F429470

General Info

Members Datasets Scaffolds Average Seq Length
383 239 766 261

Family's Representative Sequence

Representative Sequence 3300003323|rootH1_10036297|rootH1_100362974
Length 290
Sequence MAVRPEGTPCWADAMFGDVEGAKSFYGDVLGWTFGESSSEYGNYTQAYAAGKAVAAVVPPMPGQEGQSQWCLYLASPDAAATAARIREHGGEVLMEPMQVGDFGTMCLGRDPGGVVFGVWQAGVHEGFEAPPEQPGAFCWAEVYTREPGKSDAFFPAVFGYTAKQMEGEAMDFRMFNVGDDTVLGRMKMGEEFPPEVPAYINVYFTVDDCDGAVARATGHGGVLRFGPMDTPFGRFAALSDPQGASFSVIDVTRTQGEIPQISSDIGHRTSAAVVAAGAAVRSWHDRAHA

Samples

Sample ID Description Type Environment
1 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
2 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
5 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
6 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
7 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
8 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
9 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
10 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
11 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
12 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
13 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
14 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
15 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
16 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
17 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
18 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
19 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
20 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
21 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
22 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
23 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
24 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
25 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
26 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
27 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
28 3300023436 Sorghum rhizosphere microbial communities from UC West Side Research & Extension Center, Five Points, CA, USA - TP3.B2.stno.R1 Metatranscriptome Rhizosphere
29 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
30 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
31 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
32 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
33 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
34 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
35 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
36 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
37 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
38 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
39 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
40 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
41 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
42 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
43 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
44 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
45 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
46 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
47 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
48 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
49 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
50 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
51 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
52 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
53 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
54 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
55 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
56 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
57 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
58 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
59 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
60 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
61 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
62 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
63 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
64 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
65 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
66 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
67 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
68 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
71 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
72 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
76 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
77 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
78 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
79 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
80 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
84 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
85 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
86 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
87 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
88 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
89 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
90 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
91 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
92 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
93 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
94 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
95 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
96 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
97 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
98 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
103 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
104 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
105 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
106 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
107 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
108 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
115 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
116 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
117 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
118 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
119 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
120 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
121 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
122 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
123 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
124 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
125 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
126 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
127 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
128 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
129 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
130 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
131 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
132 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
133 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
134 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
135 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
136 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
137 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
138 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
139 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
140 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
141 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
144 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
145 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
146 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
147 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
148 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
149 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
150 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
153 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
155 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
158 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
159 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
160 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
161 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
162 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
163 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
164 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
165 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
166 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
167 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
168 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
169 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
170 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
171 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
173 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
174 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
175 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
176 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
177 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
178 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
179 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
180 2643221578 Streptomyces sp. Root63 Isolate Unclassified
181 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
182 2643221601 Kitasatospora sp. Root187 Isolate Unclassified
183 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
184 2643221647 Streptomyces sp. Root369 Isolate Unclassified
185 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
186 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
187 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
188 2643221714 Streptomyces sp. Root264 Isolate Unclassified
189 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
190 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
191 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
192 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
193 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
194 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
195 2808606448 Streptomyces sp. 193411 Isolate Unclassified
196 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
197 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
198 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
199 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
200 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
201 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
202 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
203 2862574272 Streptomyces sp. AcE210 Isolate Nodule
204 2867428634 Streptomyces sp. RP5T Isolate Unclassified
205 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
206 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
207 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
208 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
209 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
210 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
211 2935390628 Streptomyces sp. PvR034 Isolate Rhizosphere
212 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
213 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
214 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
215 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
216 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
217 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
218 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
219 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
220 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
221 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
222 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
223 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
224 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
225 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
226 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
227 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
228 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
229 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
230 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
231 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
232 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
233 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
234 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
235 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
236 8025478263 Streptomyces telluris AA8 Isolate Rhizosphere
237 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
238 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
239 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 81.72
Metatranscriptomes 0.78
Isolates 17.49

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.44
Nodule 1.04
Rhizoplane 0.78
Rhizosphere 77.02
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10036297 3300003323 Bacteria 6291
2 JGI24737J22298_10033929 3300001990 Bacteria 1584
3 rootH1_10058454 3300003316 Bacteria 2432
4 rootH2_10022648 3300003320 Bacteria 4219
5 rootH1_10098056 3300003323 Bacteria 1655
6 Ga0070709_10129905 3300005434 Bacteria 1718
7 Ga0070714_100276760 3300005435 Bacteria 1558
8 Ga0070713_100178181 3300005436 Bacteria 1908
9 Ga0068853_100102166 3300005539 Bacteria 2537
10 Ga0070665_100304787 3300005548 Bacteria 1596
11 Ga0068855_100330478 3300005563 Bacteria 1683
12 Ga0068856_100637700 3300005614 Bacteria 1086
13 Ga0081455_10070627 3300005937 Bacteria 2898
14 Ga0070717_10175774 3300006028 Bacteria 1864
15 Ga0075365_10099804 3300006038 Bacteria 1987
16 Ga0075368_10003569 3300006042 Bacteria 5212
17 Ga0075363_100021728 3300006048 Bacteria 3237
18 Ga0075363_100051039 3300006048 Bacteria 2205
19 Ga0075367_10000753 3300006178 Bacteria 12627
20 Ga0075370_10158644 3300006353 Bacteria 1327
21 Ga0099826_10092834 3300006948 Bacteria 1841
22 Ga0105251_10075851 3300009011 Bacteria 1561
23 Ga0105243_10259389 3300009148 Bacteria 1555
24 Ga0182008_10001515 3300014497 Bacteria 15517
25 Ga0182007_10000291 3300015262 Bacteria 32565
26 Ga0182005_1020492 3300015265 Bacteria 1819
27 Ga0183367_1003 3300015688 Bacteria 814276
28 Ga0213876_10054175 3300021384 Bacteria 2118
29 Ga0224712_10143455 3300022467 Bacteria 1053
30 Ga0256743_102822 3300023436 Bacteria 992
31 Ga0207426_1019088 3300025302 Bacteria 2403
32 Ga0207647_10012458 3300025904 Bacteria 5918
33 Ga0207699_10094148 3300025906 Bacteria 1887
34 Ga0207667_10228218 3300025949 Bacteria 1907
35 Ga0207702_10259232 3300026078 Bacteria 1636
36 Ga0209813_10015502 3300027866 Bacteria 2066
37 Ga0268266_10178717 3300028379 Bacteria 1931
38 Ga0307517_10025008 3300028786 Bacteria 7328
39 Ga0307515_10000106 3300028794 Bacteria 197218
40 Ga0307515_10051551 3300028794 Bacteria 6132
41 Ga0307511_10002051 3300030521 Bacteria 21091
42 Ga0307511_10012524 3300030521 Bacteria 8319
43 Ga0307512_10034435 3300030522 Bacteria 4332
44 Ga0307512_10104615 3300030522 Bacteria 1898
45 Ga0307513_10006435 3300031456 Bacteria 15350
46 Ga0307513_10163077 3300031456 Bacteria 2118
47 Ga0307509_10004141 3300031507 Bacteria 21188
48 Ga0307509_10007222 3300031507 Bacteria 14623
49 Ga0307509_10021254 3300031507 Bacteria 7343
50 Ga0307508_10036246 3300031616 Bacteria 4441
51 Ga0307508_10056418 3300031616 Bacteria 3478
52 Ga0307508_10064584 3300031616 Bacteria 3227
53 Ga0307514_10005418 3300031649 Bacteria 11402
54 Ga0307514_10101564 3300031649 Bacteria 2063
55 Ga0307516_10000711 3300031730 Bacteria 45216
56 Ga0307516_10009394 3300031730 Bacteria 10908
57 Ga0307516_10281774 3300031730 Bacteria 1344
58 Ga0307518_10036585 3300031838 Bacteria 3568
59 Ga0307518_10088112 3300031838 Bacteria 2236
60 Ga0307518_10156973 3300031838 Bacteria 1568
61 Ga0307507_10005664 3300033179 Bacteria 20263
62 Ga0307507_10005887 3300033179 Bacteria 19529
63 Ga0307510_10010384 3300033180 Bacteria 11060
64 Ga0307510_10033747 3300033180 Bacteria 5742
65 Ga0307510_10039953 3300033180 Bacteria 5159
66 Ga0307510_10042962 3300033180 Bacteria 4918
67 Ga0395898_0010345 3300037466 Bacteria 9758
68 Ga0395898_0036638 3300037466 Bacteria 4870
69 Ga0395901_0100094 3300038443 Bacteria 3040
70 Ga0436365_0763918 3300039437 Bacteria 2315
71 Ga0439436_0012047 3300041404 Bacteria 2626
72 Ga0439439_0009341 3300041406 Bacteria 2331
73 Ga0451853_0845322 3300041512 Bacteria 11189
74 Ga0451853_2707819 3300041512 Bacteria 7620
75 Ga0451853_3767289 3300041512 Bacteria 1745
76 Ga0439448_0007614 3300042005 Bacteria 3145
77 Ga0439449_0001497 3300042007 Bacteria 9157
78 Ga0439449_0052691 3300042007 Bacteria 1504
79 Ga0439457_005218 3300042014 Bacteria 3291
80 Ga0439462_0021541 3300042015 Bacteria 1684
81 Ga0450896_004852 3300042133 Bacteria 1831
82 Ga0450898_002555 3300042134 Bacteria 2549
83 Ga0450898_016029 3300042134 Bacteria 1275
84 Ga0450903_000037 3300042138 Bacteria 26562
85 Ga0439458_0001846 3300042157 Bacteria 5267
86 Ga0439458_0007973 3300042157 Bacteria 2355
87 Ga0466972_0001948 3300044658 Bacteria 10127
88 Ga0466972_0018433 3300044658 Bacteria 3490
89 Ga0466965_0000305 3300044683 Bacteria 16342
90 Ga0466965_0117064 3300044683 Bacteria 1374
91 Ga0466966_0014786 3300044684 Bacteria 5163
92 Ga0466961_0024482 3300044693 Bacteria 3882
93 Ga0466961_0342448 3300044693 Bacteria 911
94 Ga0466963_0000682 3300044694 Bacteria 16496
95 Ga0466963_0010728 3300044694 Bacteria 5559
96 Ga0466963_0016306 3300044694 Bacteria 4618
97 Ga0466971_0069542 3300044719 Bacteria 1597
98 Ga0466971_0076119 3300044719 Bacteria 1527
99 Ga0466970_0000323 3300044765 Bacteria 23219
100 Ga0466970_0003928 3300044765 Bacteria 7284
101 Ga0466960_0130730 3300044901 Bacteria 1324
102 Ga0466958_0189687 3300045836 Bacteria 1306
103 Ga0466967_0001305 3300045976 Bacteria 14233
104 Ga0466967_0009824 3300045976 Bacteria 7136
105 Ga0495627_048250 3300046453 Bacteria 1289
106 Ga0495592_0001777 3300046454 Bacteria 15168
107 Ga0495592_0008890 3300046454 Bacteria 7542
108 Ga0495603_0000870 3300046455 Bacteria 17328
109 Ga0495603_0002388 3300046455 Bacteria 11041
110 Ga0495603_0004469 3300046455 Bacteria 8343
111 Ga0495603_0014207 3300046455 Bacteria 4817
112 Ga0495603_0014721 3300046455 Bacteria 4730
113 Ga0495603_0024420 3300046455 Bacteria 3656
114 Ga0495603_0178191 3300046455 Bacteria 1230
115 Ga0495629_0001850 3300046459 Bacteria 16580
116 Ga0495629_0003509 3300046459 Bacteria 11855
117 Ga0495629_0007584 3300046459 Bacteria 7993
118 Ga0495629_0011108 3300046459 Bacteria 6543
119 Ga0495629_0014976 3300046459 Bacteria 5572
120 Ga0495629_0015654 3300046459 Bacteria 5445
121 Ga0495629_0020104 3300046459 Bacteria 4767
122 Ga0495629_0049973 3300046459 Bacteria 2930
123 Ga0495629_0050682 3300046459 Bacteria 2907
124 Ga0495629_0051688 3300046459 Bacteria 2876
125 Ga0495638_0057407 3300046460 Bacteria 2414
126 Ga0495638_0191815 3300046460 Bacteria 1159
127 Ga0495651_0040747 3300046462 Bacteria 3610
128 Ga0495651_0051010 3300046462 Bacteria 3191
129 Ga0495582_0029969 3300046473 Bacteria 2986
130 Ga0495582_0078545 3300046473 Bacteria 1831
131 Ga0495605_0002758 3300046474 Bacteria 10722
132 Ga0495605_0040540 3300046474 Bacteria 2324
133 Ga0495639_0092817 3300046475 Bacteria 1418
134 Ga0495662_0002022 3300046476 Bacteria 10146
135 Ga0495662_0015210 3300046476 Bacteria 3738
136 Ga0495662_0067866 3300046476 Bacteria 1726
137 Ga0495664_0007333 3300046477 Bacteria 6122
138 Ga0495664_0018929 3300046477 Bacteria 3953
139 Ga0495585_0054620 3300046492 Bacteria 2208
140 Ga0495585_0201179 3300046492 Bacteria 1014
141 Ga0495594_0003383 3300046499 Bacteria 8244
142 Ga0495594_0009553 3300046499 Bacteria 5014
143 Ga0495594_0035749 3300046499 Bacteria 2707
144 Ga0495594_0058261 3300046499 Bacteria 2133
145 Ga0495594_0061067 3300046499 Bacteria 2085
146 Ga0495594_0122088 3300046499 Bacteria 1473
147 Ga0495594_0125270 3300046499 Bacteria 1453
148 Ga0495594_0305910 3300046499 Bacteria 906
149 Ga0495596_0093845 3300046500 Bacteria 1165
150 Ga0495607_0026586 3300046501 Bacteria 3590
151 Ga0495583_0069262 3300046506 Bacteria 1554
152 Ga0495583_0069947 3300046506 Bacteria 1544
153 Ga0495606_0032536 3300046507 Bacteria 3611
154 Ga0495606_0103986 3300046507 Bacteria 1724
155 Ga0495608_0230375 3300046511 Bacteria 1160
156 Ga0495610_0030475 3300046512 Bacteria 2827
157 Ga0495618_0115532 3300046514 Bacteria 1718
158 Ga0495628_0009467 3300046516 Bacteria 8317
159 Ga0495628_0026929 3300046516 Bacteria 4680
160 Ga0495630_0184173 3300046517 Bacteria 1593
161 Ga0495630_0362596 3300046517 Bacteria 1109
162 Ga0495631_0040130 3300046518 Bacteria 2074
163 Ga0495631_0227760 3300046518 Bacteria 795
164 Ga0495648_0057485 3300046524 Bacteria 2332
165 Ga0495648_0073775 3300046524 Bacteria 1968
166 Ga0495666_0134466 3300046526 Bacteria 1154
167 Ga0495666_0167788 3300046526 Bacteria 1016
168 Ga0495652_0009693 3300046529 Bacteria 8736
169 Ga0495652_0288953 3300046529 Bacteria 1197
170 Ga0495654_0069961 3300046530 Bacteria 1665
171 Ga0495640_0001026 3300046533 Bacteria 21652
172 Ga0495640_0005875 3300046533 Bacteria 9737
173 Ga0495586_0126612 3300046535 Bacteria 1429
174 Ga0495587_0025959 3300046536 Bacteria 3575
175 Ga0495609_0010921 3300046538 Bacteria 4339
176 Ga0495622_0001462 3300046557 Bacteria 11884
177 Ga0495622_0024633 3300046557 Bacteria 2810
178 Ga0495622_0093101 3300046557 Bacteria 1384
179 Ga0495633_0128897 3300046558 Bacteria 1170
180 Ga0495667_0071170 3300046559 Bacteria 2269
181 Ga0495667_0144064 3300046559 Bacteria 1535
182 Ga0495667_0239449 3300046559 Bacteria 1156
183 Ga0495668_0028737 3300046616 Bacteria 3143
184 Ga0495634_0003255 3300046642 Bacteria 13117
185 Ga0495634_0148380 3300046642 Bacteria 1484
186 Ga0495634_0195366 3300046642 Bacteria 1259
187 Ga0495634_0359530 3300046642 Bacteria 870
188 Ga0495611_0012252 3300046648 Bacteria 3646
189 Ga0495625_0007997 3300046660 Bacteria 9081
190 Ga0495625_0065775 3300046660 Bacteria 2555
191 Ga0495625_0195284 3300046660 Bacteria 1338
192 Ga0495635_0001628 3300046663 Bacteria 15131
193 Ga0495635_0022724 3300046663 Bacteria 4372
194 Ga0495661_0059492 3300046665 Bacteria 2274
195 Ga0495588_0012621 3300046674 Bacteria 3999
196 Ga0495588_0012852 3300046674 Bacteria 3969
197 Ga0495588_0039977 3300046674 Bacteria 2390
198 Ga0495588_0040550 3300046674 Bacteria 2375
199 Ga0495588_0121574 3300046674 Bacteria 1376
200 Ga0495657_0000602 3300046675 Bacteria 32915
201 Ga0495657_0007427 3300046675 Bacteria 8469
202 Ga0495657_0017427 3300046675 Bacteria 5215
203 Ga0495657_0029058 3300046675 Bacteria 3880
204 Ga0495623_0007754 3300046679 Bacteria 6977
205 Ga0495646_0002903 3300046680 Bacteria 10621
206 Ga0495646_0113483 3300046680 Bacteria 1541
207 Ga0495658_0221233 3300046683 Bacteria 1185
208 Ga0495613_0000692 3300046689 Bacteria 26583
209 Ga0495613_0001291 3300046689 Bacteria 19116
210 Ga0495613_0008083 3300046689 Bacteria 7819
211 Ga0495613_0017739 3300046689 Bacteria 5303
212 Ga0495613_0044906 3300046689 Bacteria 3268
213 Ga0495624_0023297 3300046690 Bacteria 4084
214 Ga0495670_0029114 3300046691 Bacteria 2740
215 Ga0495671_0019594 3300046692 Bacteria 3574
216 Ga0495649_0028597 3300046694 Bacteria 3089
217 Ga0495589_0009682 3300046794 Bacteria 5007
218 Ga0495589_0034464 3300046794 Bacteria 2541
219 Ga0495589_0052379 3300046794 Bacteria 2016
220 Ga0495589_0081377 3300046794 Bacteria 1575
221 Ga0495600_0004965 3300046809 Bacteria 7987
222 Ga0495600_0097511 3300046809 Bacteria 1916
223 Ga0495600_0197604 3300046809 Bacteria 1292
224 Ga0495600_0335675 3300046809 Bacteria 948
225 Ga0495660_0087327 3300046810 Bacteria 1626
226 Ga0495581_0011453 3300047315 Bacteria 5134
227 Ga0495581_0021503 3300047315 Bacteria 3738
228 Ga0495581_0028167 3300047315 Bacteria 3257
229 Ga0495604_0000721 3300047317 Bacteria 27964
230 Ga0495604_0006293 3300047317 Bacteria 9420
231 Ga0495604_0075800 3300047317 Bacteria 2531
232 Ga0495636_0003684 3300047318 Bacteria 5959
233 Ga0495636_0010711 3300047318 Bacteria 3625
234 Ga0495636_0042959 3300047318 Bacteria 1879
235 Ga0495636_0312841 3300047318 Bacteria 736
236 Ga0495674_0219753 3300047319 Bacteria 1571
237 Ga0495676_0003652 3300047321 Bacteria 13953
238 Ga0495676_0008112 3300047321 Bacteria 9635
239 Ga0495676_0010424 3300047321 Bacteria 8429
240 Ga0495676_0011930 3300047321 Bacteria 7839
241 Ga0495676_0018216 3300047321 Bacteria 6193
242 Ga0495676_0024527 3300047321 Bacteria 5219
243 Ga0495676_0047530 3300047321 Bacteria 3468
244 Ga0495676_0052568 3300047321 Bacteria 3250
245 Ga0495680_0013028 3300047322 Bacteria 7274
246 Ga0495683_0052296 3300047323 Bacteria 2039
247 Ga0495687_001141 3300047443 Bacteria 25731
248 Ga0495687_010165 3300047443 Bacteria 5180
249 Ga0495675_0039557 3300047444 Bacteria 3003
250 Ga0495675_0072231 3300047444 Bacteria 2177
251 Ga0495675_0306287 3300047444 Bacteria 942
252 Ga0495677_0075769 3300047445 Bacteria 1257
253 Ga0495685_001020 3300047447 Bacteria 8539
254 Ga0495685_001222 3300047447 Bacteria 7885
255 Ga0495685_019421 3300047447 Bacteria 2335
256 Ga0495681_0007280 3300047470 Bacteria 7104
257 Ga0495593_0106111 3300047673 Bacteria 1437
258 Ga0495593_0142599 3300047673 Bacteria 1213
259 Ga0495602_0043267 3300048088 Bacteria 4097
260 Ga0495614_0000431 3300048089 Bacteria 17235
261 Ga0495614_0026727 3300048089 Bacteria 2487
262 Ga0495614_0033515 3300048089 Bacteria 2209
263 Ga0495614_0176235 3300048089 Bacteria 961
264 Ga0495626_0028351 3300048091 Bacteria 2716
265 Ga0496105_0445546 3300048908 Bacteria 1023
266 Ga0496109_0023826 3300048912 Bacteria 5434
267 Ga0496113_0326140 3300048916 Bacteria 1231
268 Ga0495678_040311 3300049459 Bacteria 1878
269 Ga0495678_059895 3300049459 Bacteria 1434
270 Ga0495682_0078857 3300049460 Bacteria 1185
271 Ga0501031_0054293 3300049568 Bacteria 2611
272 Ga0501032_0027569 3300049569 Bacteria 3903
273 Ga0501033_0005759 3300049570 Bacteria 9756
274 Ga0501033_0056191 3300049570 Bacteria 2910
275 Ga0501033_0059425 3300049570 Bacteria 2823
276 Ga0501034_0015003 3300049571 Bacteria 7969
277 Ga0501034_0047157 3300049571 Bacteria 4352
278 Ga0501034_0061900 3300049571 Bacteria 3758
279 Ga0501036_0013461 3300049572 Bacteria 6799
280 Ga0501036_0066881 3300049572 Bacteria 3041
281 Ga0501037_0119743 3300049573 Bacteria 1893
282 Ga0501038_0022820 3300049574 Bacteria 5601
283 Ga0501038_0033542 3300049574 Bacteria 4522
284 Ga0501038_0063785 3300049574 Bacteria 3144
285 Ga0501038_0097028 3300049574 Bacteria 2459
286 Ga0501039_0043957 3300049575 Bacteria 3451
287 Ga0501043_0016594 3300049579 Bacteria 5771
288 Ga0501043_0049731 3300049579 Bacteria 3296
289 Ga0501047_0026580 3300049581 Bacteria 5569
290 Ga0501047_0037314 3300049581 Bacteria 4699
291 Ga0501047_0038843 3300049581 Bacteria 4604
292 Ga0501047_0079603 3300049581 Bacteria 3150
293 Ga0501048_0010085 3300049582 Bacteria 7066
294 Ga0501070_0306033 3300049586 Bacteria 1294
295 Ga0501079_0308148 3300049741 Bacteria 1239
296 Ga0501080_0191483 3300049742 Bacteria 1879
297 Ga0501035_0016972 3300049822 Bacteria 6709
298 Ga0501035_0020015 3300049822 Bacteria 6148
299 Ga0501035_0023644 3300049822 Bacteria 5638
300 Ga0501035_0152662 3300049822 Bacteria 2003
301 Ga0501044_0006941 3300049823 Bacteria 12464
302 Ga0501044_0031794 3300049823 Bacteria 5550
303 Ga0501044_0137228 3300049823 Bacteria 2436
304 Ga0501044_0214526 3300049823 Bacteria 1877
305 nmdc:mga0yw44_317976_c1 3300050492 Bacteria 1045
306 nmdc:mga06z11_9367_c1 3300050494 Bacteria 4126
307 nmdc:mga04h51_17603_c1 3300050495 Bacteria 2093
308 nmdc:mga0sz30_158010_c1 3300050516 Bacteria 1004
309 Ga0495612_0008854 3300053078 Bacteria 4078
310 Ga0500644_0022985 3300053088 Bacteria 1888
311 Ga0500640_000618 3300053095 Bacteria 9237
312 Ga0500560_017140 3300053107 Bacteria 1993
313 Ga0500600_0094579 3300053149 Bacteria 1589
314 Ga0500600_0101671 3300053149 Bacteria 1515
315 Ga0587080_036131 3300059503 Bacteria 882
316 Ga0466962_0001570 3300061719 Bacteria 10683
317 2547408893 2547132111 Bacteria 8013147
318 2554257646 2554235005 Bacteria 6457341
319 2585301046 2582581312 Bacteria 7308206
320 2585306020 2582581313 Bacteria 10042643
321 2585316432 2582581314 Bacteria 11452267
322 2616693778 2616644814 Bacteria 11555299
323 2616904424 2616644941 Bacteria 8510691
324 2643900373 2643221578 Bacteria 9213798
325 2643944303 2643221587 Bacteria 7586415
326 2644015810 2643221601 Bacteria 7493239
327 2644175075 2643221631 Bacteria 8168043
328 2644265114 2643221647 Bacteria 10741251
329 2644405403 2643221673 Bacteria 9196637
330 2644431148 2643221677 Bacteria 7584031
331 2644441795 2643221678 Bacteria 9540101
332 2644630812 2643221714 Bacteria 9015452
333 2784586005 2784132148 Bacteria 8627943
334 2785346954 2784746763 Bacteria 9783172
335 2785366214 2784746768 Bacteria 10036182
336 2786667185 2786546132 Bacteria 10419719
337 2808846814 2808606359 Bacteria 9866990
338 2808917448 2808606375 Bacteria 9466072
339 2809229506 2808606448 Bacteria 8656184
340 2811845594 2808606982 Bacteria 7791042
341 2812361575 2811994879 Bacteria 9313447
342 2812477189 2811994917 Bacteria 7761064
343 2852641708 2852635781 Bacteria 8251373
344 2862282354 2862281513 Bacteria 9621493
345 2862391040 2862382967 Bacteria 10317375
346 2862512830 2862507626 Bacteria 9425308
347 2862580569 2862574272 Bacteria 10567477
348 2867430503 2867428634 Bacteria 9590268
349 2875394995 2875391855 Bacteria 7600475
350 2877684299 2877676314 Bacteria 9512378
351 2912723395 2912715099 Bacteria 9460473
352 2912726813 2912723979 Bacteria 8557534
353 2918508138 2918501144 Bacteria 8668083
354 2919473837 2919468124 Bacteria 9133025
355 2935390928 2935390628 Bacteria 7043367
356 2946049289 2946045630 Bacteria 8527308
357 2946064588 2946064051 Bacteria 8957905
358 2946073005 2946072368 Bacteria 8999607
359 2947224531 2947224130 Bacteria 9938529
360 2954009144 2954002825 Bacteria 9173742
361 2954389639 2954380949 Bacteria 10050426
362 2954682272 2954673503 Bacteria 9685905
363 2954690651 2954682443 Bacteria 9862841
364 2954700479 2954691527 Bacteria 10720516
365 2954701749 2954701450 Bacteria 10834262
366 2954719152 2954711539 Bacteria 10867210
367 2954729123 2954721474 Bacteria 10456478
368 2954732687 2954731030 Bacteria 10243860
369 2954748023 2954740390 Bacteria 10229294
370 2954751566 2954749733 Bacteria 10366972
371 2954767148 2954759201 Bacteria 9358192
372 2990063277 2990059506 Bacteria 9321252
373 2997459251 2997451912 Bacteria 8492419
374 3006398651 3006393351 Bacteria 6615579
375 3006488620 3006486233 Bacteria 8157040
376 3006498630 3006493962 Bacteria 8825450
377 8008560177 8008558824 Bacteria 10610750
378 8008581425 8008574985 Bacteria 7815457
379 8023624555 8023623736 Bacteria 8593882
380 8025483648 8025478263 Bacteria 8209203
381 8048414157 8048406513 Bacteria 8936924
382 8056673497 8056667051 Bacteria 6953971
383 8056834976 8056829672 Bacteria 9045328
384 rootH1_10036297
385 JGI24737J22298_10033929
386 rootH1_10058454
387 rootH2_10022648
388 rootH1_10098056
389 Ga0070709_10129905
390 Ga0070714_100276760
391 Ga0070713_100178181
392 Ga0068853_100102166
393 Ga0070665_100304787
394 Ga0068855_100330478
395 Ga0068856_100637700
396 Ga0081455_10070627
397 Ga0070717_10175774
398 Ga0075365_10099804
399 Ga0075368_10003569
400 Ga0075363_100021728
401 Ga0075363_100051039
402 Ga0075367_10000753
403 Ga0075370_10158644
404 Ga0099826_10092834
405 Ga0105251_10075851
406 Ga0105243_10259389
407 Ga0182008_10001515
408 Ga0182007_10000291
409 Ga0182005_1020492
410 Ga0183367_1003
411 Ga0213876_10054175
412 Ga0224712_10143455
413 Ga0256743_102822
414 Ga0207426_1019088
415 Ga0207647_10012458
416 Ga0207699_10094148
417 Ga0207667_10228218
418 Ga0207702_10259232
419 Ga0209813_10015502
420 Ga0268266_10178717
421 Ga0307517_10025008
422 Ga0307515_10000106
423 Ga0307515_10051551
424 Ga0307511_10002051
425 Ga0307511_10012524
426 Ga0307512_10034435
427 Ga0307512_10104615
428 Ga0307513_10006435
429 Ga0307513_10163077
430 Ga0307509_10004141
431 Ga0307509_10007222
432 Ga0307509_10021254
433 Ga0307508_10036246
434 Ga0307508_10056418
435 Ga0307508_10064584
436 Ga0307514_10005418
437 Ga0307514_10101564
438 Ga0307516_10000711
439 Ga0307516_10009394
440 Ga0307516_10281774
441 Ga0307518_10036585
442 Ga0307518_10088112
443 Ga0307518_10156973
444 Ga0307507_10005664
445 Ga0307507_10005887
446 Ga0307510_10010384
447 Ga0307510_10033747
448 Ga0307510_10039953
449 Ga0307510_10042962
450 Ga0395898_0010345
451 Ga0395898_0036638
452 Ga0395901_0100094
453 Ga0436365_0763918
454 Ga0439436_0012047
455 Ga0439439_0009341
456 Ga0451853_0845322
457 Ga0451853_2707819
458 Ga0451853_3767289
459 Ga0439448_0007614
460 Ga0439449_0001497
461 Ga0439449_0052691
462 Ga0439457_005218
463 Ga0439462_0021541
464 Ga0450896_004852
465 Ga0450898_002555
466 Ga0450898_016029
467 Ga0450903_000037
468 Ga0439458_0001846
469 Ga0439458_0007973
470 Ga0466972_0001948
471 Ga0466972_0018433
472 Ga0466965_0000305
473 Ga0466965_0117064
474 Ga0466966_0014786
475 Ga0466961_0024482
476 Ga0466961_0342448
477 Ga0466963_0000682
478 Ga0466963_0010728
479 Ga0466963_0016306
480 Ga0466971_0069542
481 Ga0466971_0076119
482 Ga0466970_0000323
483 Ga0466970_0003928
484 Ga0466960_0130730
485 Ga0466958_0189687
486 Ga0466967_0001305
487 Ga0466967_0009824
488 Ga0495627_048250
489 Ga0495592_0001777
490 Ga0495592_0008890
491 Ga0495603_0000870
492 Ga0495603_0002388
493 Ga0495603_0004469
494 Ga0495603_0014207
495 Ga0495603_0014721
496 Ga0495603_0024420
497 Ga0495603_0178191
498 Ga0495629_0001850
499 Ga0495629_0003509
500 Ga0495629_0007584
501 Ga0495629_0011108
502 Ga0495629_0014976
503 Ga0495629_0015654
504 Ga0495629_0020104
505 Ga0495629_0049973
506 Ga0495629_0050682
507 Ga0495629_0051688
508 Ga0495638_0057407
509 Ga0495638_0191815
510 Ga0495651_0040747
511 Ga0495651_0051010
512 Ga0495582_0029969
513 Ga0495582_0078545
514 Ga0495605_0002758
515 Ga0495605_0040540
516 Ga0495639_0092817
517 Ga0495662_0002022
518 Ga0495662_0015210
519 Ga0495662_0067866
520 Ga0495664_0007333
521 Ga0495664_0018929
522 Ga0495585_0054620
523 Ga0495585_0201179
524 Ga0495594_0003383
525 Ga0495594_0009553
526 Ga0495594_0035749
527 Ga0495594_0058261
528 Ga0495594_0061067
529 Ga0495594_0122088
530 Ga0495594_0125270
531 Ga0495594_0305910
532 Ga0495596_0093845
533 Ga0495607_0026586
534 Ga0495583_0069262
535 Ga0495583_0069947
536 Ga0495606_0032536
537 Ga0495606_0103986
538 Ga0495608_0230375
539 Ga0495610_0030475
540 Ga0495618_0115532
541 Ga0495628_0009467
542 Ga0495628_0026929
543 Ga0495630_0184173
544 Ga0495630_0362596
545 Ga0495631_0040130
546 Ga0495631_0227760
547 Ga0495648_0057485
548 Ga0495648_0073775
549 Ga0495666_0134466
550 Ga0495666_0167788
551 Ga0495652_0009693
552 Ga0495652_0288953
553 Ga0495654_0069961
554 Ga0495640_0001026
555 Ga0495640_0005875
556 Ga0495586_0126612
557 Ga0495587_0025959
558 Ga0495609_0010921
559 Ga0495622_0001462
560 Ga0495622_0024633
561 Ga0495622_0093101
562 Ga0495633_0128897
563 Ga0495667_0071170
564 Ga0495667_0144064
565 Ga0495667_0239449
566 Ga0495668_0028737
567 Ga0495634_0003255
568 Ga0495634_0148380
569 Ga0495634_0195366
570 Ga0495634_0359530
571 Ga0495611_0012252
572 Ga0495625_0007997
573 Ga0495625_0065775
574 Ga0495625_0195284
575 Ga0495635_0001628
576 Ga0495635_0022724
577 Ga0495661_0059492
578 Ga0495588_0012621
579 Ga0495588_0012852
580 Ga0495588_0039977
581 Ga0495588_0040550
582 Ga0495588_0121574
583 Ga0495657_0000602
584 Ga0495657_0007427
585 Ga0495657_0017427
586 Ga0495657_0029058
587 Ga0495623_0007754
588 Ga0495646_0002903
589 Ga0495646_0113483
590 Ga0495658_0221233
591 Ga0495613_0000692
592 Ga0495613_0001291
593 Ga0495613_0008083
594 Ga0495613_0017739
595 Ga0495613_0044906
596 Ga0495624_0023297
597 Ga0495670_0029114
598 Ga0495671_0019594
599 Ga0495649_0028597
600 Ga0495589_0009682
601 Ga0495589_0034464
602 Ga0495589_0052379
603 Ga0495589_0081377
604 Ga0495600_0004965
605 Ga0495600_0097511
606 Ga0495600_0197604
607 Ga0495600_0335675
608 Ga0495660_0087327
609 Ga0495581_0011453
610 Ga0495581_0021503
611 Ga0495581_0028167
612 Ga0495604_0000721
613 Ga0495604_0006293
614 Ga0495604_0075800
615 Ga0495636_0003684
616 Ga0495636_0010711
617 Ga0495636_0042959
618 Ga0495636_0312841
619 Ga0495674_0219753
620 Ga0495676_0003652
621 Ga0495676_0008112
622 Ga0495676_0010424
623 Ga0495676_0011930
624 Ga0495676_0018216
625 Ga0495676_0024527
626 Ga0495676_0047530
627 Ga0495676_0052568
628 Ga0495680_0013028
629 Ga0495683_0052296
630 Ga0495687_001141
631 Ga0495687_010165
632 Ga0495675_0039557
633 Ga0495675_0072231
634 Ga0495675_0306287
635 Ga0495677_0075769
636 Ga0495685_001020
637 Ga0495685_001222
638 Ga0495685_019421
639 Ga0495681_0007280
640 Ga0495593_0106111
641 Ga0495593_0142599
642 Ga0495602_0043267
643 Ga0495614_0000431
644 Ga0495614_0026727
645 Ga0495614_0033515
646 Ga0495614_0176235
647 Ga0495626_0028351
648 Ga0496105_0445546
649 Ga0496109_0023826
650 Ga0496113_0326140
651 Ga0495678_040311
652 Ga0495678_059895
653 Ga0495682_0078857
654 Ga0501031_0054293
655 Ga0501032_0027569
656 Ga0501033_0005759
657 Ga0501033_0056191
658 Ga0501033_0059425
659 Ga0501034_0015003
660 Ga0501034_0047157
661 Ga0501034_0061900
662 Ga0501036_0013461
663 Ga0501036_0066881
664 Ga0501037_0119743
665 Ga0501038_0022820
666 Ga0501038_0033542
667 Ga0501038_0063785
668 Ga0501038_0097028
669 Ga0501039_0043957
670 Ga0501043_0016594
671 Ga0501043_0049731
672 Ga0501047_0026580
673 Ga0501047_0037314
674 Ga0501047_0038843
675 Ga0501047_0079603
676 Ga0501048_0010085
677 Ga0501070_0306033
678 Ga0501079_0308148
679 Ga0501080_0191483
680 Ga0501035_0016972
681 Ga0501035_0020015
682 Ga0501035_0023644
683 Ga0501035_0152662
684 Ga0501044_0006941
685 Ga0501044_0031794
686 Ga0501044_0137228
687 Ga0501044_0214526
688 nmdc:mga0yw44_317976_c1
689 nmdc:mga06z11_9367_c1
690 nmdc:mga04h51_17603_c1
691 nmdc:mga0sz30_158010_c1
692 Ga0495612_0008854
693 Ga0500644_0022985
694 Ga0500640_000618
695 Ga0500560_017140
696 Ga0500600_0094579
697 Ga0500600_0101671
698 Ga0587080_036131
699 Ga0466962_0001570
700 2547408893
701 2554257646
702 2585301046
703 2585306020
704 2585316432
705 2616693778
706 2616904424
707 2643900373
708 2643944303
709 2644015810
710 2644175075
711 2644265114
712 2644405403
713 2644431148
714 2644441795
715 2644630812
716 2784586005
717 2785346954
718 2785366214
719 2786667185
720 2808846814
721 2808917448
722 2809229506
723 2811845594
724 2812361575
725 2812477189
726 2852641708
727 2862282354
728 2862391040
729 2862512830
730 2862580569
731 2867430503
732 2875394995
733 2877684299
734 2912723395
735 2912726813
736 2918508138
737 2919473837
738 2935390928
739 2946049289
740 2946064588
741 2946073005
742 2947224531
743 2954009144
744 2954389639
745 2954682272
746 2954690651
747 2954700479
748 2954701749
749 2954719152
750 2954729123
751 2954732687
752 2954748023
753 2954751566
754 2954767148
755 2990063277
756 2997459251
757 3006398651
758 3006488620
759 3006498630
760 8008560177
761 8008581425
762 8023624555
763 8025483648
764 8048414157
765 8056673497
766 8056834976

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

11

119

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.9402 5 251
3oxh-assembly1.cif.gz_A mycobacterium tuberculosis kinase inhibitor homolog rv0577 0.8789 5 251
2r6u-assembly2.cif.gz_D crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8254 4 122
2r6u-assembly2.cif.gz_B crystal structure of gene product rha04853 from rhodococcus sp. rha1 0.8101 6 122
2pjs-assembly1.cif.gz_B crystal structure of atu1953, protein of unknown function 0.7846 203 250
ID Description Score Start End Superfamily
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.963 5 125 3.10.180.10
af_I6XA34_8_128_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9553 5 125 3.10.180.10
3oxhA01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9529 6 130 3.10.180.10
af_I6XA34_134_256_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9098 133 251 3.10.180.10
3oxhA02 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8938 3 122 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A370RWE3-F1-model_v4 deleted 0.9903 98 264
AF-A0A6B3HHJ4-F1-model_v4 VOC family protein 0.9884 18 154
AF-A0A5B7V2Q2-F1-model_v4 27 kDa antigen Cfp30B 0.9864 1 262
AF-A0A1C4QG54-F1-model_v4 VOC domain-containing protein 0.9861 61 264
AF-A0A5B7V2Q2-F1-model_v4 27 kDa antigen Cfp30B 0.979 1 262

Map