033281 | Ga0207671_100332814 | 459 |
| 93 | 3300025914 | Ga0207671_10070512 | Ga0207671_100705121 | 459 |
| 94 | 3300025949 | Ga0207667_10000411 | Ga0207667_100004116 | 459 |
| 95 | 3300031730 | Ga0307516_10000330 | Ga0307516_1000033044 | 459 |
| 96 | 3300035692 | Ga0373935_0146306 | Ga0373935_0146306_122_1540 | 459 |
| 97 | 3300046660 | Ga0495625_0004553 | Ga0495625_0004553_10906_12312 | 459 |
| 98 | 3300048918 | Ga0496115_0120099 | Ga0496115_0120099_490_1878 | 459 |
| 99 | 3300002737 | JGI25162J39368_1001033 | JGI25162J39368_100103322 | 460 |
| 100 | 3300003214 | JGI25165J46597_1000678 | JGI25165J46597_100067832 | 460 |
| 101 | 3300003320 | rootH2_10003984 | rootH2_1000398411 | 460 |
| 102 | 3300003320 | rootH2_10010257 | rootH2_100102572 | 460 |
| 103 | 3300003320 | rootH2_10012322 | rootH2_100123228 | 460 |
| 104 | 3300003320 | rootH2_10019694 | rootH2_1001969420 | 460 |
| 105 | 3300003323 | rootH1_10002303 | rootH1_1000230318 | 460 |
| 106 | 3300003323 | rootH1_10091166 | rootH1_100911663 | 460 |
| 107 | 3300004799 | Ga0058863_11409933 | Ga0058863_114099332 | 460 |
| 108 | 3300004803 | Ga0058862_12260637 | Ga0058862_122606372 | 460 |
| 109 | 3300005288 | Ga0065714_10007844 | Ga0065714_100078443 | 460 |
| 110 | 3300005327 | Ga0070658_10000153 | Ga0070658_1000015373 | 460 |
| 111 | 3300005329 | Ga0070683_100018315 | Ga0070683_1000183157 | 460 |
| 112 | 3300005336 | Ga0070680_100002040 | Ga0070680_10000204014 | 460 |
| 113 | 3300005355 | Ga0070671_100004940 | Ga0070671_1000049404 | 460 |
| 114 | 3300005458 | Ga0070681_10053940 | Ga0070681_100539403 | 460 |
| 115 | 3300005530 | Ga0070679_100005927 | Ga0070679_1000059275 | 460 |
| 116 | 3300005548 | Ga0070665_100000372 | Ga0070665_10000037253 | 460 |
| 117 | 3300005563 | Ga0068855_100065723 | Ga0068855_1000657233 | 460 |
| 118 | 3300005563 | Ga0068855_100137266 | Ga0068855_1001372661 | 460 |
| 119 | 3300005614 | Ga0068856_100001358 | Ga0068856_10000135831 | 460 |
| 120 | 3300005614 | Ga0068856_100003057 | Ga0068856_10000305719 | 460 |
| 121 | 3300005616 | Ga0068852_100000197 | Ga0068852_10000019725 | 460 |
| 122 | 3300006237 | Ga0097621_100105555 | Ga0097621_1001055552 | 460 |
| 123 | 3300009093 | Ga0105240_10000100 | Ga0105240_1000010034 | 460 |
| 124 | 3300009093 | Ga0105240_10000268 | Ga0105240_1000026817 | 460 |
| 125 | 3300009093 | Ga0105240_10005272 | Ga0105240_100052726 | 460 |
| 126 | 3300009093 | Ga0105240_10028879 | Ga0105240_100288794 | 460 |
| 127 | 3300009093 | Ga0105240_10122090 | Ga0105240_101220903 | 460 |
| 128 | 3300009545 | Ga0105237_10006561 | Ga0105237_100065615 | 460 |
| 129 | 3300009551 | Ga0105238_10106565 | Ga0105238_101065651 | 460 |
| 130 | 3300010375 | Ga0105239_10000811 | Ga0105239_1000081113 | 460 |
| 131 | 3300010375 | Ga0105239_10003552 | Ga0105239_100035523 | 460 |
| 132 | 3300011119 | Ga0105246_10080985 | Ga0105246_100809852 | 460 |
| 133 | 3300013100 | Ga0157373_10044183 | Ga0157373_100441833 | 460 |
| 134 | 3300013104 | Ga0157370_10009749 | Ga0157370_100097497 | 460 |
| 135 | 3300013104 | Ga0157370_10101212 | Ga0157370_101012124 | 460 |
| 136 | 3300013296 | Ga0157374_10000004 | Ga0157374_10000004292 | 460 |
| 137 | 3300013306 | Ga0163162_10001202 | Ga0163162_1000120211 | 460 |
| 138 | 3300013307 | Ga0157372_10007279 | Ga0157372_100072797 | 460 |
| 139 | 3300013307 | Ga0157372_10095588 | Ga0157372_100955882 | 460 |
| 140 | 3300013308 | Ga0157375_10043043 | Ga0157375_100430432 | 460 |
| 141 | 3300014969 | Ga0157376_10001335 | Ga0157376_1000133517 | 460 |
| 142 | 3300025230 | Ga0209563_105246 | Ga0209563_1052463 | 460 |
| 143 | 3300025231 | Ga0207427_100025 | Ga0207427_100025341 | 460 |
| 144 | 3300025233 | Ga0209437_100010 | Ga0209437_100010603 | 460 |
| 145 | 3300025261 | Ga0209233_1000017 | Ga0209233_1000017616 | 460 |
| 146 | 3300025904 | Ga0207647_10008184 | Ga0207647_100081843 | 460 |
| 147 | 3300025909 | Ga0207705_10000108 | Ga0207705_1000010839 | 460 |
| 148 | 3300025912 | Ga0207707_10014728 | Ga0207707_100147286 | 460 |
| 149 | 3300025913 | Ga0207695_10000027 | Ga0207695_10000027371 | 460 |
| 150 | 3300025913 | Ga0207695_10000073 | Ga0207695_1000007314 | 460 |
| 151 | 3300025913 | Ga0207695_10000164 | Ga0207695_1000016499 | 460 |
| 152 | 3300025913 | Ga0207695_10081046 | Ga0207695_100810463 | 460 |
| 153 | 3300025913 | Ga0207695_10162202 | Ga0207695_101622022 | 460 |
| 154 | 3300025914 | Ga0207671_10009599 | Ga0207671_100095998 | 460 |
| 155 | 3300025914 | Ga0207671_10041850 | Ga0207671_100418503 | 460 |
| 156 | 3300025919 | Ga0207657_10025916 | Ga0207657_100259162 | 460 |
| 157 | 3300025919 | Ga0207657_10057330 | Ga0207657_100573302 | 460 |
| 158 | 3300025931 | Ga0207644_10023288 | Ga0207644_100232886 | 460 |
| 159 | 3300025944 | Ga0207661_10078576 | Ga0207661_100785761 | 460 |
| 160 | 3300025949 | Ga0207667_10001830 | Ga0207667_1000183016 | 460 |
| 161 | 3300025949 | Ga0207667_10106915 | Ga0207667_101069152 | 460 |
| 162 | 3300025981 | Ga0207640_10034093 | Ga0207640_100340933 | 460 |
| 163 | 3300026078 | Ga0207702_10001407 | Ga0207702_1000140728 | 460 |
| 164 | 3300026078 | Ga0207702_10004956 | Ga0207702_100049569 | 460 |
| 165 | 3300026142 | Ga0207698_10010995 | Ga0207698_100109953 | 460 |
| 166 | 3300026142 | Ga0207698_10036047 | Ga0207698_100360472 | 460 |
| 167 | 3300028379 | Ga0268266_10000658 | Ga0268266_1000065853 | 460 |
| 168 | 3300028786 | Ga0307517_10004407 | Ga0307517_1000440710 | 460 |
| 169 | 3300028794 | Ga0307515_10003374 | Ga0307515_1000337433 | 460 |
| 170 | 3300028794 | Ga0307515_10019936 | Ga0307515_100199368 | 460 |
| 171 | 3300030521 | Ga0307511_10001438 | Ga0307511_1000143812 | 460 |
| 172 | 3300033179 | Ga0307507_10000034 | Ga0307507_1000003497 | 460 |
| 173 | 3300033180 | Ga0307510_10000366 | Ga0307510_1000036636 | 460 |
| 174 | 3300035115 | Ga0373941_0011630 | Ga0373941_0011630_88_1491 | 460 |
| 175 | 3300037312 | Ga0395899_0000034 | Ga0395899_0000034_15443_16858 | 460 |
| 176 | 3300037312 | Ga0395899_0006152 | Ga0395899_0006152_3670_5070 | 460 |
| 177 | 3300037418 | Ga0395900_0000346 | Ga0395900_0000346_56238_57638 | 460 |
| 178 | 3300037418 | Ga0395900_0022444 | Ga0395900_0022444_2434_3831 | 460 |
| 179 | 3300037471 | Ga0395905_0000528 | Ga0395905_0000528_10366_11766 | 460 |
| 180 | 3300037471 | Ga0395905_0002267 | Ga0395905_0002267_1540_2937 | 460 |
| 181 | 3300038443 | Ga0395901_0000351 | Ga0395901_0000351_9867_11267 | 460 |
| 182 | 3300038443 | Ga0395901_0009231 | Ga0395901_0009231_2924_4321 | 460 |
| 183 | 3300039447 | Ga0436361_0167348 | Ga0436361_0167348_4357_5757 | 460 |
| 184 | 3300044693 | Ga0466961_0021970 | Ga0466961_0021970_612_2015 | 460 |
| 185 | 3300044719 | Ga0466971_0042273 | Ga0466971_0042273_626_2029 | 460 |
| 186 | 3300046492 | Ga0495585_0006589 | Ga0495585_0006589_5603_7024 | 460 |
| 187 | 3300046513 | Ga0495616_0004750 | Ga0495616_0004750_234_1655 | 460 |
| 188 | 3300046538 | Ga0495609_0062244 | Ga0495609_0062244_170_1591 | 460 |
| 189 | 3300046558 | Ga0495633_0000072 | Ga0495633_0000072_68047_69468 | 460 |
| 190 | 3300046616 | Ga0495668_0000165 | Ga0495668_0000165_17997_19418 | 460 |
| 191 | 3300046660 | Ga0495625_0001492 | Ga0495625_0001492_25675_27096 | 460 |
| 192 | 3300046660 | Ga0495625_0107198 | Ga0495625_0107198_335_1756 | 460 |
| 193 | 3300047323 | Ga0495683_0011808 | Ga0495683_0011808_3040_4440 | 460 |
| 194 | 3300047443 | Ga0495687_000233 | Ga0495687_000233_47303_48706 | 460 |
| 195 | 3300049459 | Ga0495678_017508 | Ga0495678_017508_657_2078 | 460 |
| 196 | 3300053122 | Ga0500608_000343 | Ga0500608_000343_7217_8617 | 460 |
| 197 | 3300053125 | Ga0500618_000005 | Ga0500618_000005_239730_241151 | 460 |
| 198 | 3300005563 | Ga0068855_100000224 | Ga0068855_10000022441 | 461 |
| 199 | 3300025949 | Ga0207667_10000266 | Ga0207667_1000026639 | 461 |
| 200 | 3300031616 | Ga0307508_10185407 | Ga0307508_101854071 | 461 |
| 201 | 3300037418 | Ga0395900_0001482 | Ga0395900_0001482_12693_14090 | 461 |
| 202 | 3300005548 | Ga0070665_100290173 | Ga0070665_1002901731 | 462 |
| 203 | 3300009093 | Ga0105240_10000570 | Ga0105240_1000057028 | 462 |
| 204 | 3300009174 | Ga0105241_10002013 | Ga0105241_1000201311 | 462 |
| 205 | 3300009174 | Ga0105241_10028951 | Ga0105241_100289512 | 462 |
| 206 | 3300009551 | Ga0105238_10002725 | Ga0105238_1000272513 | 462 |
| 207 | 3300010375 | Ga0105239_10137540 | Ga0105239_101375402 | 462 |
| 208 | 3300013297 | Ga0157378_10179900 | Ga0157378_101799001 | 462 |
| 209 | 3300013307 | Ga0157372_10058353 | Ga0157372_100583533 | 462 |
| 210 | 3300025272 | Ga0209455_1001523 | Ga0209455_100152312 | 462 |
| 211 | 3300025911 | Ga0207654_10043314 | Ga0207654_100433143 | 462 |
| 212 | 3300025913 | Ga0207695_10000775 | Ga0207695_1000077546 | 462 |
| 213 | 3300025913 | Ga0207695_10034063 | Ga0207695_100340638 | 462 |
| 214 | 3300025924 | Ga0207694_10035422 | Ga0207694_100354222 | 462 |
| 215 | 3300025949 | Ga0207667_10013280 | Ga0207667_100132803 | 462 |
| 216 | 3300026041 | Ga0207639_10139983 | Ga0207639_101399832 | 462 |
| 217 | 3300028800 | Ga0265338_10022351 | Ga0265338_100223518 | 462 |
| 218 | 3300031507 | Ga0307509_10036410 | Ga0307509_100364102 | 462 |
| 219 | 3300039437 | Ga0436365_0518530 | Ga0436365_0518530_4773_6170 | 462 |
| 220 | 3300003215 | JGI25153J46596_10014113 | JGI25153J46596_100141132 | 463 |
| 221 | 3300003354 | JGI25160J50197_1004449 | JGI25160J50197_10044494 | 463 |
| 222 | 3300003771 | Ga0055526_1009755 | Ga0055526_10097552 | 463 |
| 223 | 3300003790 | Ga0055528_1001348 | Ga0055528_10013486 | 463 |
| 224 | 3300003791 | Ga0055530_10005304 | Ga0055530_100053044 | 463 |
| 225 | 3300005262 | Ga0065165_1000127 | Ga0065165_100012753 | 463 |
| 226 | 3300005843 | Ga0068860_100017322 | Ga0068860_1000173224 | 463 |
| 227 | 3300009093 | Ga0105240_10028314 | Ga0105240_100283145 | 463 |
| 228 | 3300009545 | Ga0105237_10013534 | Ga0105237_100135347 | 463 |
| 229 | 3300009553 | Ga0105249_10001205 | Ga0105249_1000120517 | 463 |
| 230 | 3300009553 | Ga0105249_10011122 | Ga0105249_100111225 | 463 |
| 231 | 3300010375 | Ga0105239_10016202 | Ga0105239_100162027 | 463 |
| 232 | 3300014969 | Ga0157376_10035560 | Ga0157376_100355602 | 463 |
| 233 | 3300025273 | Ga0209673_1000034 | Ga0209673_100003413 | 463 |
| 234 | 3300025291 | Ga0209675_1025421 | Ga0209675_10254211 | 463 |
| 235 | 3300025295 | Ga0209564_1004382 | Ga0209564_10043822 | 463 |
| 236 | 3300025297 | Ga0209758_1004388 | Ga0209758_10043888 | 463 |
| 237 | 3300025298 | Ga0209050_1000673 | Ga0209050_100067337 | 463 |
| 238 | 3300025302 | Ga0207426_1000329 | Ga0207426_100032947 | 463 |
| 239 | 3300025303 | Ga0209051_1029713 | Ga0209051_10297132 | 463 |
| 240 | 3300025304 | Ga0209257_1001183 | Ga0209257_10011838 | 463 |
| 241 | 3300025913 | Ga0207695_10024707 | Ga0207695_100247074 | 463 |
| 242 | 3300025913 | Ga0207695_10026501 | Ga0207695_100265015 | 463 |
| 243 | 3300025923 | Ga0207681_10043129 | Ga0207681_100431294 | 463 |
| 244 | 3300028381 | Ga0268264_10011532 | Ga0268264_100115325 | 463 |
| 245 | 3300031251 | Ga0265327_10000099 | Ga0265327_1000009955 | 463 |
| 246 | 3300003323 | rootH1_10064719 | rootH1_100647192 | 464 |
| 247 | 3300005290 | Ga0065712_10076262 | Ga0065712_100762623 | 464 |
| 248 | 3300005328 | Ga0070676_10022171 | Ga0070676_100221714 | 464 |
| 249 | 3300005338 | Ga0068868_100024954 | Ga0068868_1000249543 | 464 |
| 250 | 3300005343 | Ga0070687_100011272 | Ga0070687_1000112725 | 464 |
| 251 | 3300005466 | Ga0070685_10014014 | Ga0070685_100140144 | 464 |
| 252 | 3300005471 | Ga0070698_100001240 | Ga0070698_1000012402 | 464 |
| 253 | 3300005471 | Ga0070698_100015839 | Ga0070698_1000158399 | 464 |
| 254 | 3300005539 | Ga0068853_100066776 | Ga0068853_1000667762 | 464 |
| 255 | 3300005563 | Ga0068855_100002344 | Ga0068855_10000234413 | 464 |
| 256 | 3300005577 | Ga0068857_100054142 | Ga0068857_1000541422 | 464 |
| 257 | 3300005614 | Ga0068856_100015071 | Ga0068856_1000150713 | 464 |
| 258 | 3300005617 | Ga0068859_100078746 | Ga0068859_1000787463 | 464 |
| 259 | 3300006237 | Ga0097621_100010363 | Ga0097621_1000103637 | 464 |
| 260 | 3300006844 | Ga0075428_100017514 | Ga0075428_1000175145 | 464 |
| 261 | 3300006931 | Ga0097620_100078743 | Ga0097620_1000787433 | 464 |
| 262 | 3300009093 | Ga0105240_10101158 | Ga0105240_101011582 | 464 |
| 263 | 3300009174 | Ga0105241_10004311 | Ga0105241_100043114 | 464 |
| 264 | 3300009176 | Ga0105242_10056851 | Ga0105242_100568512 | 464 |
| 265 | 3300009176 | Ga0105242_10113823 | Ga0105242_101138231 | 464 |
| 266 | 3300009177 | Ga0105248_10260468 | Ga0105248_102604682 | 464 |
| 267 | 3300009545 | Ga0105237_10209306 | Ga0105237_102093062 | 464 |
| 268 | 3300009553 | Ga0105249_10008771 | Ga0105249_100087714 | 464 |
| 269 | 3300009553 | Ga0105249_10010240 | Ga0105249_1001024011 | 464 |
| 270 | 3300010375 | Ga0105239_10001523 | Ga0105239_100015238 | 464 |
| 271 | 3300013297 | Ga0157378_10064296 | Ga0157378_100642963 | 464 |
| 272 | 3300013307 | Ga0157372_10113150 | Ga0157372_101131503 | 464 |
| 273 | 3300014325 | Ga0163163_10151995 | Ga0163163_101519952 | 464 |
| 274 | 3300017792 | Ga0163161_10042247 | Ga0163161_100422472 | 464 |
| 275 | 3300025907 | Ga0207645_10000821 | Ga0207645_100008217 | 464 |
| 276 | 3300025913 | Ga0207695_10083883 | Ga0207695_100838832 | 464 |
| 277 | 3300025914 | Ga0207671_10040152 | Ga0207671_100401523 | 464 |
| 278 | 3300025918 | Ga0207662_10020460 | Ga0207662_100204605 | 464 |
| 279 | 3300025925 | Ga0207650_10122252 | Ga0207650_101222522 | 464 |
| 280 | 3300025933 | Ga0207706_10134510 | Ga0207706_101345103 | 464 |
| 281 | 3300025934 | Ga0207686_10000566 | Ga0207686_100005666 | 464 |
| 282 | 3300025938 | Ga0207704_10078093 | Ga0207704_100780932 | 464 |
| 283 | 3300025949 | Ga0207667_10012886 | Ga0207667_100128863 | 464 |
| 284 | 3300025961 | Ga0207712_10005253 | Ga0207712_1000525311 | 464 |
| 285 | 3300025961 | Ga0207712_10005755 | Ga0207712_100057559 | 464 |
| 286 | 3300026041 | Ga0207639_10175668 | Ga0207639_101756682 | 464 |
| 287 | 3300026088 | Ga0207641_10005426 | Ga0207641_100054269 | 464 |
| 288 | 3300026089 | Ga0207648_10013332 | Ga0207648_100133326 | 464 |
| 289 | 3300026116 | Ga0207674_10084035 | Ga0207674_100840353 | 464 |
| 290 | 3300026116 | Ga0207674_10230029 | Ga0207674_102300291 | 464 |
| 291 | 3300026118 | Ga0207675_100036164 | Ga0207675_1000361642 | 464 |
| 292 | 3300026118 | Ga0207675_100038705 | Ga0207675_1000387054 | 464 |
| 293 | 3300026121 | Ga0207683_10002737 | Ga0207683_100027376 | 464 |
| 294 | 3300028379 | Ga0268266_10068549 | Ga0268266_100685491 | 464 |
| 295 | 3300028381 | Ga0268264_10055834 | Ga0268264_100558342 | 464 |
| 296 | 3300028381 | Ga0268264_10177847 | Ga0268264_101778472 | 464 |
| 297 | 3300046516 | Ga0495628_0000313 | Ga0495628_0000313_35068_36486 | 464 |
| 298 | 3300005328 | Ga0070676_10007843 | Ga0070676_100078434 | 465 |
| 299 | 3300005329 | Ga0070683_100000329 | Ga0070683_1000003298 | 465 |
| 300 | 3300005330 | Ga0070690_100023911 | Ga0070690_1000239114 | 465 |
| 301 | 3300005334 | Ga0068869_100027695 | Ga0068869_1000276954 | 465 |
| 302 | 3300005338 | Ga0068868_100000726 | Ga0068868_10000072610 | 465 |
| 303 | 3300005338 | Ga0068868_100123120 | Ga0068868_1001231201 | 465 |
| 304 | 3300005340 | Ga0070689_100019987 | Ga0070689_1000199871 | 465 |
| 305 | 3300005344 | Ga0070661_100000537 | Ga0070661_10000053722 | 465 |
| 306 | 3300005355 | Ga0070671_100137328 | Ga0070671_1001373282 | 465 |
| 307 | 3300005367 | Ga0070667_100095018 | Ga0070667_1000950182 | 465 |
| 308 | 3300005457 | Ga0070662_100009876 | Ga0070662_1000098763 | 465 |
| 309 | 3300005459 | Ga0068867_100003263 | Ga0068867_1000032632 | 465 |
| 310 | 3300005535 | Ga0070684_100053747 | Ga0070684_1000537473 | 465 |
| 311 | 3300005539 | Ga0068853_100020667 | Ga0068853_1000206674 | 465 |
| 312 | 3300005548 | Ga0070665_100014535 | Ga0070665_1000145354 | 465 |
| 313 | 3300005564 | Ga0070664_100002488 | Ga0070664_1000024887 | 465 |
| 314 | 3300005564 | Ga0070664_100078451 | Ga0070664_1000784512 | 465 |
| 315 | 3300005578 | Ga0068854_100123533 | Ga0068854_1001235332 | 465 |
| 316 | 3300005614 | Ga0068856_100223760 | Ga0068856_1002237601 | 465 |
| 317 | 3300005616 | Ga0068852_100033980 | Ga0068852_1000339803 | 465 |
| 318 | 3300005617 | Ga0068859_100036769 | Ga0068859_1000367694 | 465 |
| 319 | 3300005618 | Ga0068864_100034223 | Ga0068864_1000342232 | 465 |
| 320 | 3300005718 | Ga0068866_10034795 | Ga0068866_100347952 | 465 |
| 321 | 3300005842 | Ga0068858_100107060 | Ga0068858_1001070602 | 465 |
| 322 | 3300005842 | Ga0068858_100144842 | Ga0068858_1001448422 | 465 |
| 323 | 3300005843 | Ga0068860_100101866 | Ga0068860_1001018662 | 465 |
| 324 | 3300006931 | Ga0097620_100036770 | Ga0097620_1000367702 | 465 |
| 325 | 3300009174 | Ga0105241_10120579 | Ga0105241_101205792 | 465 |
| 326 | 3300009177 | Ga0105248_10291379 | Ga0105248_102913792 | 465 |
| 327 | 3300013100 | Ga0157373_10028143 | Ga0157373_100281433 | 465 |
| 328 | 3300013104 | Ga0157370_10001825 | Ga0157370_100018258 | 465 |
| 329 | 3300013296 | Ga0157374_10007946 | Ga0157374_100079463 | 465 |
| 330 | 3300013306 | Ga0163162_10054377 | Ga0163162_100543771 | 465 |
| 331 | 3300013308 | Ga0157375_10006512 | Ga0157375_100065122 | 465 |
| 332 | 3300013308 | Ga0157375_10048419 | Ga0157375_100484194 | 465 |
| 333 | 3300013308 | Ga0157375_10192959 | Ga0157375_101929592 | 465 |
| 334 | 3300014325 | Ga0163163_10114118 | Ga0163163_101141182 | 465 |
| 335 | 3300014968 | Ga0157379_10032127 | Ga0157379_100321273 | 465 |
| 336 | 3300014969 | Ga0157376_10032526 | Ga0157376_100325262 | 465 |
| 337 | 3300017792 | Ga0163161_10010401 | Ga0163161_100104014 | 465 |
| 338 | 3300025903 | Ga0207680_10003322 | Ga0207680_100033226 | 465 |
| 339 | 3300025907 | Ga0207645_10015292 | Ga0207645_100152922 | 465 |
| 340 | 3300025920 | Ga0207649_10028757 | Ga0207649_100287573 | 465 |
| 341 | 3300025931 | Ga0207644_10104999 | Ga0207644_101049992 | 465 |
| 342 | 3300025933 | Ga0207706_10009220 | Ga0207706_100092202 | 465 |
| 343 | 3300025942 | Ga0207689_10017871 | Ga0207689_100178714 | 465 |
| 344 | 3300025942 | Ga0207689_10146260 | Ga0207689_101462601 | 465 |
| 345 | 3300025944 | Ga0207661_10047939 | Ga0207661_100479393 | 465 |
| 346 | 3300025944 | Ga0207661_10059286 | Ga0207661_100592863 | 465 |
| 347 | 3300025945 | Ga0207679_10000751 | Ga0207679_100007516 | 465 |
| 348 | 3300025945 | Ga0207679_10162320 | Ga0207679_101623202 | 465 |
| 349 | 3300026035 | Ga0207703_10043044 | Ga0207703_100430442 | 465 |
| 350 | 3300026041 | Ga0207639_10078824 | Ga0207639_100788242 | 465 |
| 351 | 3300026118 | Ga0207675_100016558 | Ga0207675_1000165585 | 465 |
| 352 | 3300026121 | Ga0207683_10085551 | Ga0207683_100855512 | 465 |
| 353 | 3300028379 | Ga0268266_10017916 | Ga0268266_100179163 | 465 |
| 354 | 3300053085 | Ga0495619_0137540 | Ga0495619_0137540_225_1631 | 465 |
| 355 | 3300003203 | JGI25406J46586_10000891 | JGI25406J46586_1000089110 | 467 |
| 356 | 3300005327 | Ga0070658_10103732 | Ga0070658_101037321 | 467 |
| 357 | 3300005329 | Ga0070683_100014341 | Ga0070683_1000143415 | 467 |
| 358 | 3300005339 | Ga0070660_100108592 | Ga0070660_1001085922 | 467 |
| 359 | 3300005457 | Ga0070662_100153931 | Ga0070662_1001539312 | 467 |
| 360 | 3300005563 | Ga0068855_100307796 | Ga0068855_1003077962 | 467 |
| 361 | 3300005616 | Ga0068852_100061913 | Ga0068852_1000619132 | 467 |
| 362 | 3300005985 | Ga0081539_10001586 | Ga0081539_1000158627 | 467 |
| 363 | 3300006237 | Ga0097621_100105447 | Ga0097621_1001054471 | 467 |
| 364 | 3300013100 | Ga0157373_10046238 | Ga0157373_100462383 | 467 |
| 365 | 3300013102 | Ga0157371_10066284 | Ga0157371_100662843 | 467 |
| 366 | 3300013104 | Ga0157370_10230227 | Ga0157370_102302271 | 467 |
| 367 | 3300013296 | Ga0157374_10028471 | Ga0157374_100284713 | 467 |
| 368 | 3300014745 | Ga0157377_10050567 | Ga0157377_100505672 | 467 |
| 369 | 3300025919 | Ga0207657_10045102 | Ga0207657_100451022 | 467 |
| 370 | 3300025933 | Ga0207706_10059535 | Ga0207706_100595352 | 467 |
| 371 | 3300025944 | Ga0207661_10009743 | Ga0207661_100097434 | 467 |
| 372 | 3300031251 | Ga0265327_10071456 | Ga0265327_100714561 | 467 |
| 373 | 3300046648 | Ga0495611_0000757 | Ga0495611_0000757_5767_7182 | 467 |
| 374 | 3300005539 | Ga0068853_100008148 | Ga0068853_1000081481 | 469 |
| 375 | 3300009093 | Ga0105240_10025992 | Ga0105240_100259924 | 469 |
| 376 | 3300009551 | Ga0105238_10018791 | Ga0105238_100187914 | 469 |
| 377 | 3300025934 | Ga0207686_10103684 | Ga0207686_101036841 | 469 |
| 378 | 3300033180 | Ga0307510_10001319 | Ga0307510_100013198 | 469 |
| 379 | 3300005367 | Ga0070667_100028970 | Ga0070667_1000289702 | 470 |
| 380 | 3300025986 | Ga0207658_10075663 | Ga0207658_100756632 | 470 |
| 381 | 3300001979 | JGI24740J21852_10024878 | JGI24740J21852_100248782 | 471 |
| 382 | 3300010375 | Ga0105239_10007261 | Ga0105239_1000726111 | 471 |
| 383 | 3300025904 | Ga0207647_10022722 | Ga0207647_100227224 | 471 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2x1c-assembly2.cif.gz_B | the crystal structure of precursor acyl coenzyme a:isopenicillin n acyltransferase from penicillium chrysogenum | 0.8579 | 46 | 433 |
| 2x1e-assembly2.cif.gz_B | the crystal structure of mature acyl coenzyme a:isopenicillin n acyltransferase from penicillium chrysogenum in complex 6- aminopenicillanic acid | 0.8529 | 46 | 433 |
| 2x1e-assembly3.cif.gz_C | the crystal structure of mature acyl coenzyme a:isopenicillin n acyltransferase from penicillium chrysogenum in complex 6- aminopenicillanic acid | 0.8407 | 46 | 433 |
| 2x1e-assembly1.cif.gz_A | the crystal structure of mature acyl coenzyme a:isopenicillin n acyltransferase from penicillium chrysogenum in complex 6- aminopenicillanic acid | 0.8339 | 46 | 433 |
| 3gvz-assembly2.cif.gz_B | crystal structure of the protein cv2077 from chromobacterium violaceum. northeast structural genomics consortium target cvr62 | 0.8231 | 163 | 433 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3gvzB00 | Alpha Beta;4-Layer Sandwich;Penicillin V Acylase; Chain A;Penicillin V Acylase; Chain A | 0.8205 | 163 | 433 | 3.60.60.10 |
| af_Q9BL07_46_577_3.60.60.30 | Alpha Beta;4-Layer Sandwich;Penicillin V Acylase; Chain A; | 0.7983 | 36 | 441 | 3.60.60.30 |
| af_Q54PS7_44_568_3.60.60.30 | Alpha Beta;4-Layer Sandwich;Penicillin V Acylase; Chain A; | 0.7658 | 36 | 470 | 3.60.60.30 |
| af_Q550U9_28_561_3.60.60.30 | Alpha Beta;4-Layer Sandwich;Penicillin V Acylase; Chain A; | 0.7594 | 36 | 470 | 3.60.60.30 |
| af_Q8C0E3_415_593_2.60.120.920 | Mainly Beta;Sandwich;Jelly Rolls;SPRY domain | 0.7537 | 281 | 311 | 2.60.120.920 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A537J8U5-F1-model_v4 | Peptidase C45 | 0.9949 | 66 | 471 |
GO:0004620
GO:0005576 GO:0009395 |
| AF-A0A2V7WPB5-F1-model_v4 | Peptidase C45 | 0.9913 | 169 | 470 |
GO:0004620
GO:0005576 GO:0009395 |
| AF-A0A537J8U5-F1-model_v4 | Peptidase C45 | 0.9876 | 66 | 471 |
GO:0004620
GO:0005576 GO:0009395 |
| AF-A0A1F5AGZ7-F1-model_v4 | Peptidase M1 membrane alanine aminopeptidase domain-containing protein | 0.9861 | 210 | 471 |
GO:0004620
GO:0016042 |
| AF-A0A3D0QDT7-F1-model_v4 | Peptidase C45 | 0.9834 | 385 | 471 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar