F429455

General Info

Members Datasets Scaffolds Average Seq Length
382 248 764 338

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2990059506|2990066472
Length 380
Sequence IDPLGSQSSKYERKRLRNDEGGFTVASLTDHTDVKSREKSAVTARITDVARAAGVSASTVSRALRGRTGVSEEVRAQITAVAASLGYTASRSASSLASGRTFTIGVVAPYIGRWFFGTVLDAAEQVFSAAGYDVLLYNLGSPEARKRFFTKLPVRKRVDAVLSLLIPDEDESAALRSLGVPLASTVGGQRPGFTVVGIDDRAGAESAVRHLANLGHRRIGMISGASGPLHWTTPIDRRAAYLHVLTEAGIEHDPALVSDGDYTVEGGERAMTELLAASRPPTAVFAQSDEMAMGALRALRRHRLKVPDDVSVIGFDDHELADVLGLTTVAQPVAGQGAEAARLLLRQLDESADEQPGHVQMPTRLVLRETTAPPRPRGPQ

Samples

Sample ID Description Type Environment
1 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
12 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
18 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
19 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
20 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
29 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
30 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
31 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
32 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
33 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
34 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
37 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
38 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
39 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
52 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
53 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
61 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
62 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
63 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
64 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
65 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
66 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
67 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
68 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
69 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
70 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
71 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
72 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
73 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
74 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
75 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
76 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
77 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
120 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
121 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
122 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
123 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
124 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
125 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
126 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
127 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
128 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
129 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
130 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
131 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
132 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
133 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
134 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
135 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
136 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
137 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
138 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
139 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
140 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
141 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
142 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
143 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
144 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
145 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
146 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
147 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
148 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
149 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
150 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
151 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
152 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
153 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
154 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
155 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
156 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
157 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
158 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
159 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
160 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
161 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
162 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
163 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
164 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
167 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
168 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
169 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
170 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
171 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
172 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
173 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
174 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
175 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
176 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
177 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
178 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
179 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
180 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
181 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
182 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
183 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
184 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
185 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
186 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
187 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
188 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
189 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
190 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
191 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
192 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
193 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
194 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
195 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
196 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
197 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
198 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
199 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
200 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
201 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
202 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
203 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
204 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
205 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
206 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
207 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
208 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
209 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
210 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
211 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
212 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
213 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
214 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
216 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
217 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
218 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
219 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
220 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
221 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
224 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
225 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
226 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
227 2643221647 Streptomyces sp. Root369 Isolate Unclassified
228 2751185782 Actinoplanes subtropicus NRRL B-24665 Isolate Rhizosphere
229 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
230 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
231 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
232 2837183177 Egibacter rhizosphaerae EGI 80759 Isolate Unclassified
233 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
234 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
235 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
236 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
237 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
238 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
239 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
240 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
241 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
242 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
243 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
244 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
245 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
246 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
247 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
248 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 92.93
Metatranscriptomes 0.79
Isolates 6.28

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.52
Nodule 0.52
Rhizoplane 4.19
Rhizosphere 88.48
Stem 0
Stem Tuber 0
Unclassified 0.52

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24735J21928_10032223 3300002067 Bacteria 1552
2 rootL2_10181916 3300003322 Bacteria 2845
3 Ga0070683_100005556 3300005329 Bacteria 10529
4 Ga0070666_10007363 3300005335 Bacteria 6782
5 Ga0070682_100051541 3300005337 Bacteria 2572
6 Ga0068868_100004445 3300005338 Bacteria 9834
7 Ga0070660_100005532 3300005339 Bacteria 8753
8 Ga0070692_10000870 3300005345 Bacteria 10170
9 Ga0070668_100003900 3300005347 Bacteria 11013
10 Ga0070668_100027097 3300005347 Bacteria 4349
11 Ga0070669_100024784 3300005353 Bacteria 4305
12 Ga0070671_100020384 3300005355 Bacteria 5406
13 Ga0070671_100038783 3300005355 Bacteria 3954
14 Ga0070674_100162360 3300005356 Bacteria 1696
15 Ga0070673_100055442 3300005364 Bacteria 3123
16 Ga0070688_100020922 3300005365 Bacteria 3813
17 Ga0070659_100004319 3300005366 Bacteria 10149
18 Ga0070667_100011999 3300005367 Bacteria 7172
19 Ga0070709_10001781 3300005434 Bacteria 11710
20 Ga0070709_10070623 3300005434 Bacteria 2251
21 Ga0070714_100000002 3300005435 Bacteria 386673
22 Ga0070714_100011642 3300005435 Bacteria 6985
23 Ga0070713_100006656 3300005436 Bacteria 8040
24 Ga0070713_100051128 3300005436 Bacteria 3417
25 Ga0070713_100206215 3300005436 Bacteria 1778
26 Ga0070710_10001218 3300005437 Bacteria 12179
27 Ga0070710_10005228 3300005437 Bacteria 6154
28 Ga0070711_100090338 3300005439 Bacteria 2206
29 Ga0070711_100136379 3300005439 Bacteria 1835
30 Ga0070705_100053459 3300005440 Bacteria 2364
31 Ga0070700_100000072 3300005441 Bacteria 71205
32 Ga0070708_100438561 3300005445 Bacteria 1232
33 Ga0070663_100013712 3300005455 Bacteria 5179
34 Ga0070662_100220264 3300005457 Bacteria 1514
35 Ga0070681_10069893 3300005458 Bacteria 3477
36 Ga0070684_100000803 3300005535 Bacteria 21845
37 Ga0068853_100035356 3300005539 Bacteria 4243
38 Ga0070672_100113781 3300005543 Bacteria 2209
39 Ga0070665_100000821 3300005548 Bacteria 40648
40 Ga0070665_100044015 3300005548 Bacteria 4484
41 Ga0070665_100091573 3300005548 Bacteria 3045
42 Ga0070665_100115244 3300005548 Bacteria 2690
43 Ga0070704_100064015 3300005549 Bacteria 2641
44 Ga0068855_100005481 3300005563 Bacteria 15481
45 Ga0068855_100024155 3300005563 Bacteria 7275
46 Ga0068855_100101952 3300005563 Bacteria 3304
47 Ga0068855_100205735 3300005563 Bacteria 2214
48 Ga0068857_100112540 3300005577 Bacteria 2447
49 Ga0068856_100006632 3300005614 Bacteria 11342
50 Ga0068856_100120423 3300005614 Bacteria 2626
51 Ga0070702_100001951 3300005615 Bacteria 8681
52 Ga0068852_100007755 3300005616 Bacteria 7855
53 Ga0068852_100073197 3300005616 Bacteria 3014
54 Ga0068866_10006674 3300005718 Bacteria 4814
55 Ga0068861_100039462 3300005719 Bacteria 3524
56 Ga0068851_10115459 3300005834 Bacteria 1438
57 Ga0068863_100008952 3300005841 Bacteria 9774
58 Ga0068863_100033488 3300005841 Bacteria 4895
59 Ga0068858_100031373 3300005842 Bacteria 4935
60 Ga0068858_100035910 3300005842 Bacteria 4596
61 Ga0068858_100083580 3300005842 Bacteria 2969
62 Ga0068860_100000035 3300005843 Bacteria 238993
63 Ga0068860_100015611 3300005843 Bacteria 7415
64 Ga0068860_100023677 3300005843 Bacteria 5935
65 Ga0068862_100035545 3300005844 Bacteria 4220
66 Ga0070717_10002316 3300006028 Bacteria 13377
67 Ga0070717_10045346 3300006028 Bacteria 3594
68 Ga0070716_100025235 3300006173 Bacteria 3170
69 Ga0070712_100004800 3300006175 Bacteria 8359
70 Ga0070712_100020928 3300006175 Bacteria 4287
71 Ga0075367_10001469 3300006178 Bacteria 10169
72 Ga0068871_100132162 3300006358 Bacteria 2117
73 Ga0075433_10010821 3300006852 Bacteria 7338
74 Ga0068865_100049956 3300006881 Bacteria 2887
75 Ga0075436_100013081 3300006914 Bacteria 5688
76 Ga0075435_100056046 3300007076 Bacteria 3185
77 Ga0105240_10050482 3300009093 Bacteria 5244
78 Ga0105240_10155437 3300009093 Bacteria 2721
79 Ga0105245_10032459 3300009098 Bacteria 4623
80 Ga0105247_10008254 3300009101 Bacteria 6355
81 Ga0105241_10013462 3300009174 Bacteria 5995
82 Ga0105242_10033097 3300009176 Bacteria 4138
83 Ga0105248_10022097 3300009177 Bacteria 7050
84 Ga0105237_10073611 3300009545 Bacteria 3408
85 Ga0105237_10105180 3300009545 Bacteria 2814
86 Ga0105237_10494573 3300009545 Bacteria 1229
87 Ga0105238_10003076 3300009551 Bacteria 16638
88 Ga0105249_10030663 3300009553 Bacteria 4862
89 Ga0105249_10457472 3300009553 Bacteria 1316
90 Ga0105239_10035517 3300010375 Bacteria 5474
91 Ga0105246_10003969 3300011119 Bacteria 8968
92 Ga0157370_10030245 3300013104 Bacteria 5307
93 Ga0157369_10054495 3300013105 Bacteria 4318
94 Ga0157374_10030044 3300013296 Bacteria 4930
95 Ga0157374_10096439 3300013296 Bacteria 2829
96 Ga0157378_10076299 3300013297 Bacteria 3020
97 Ga0157378_10238943 3300013297 Bacteria 1735
98 Ga0163162_10038308 3300013306 Bacteria 4785
99 Ga0157372_10000534 3300013307 Bacteria 41997
100 Ga0157372_10025756 3300013307 Bacteria 6398
101 Ga0157375_10078257 3300013308 Bacteria 3339
102 Ga0163163_10024392 3300014325 Bacteria 5756
103 Ga0157379_10013574 3300014968 Bacteria 7139
104 Ga0157376_10037165 3300014969 Bacteria 3950
105 Ga0163161_10006721 3300017792 Bacteria 7957
106 Ga0206353_10684355 3300020082 Bacteria 1302
107 Ga0206353_10708941 3300020082 Bacteria 3300
108 Ga0207653_10008177 3300025885 Bacteria 3261
109 Ga0207692_10001131 3300025898 Bacteria 9807
110 Ga0207688_10000969 3300025901 Bacteria 14610
111 Ga0207647_10008139 3300025904 Bacteria 7533
112 Ga0207647_10148388 3300025904 Bacteria 1371
113 Ga0207685_10006279 3300025905 Bacteria 3223
114 Ga0207699_10003132 3300025906 Bacteria 7859
115 Ga0207705_10150311 3300025909 Bacteria 1745
116 Ga0207705_10152062 3300025909 Bacteria 1735
117 Ga0207654_10074934 3300025911 Bacteria 2021
118 Ga0207654_10103838 3300025911 Bacteria 1756
119 Ga0207707_10135427 3300025912 Bacteria 2154
120 Ga0207695_10004038 3300025913 Bacteria 20191
121 Ga0207695_10125481 3300025913 Bacteria 2530
122 Ga0207695_10190489 3300025913 Bacteria 1968
123 Ga0207671_10000044 3300025914 Bacteria 205065
124 Ga0207671_10098646 3300025914 Bacteria 2210
125 Ga0207671_10194749 3300025914 Bacteria 1581
126 Ga0207693_10000801 3300025915 Bacteria 28098
127 Ga0207693_10002033 3300025915 Bacteria 17746
128 Ga0207657_10012593 3300025919 Bacteria 8337
129 Ga0207681_10024023 3300025923 Bacteria 3907
130 Ga0207694_10001402 3300025924 Bacteria 20684
131 Ga0207694_10301729 3300025924 Bacteria 1319
132 Ga0207687_10032981 3300025927 Bacteria 3511
133 Ga0207700_10019302 3300025928 Unclassified 4602
134 Ga0207700_10175473 3300025928 Bacteria 1791
135 Ga0207664_10000038 3300025929 Bacteria 166264
136 Ga0207664_10006376 3300025929 Bacteria 8112
137 Ga0207664_10036815 3300025929 Bacteria 3783
138 Ga0207664_10181587 3300025929 Bacteria 1807
139 Ga0207644_10040397 3300025931 Bacteria 3297
140 Ga0207706_10035653 3300025933 Bacteria 4421
141 Ga0207670_10032836 3300025936 Bacteria 3340
142 Ga0207704_10024719 3300025938 Bacteria 3264
143 Ga0207665_10001622 3300025939 Bacteria 15146
144 Ga0207665_10080577 3300025939 Bacteria 2240
145 Ga0207691_10319735 3300025940 Bacteria 1331
146 Ga0207661_10005433 3300025944 Bacteria 8980
147 Ga0207667_10014248 3300025949 Bacteria 9070
148 Ga0207667_10033819 3300025949 Bacteria 5493
149 Ga0207667_10087055 3300025949 Bacteria 3232
150 Ga0207667_10094800 3300025949 Bacteria 3081
151 Ga0207667_10274054 3300025949 Bacteria 1725
152 Ga0207668_10019574 3300025972 Bacteria 4282
153 Ga0207640_10031990 3300025981 Bacteria 3258
154 Ga0207658_10006150 3300025986 Bacteria 8195
155 Ga0207703_10053245 3300026035 Bacteria 3289
156 Ga0207639_10206201 3300026041 Bacteria 1689
157 Ga0207678_10004480 3300026067 Bacteria 12560
158 Ga0207708_10000023 3300026075 Bacteria 176615
159 Ga0207708_10065749 3300026075 Bacteria 2772
160 Ga0207702_10009984 3300026078 Bacteria 7959
161 Ga0207702_10040797 3300026078 Bacteria 3891
162 Ga0207641_10005529 3300026088 Bacteria 10783
163 Ga0207641_10143778 3300026088 Bacteria 2155
164 Ga0207674_10132408 3300026116 Bacteria 2456
165 Ga0207675_100014461 3300026118 Bacteria 7358
166 Ga0207683_10001840 3300026121 Bacteria 18748
167 Ga0207698_10299422 3300026142 Bacteria 1496
168 Ga0268266_10003777 3300028379 Bacteria 14835
169 Ga0268265_10093341 3300028380 Bacteria 2411
170 Ga0268264_10000031 3300028381 Bacteria 409525
171 Ga0307515_10152764 3300028794 Bacteria 2403
172 Ga0307513_10019461 3300031456 Bacteria 8082
173 Ga0307508_10002892 3300031616 Bacteria 17745
174 Ga0307415_100187857 3300032126 Bacteria 1628
175 Ga0373929_0004154 3300035085 Bacteria 2598
176 Ga0373940_0005756 3300035088 Bacteria 2706
177 Ga0373951_0005988 3300035091 Bacteria 2803
178 Ga0373932_0008455 3300035112 Bacteria 2462
179 Ga0373960_0001968 3300035121 Bacteria 4607
180 Ga0373942_0026871 3300035207 Bacteria 1493
181 Ga0373931_0042725 3300035691 Bacteria 2384
182 Ga0373927_0094389 3300035695 Bacteria 1944
183 Ga0372808_008526 3300036459 Bacteria 1422
184 Ga0395898_0059207 3300037466 Bacteria 3727
185 Ga0436365_0579365 3300039437 Bacteria 3385
186 Ga0439436_0001391 3300041404 Bacteria 6985
187 Ga0439439_0019459 3300041406 Bacteria 1685
188 Ga0451853_0023316 3300041512 Bacteria 4322
189 Ga0451853_1333405 3300041512 Bacteria 3379
190 Ga0439433_0002150 3300041999 Bacteria 4150
191 Ga0439433_0007582 3300041999 Bacteria 2345
192 Ga0439442_015096 3300042002 Bacteria 1590
193 Ga0439449_0008074 3300042007 Bacteria 3999
194 Ga0439449_0036796 3300042007 Bacteria 1820
195 Ga0439457_000032 3300042014 Bacteria 28723
196 Ga0439457_001067 3300042014 Bacteria 8272
197 Ga0439462_0003046 3300042015 Bacteria 3981
198 Ga0450894_000803 3300042131 Bacteria 5084
199 Ga0450896_001633 3300042133 Bacteria 2800
200 Ga0450906_000533 3300042145 Bacteria 7984
201 Ga0466969_0033003 3300044656 Bacteria 2631
202 Ga0466969_0040565 3300044656 Bacteria 2332
203 Ga0466972_0016983 3300044658 Bacteria 3641
204 Ga0466972_0019529 3300044658 Bacteria 3388
205 Ga0466972_0138985 3300044658 Bacteria 1143
206 Ga0466965_0060132 3300044683 Bacteria 1897
207 Ga0466965_0088607 3300044683 Bacteria 1572
208 Ga0466965_0094551 3300044683 Bacteria 1523
209 Ga0466966_0024763 3300044684 Bacteria 3926
210 Ga0466966_0070287 3300044684 Bacteria 2195
211 Ga0466966_0072660 3300044684 Bacteria 2153
212 Ga0466966_0083602 3300044684 Bacteria 1986
213 Ga0466966_0084976 3300044684 Bacteria 1967
214 Ga0466966_0106365 3300044684 Bacteria 1732
215 Ga0466966_0142336 3300044684 Bacteria 1465
216 Ga0466961_0007418 3300044693 Bacteria 6982
217 Ga0466961_0008737 3300044693 Bacteria 6459
218 Ga0466961_0009410 3300044693 Bacteria 6221
219 Ga0466961_0010245 3300044693 Bacteria 5971
220 Ga0466961_0013548 3300044693 Bacteria 5222
221 Ga0466961_0086049 3300044693 Bacteria 1987
222 Ga0466961_0199954 3300044693 Bacteria 1236
223 Ga0466961_0201860 3300044693 Unclassified 1229
224 Ga0466963_0002645 3300044694 Bacteria 10068
225 Ga0466963_0009635 3300044694 Bacteria 5823
226 Ga0466963_0011640 3300044694 Bacteria 5358
227 Ga0466963_0020560 3300044694 Bacteria 4150
228 Ga0466963_0029116 3300044694 Bacteria 3552
229 Ga0466963_0032262 3300044694 Bacteria 3391
230 Ga0466963_0034593 3300044694 Bacteria 3288
231 Ga0466963_0038227 3300044694 Bacteria 3137
232 Ga0466963_0083813 3300044694 Bacteria 2162
233 Ga0466963_0167430 3300044694 Bacteria 1531
234 Ga0466963_0285810 3300044694 Bacteria 1159
235 Ga0466964_0000816 3300044706 Bacteria 10197
236 Ga0466964_0077371 3300044706 Bacteria 1420
237 Ga0466971_0005818 3300044719 Bacteria 5367
238 Ga0466971_0050726 3300044719 Bacteria 1867
239 Ga0466968_0012903 3300044735 Bacteria 3278
240 Ga0466957_0002190 3300044842 Bacteria 10472
241 Ga0466957_0015450 3300044842 Bacteria 4459
242 Ga0466957_0096123 3300044842 Bacteria 1861
243 Ga0466960_0005245 3300044901 Bacteria 5123
244 Ga0466960_0009893 3300044901 Bacteria 3944
245 Ga0466959_0065230 3300045049 Bacteria 2642
246 Ga0466959_0094680 3300045049 Bacteria 2142
247 Ga0466959_0100199 3300045049 Bacteria 2074
248 Ga0466958_0007533 3300045836 Bacteria 5991
249 Ga0466958_0014624 3300045836 Bacteria 4481
250 Ga0466958_0029847 3300045836 Bacteria 3236
251 Ga0466958_0060919 3300045836 Bacteria 2298
252 Ga0466958_0068425 3300045836 Bacteria 2170
253 Ga0466958_0073327 3300045836 Bacteria 2097
254 Ga0466958_0218384 3300045836 Bacteria 1216
255 Ga0466958_0235756 3300045836 Bacteria 1169
256 Ga0466967_0000184 3300045976 Bacteria 25866
257 Ga0466967_0001144 3300045976 Bacteria 14819
258 Ga0466967_0003429 3300045976 Bacteria 10341
259 Ga0466967_0014361 3300045976 Bacteria 6166
260 Ga0466967_0025761 3300045976 Bacteria 4854
261 Ga0466967_0036798 3300045976 Bacteria 4182
262 Ga0466967_0039399 3300045976 Bacteria 4062
263 Ga0466967_0042641 3300045976 Bacteria 3922
264 Ga0466967_0046523 3300045976 Bacteria 3778
265 Ga0466967_0046682 3300045976 Bacteria 3773
266 Ga0466967_0058401 3300045976 Bacteria 3410
267 Ga0466967_0060280 3300045976 Bacteria 3362
268 Ga0466967_0067964 3300045976 Bacteria 3180
269 Ga0466967_0186967 3300045976 Bacteria 1956
270 Ga0495617_002123 3300046452 Bacteria 8156
271 Ga0495617_021320 3300046452 Bacteria 2188
272 Ga0495603_0039735 3300046455 Bacteria 2817
273 Ga0495603_0129273 3300046455 Bacteria 1471
274 Ga0495629_0003250 3300046459 Bacteria 12311
275 Ga0495629_0011637 3300046459 Bacteria 6388
276 Ga0495651_0025485 3300046462 Bacteria 4602
277 Ga0495605_0006033 3300046474 Bacteria 7002
278 Ga0495585_0009129 3300046492 Bacteria 5970
279 Ga0495594_0018564 3300046499 Bacteria 3686
280 Ga0495594_0085570 3300046499 Bacteria 1763
281 Ga0495583_0007426 3300046506 Bacteria 6889
282 Ga0495606_0010214 3300046507 Bacteria 7824
283 Ga0495620_0028059 3300046515 Bacteria 2623
284 Ga0495628_0024563 3300046516 Bacteria 4931
285 Ga0495628_0066736 3300046516 Bacteria 2812
286 Ga0495666_0020930 3300046526 Bacteria 3238
287 Ga0495652_0000482 3300046529 Bacteria 46791
288 Ga0495652_0010162 3300046529 Bacteria 8533
289 Ga0495640_0099137 3300046533 Bacteria 1914
290 Ga0495597_0011307 3300046542 Bacteria 4333
291 Ga0495622_0005599 3300046557 Bacteria 5825
292 Ga0495633_0030264 3300046558 Bacteria 2630
293 Ga0495668_0009663 3300046616 Bacteria 5898
294 Ga0495668_0040911 3300046616 Bacteria 2584
295 Ga0495634_0023570 3300046642 Bacteria 4323
296 Ga0495634_0127539 3300046642 Bacteria 1625
297 Ga0495611_0007307 3300046648 Bacteria 4692
298 Ga0495625_0024864 3300046660 Bacteria 4548
299 Ga0495657_0007820 3300046675 Bacteria 8206
300 Ga0495623_0007447 3300046679 Bacteria 7107
301 Ga0495646_0021584 3300046680 Bacteria 4067
302 Ga0495613_0085460 3300046689 Bacteria 2289
303 Ga0495613_0209530 3300046689 Bacteria 1371
304 Ga0495624_0019680 3300046690 Bacteria 4500
305 Ga0495624_0092634 3300046690 Bacteria 1864
306 Ga0495624_0122235 3300046690 Bacteria 1598
307 Ga0495649_0050286 3300046694 Bacteria 2262
308 Ga0495589_0018263 3300046794 Bacteria 3597
309 Ga0495600_0035443 3300046809 Bacteria 3241
310 Ga0495660_0031931 3300046810 Bacteria 2958
311 Ga0495581_0018337 3300047315 Bacteria 4065
312 Ga0495604_0008202 3300047317 Bacteria 8265
313 Ga0495676_0006529 3300047321 Bacteria 10747
314 Ga0495676_0015914 3300047321 Bacteria 6683
315 Ga0495683_0053369 3300047323 Bacteria 2016
316 Ga0495687_013705 3300047443 Bacteria 4212
317 Ga0495675_0145287 3300047444 Bacteria 1468
318 Ga0495685_005969 3300047447 Bacteria 3978
319 Ga0496102_0000439 3300048905 Bacteria 47479
320 Ga0496102_0112130 3300048905 Bacteria 2543
321 Ga0496102_0185335 3300048905 Bacteria 1961
322 Ga0496103_0016772 3300048906 Bacteria 4375
323 Ga0496104_0020950 3300048907 Bacteria 5997
324 Ga0496105_0345054 3300048908 Bacteria 1190
325 Ga0496107_0048146 3300048910 Bacteria 3070
326 Ga0496108_0044335 3300048911 Bacteria 3713
327 Ga0496109_0017254 3300048912 Bacteria 6325
328 Ga0496109_0120693 3300048912 Bacteria 2442
329 Ga0496110_0007696 3300048913 Bacteria 8620
330 Ga0496110_0177173 3300048913 Bacteria 1935
331 Ga0496111_0024234 3300048914 Bacteria 4270
332 Ga0496111_0098031 3300048914 Bacteria 2152
333 Ga0496113_0010189 3300048916 Bacteria 6205
334 Ga0496114_0033363 3300048917 Bacteria 4242
335 Ga0496119_0001193 3300048922 Bacteria 32523
336 Ga0496120_0010523 3300048923 Bacteria 6445
337 Ga0496121_0021221 3300048924 Bacteria 6374
338 Ga0496126_0000006 3300048929 Bacteria 798804
339 Ga0501033_0058283 3300049570 Bacteria 2853
340 Ga0501036_0064351 3300049572 Bacteria 3104
341 Ga0501037_0033649 3300049573 Bacteria 3785
342 Ga0501037_0229867 3300049573 Bacteria 1303
343 Ga0501038_0001252 3300049574 Bacteria 23042
344 Ga0501043_0002000 3300049579 Bacteria 17395
345 Ga0501046_0114800 3300049580 Bacteria 2054
346 Ga0501048_0000047 3300049582 Bacteria 59594
347 Ga0501070_0003775 3300049586 Bacteria 13086
348 Ga0501081_0048698 3300049743 Bacteria 2917
349 Ga0501035_0234637 3300049822 Bacteria 1562
350 Ga0501044_0038646 3300049823 Bacteria 4984
351 Ga0501044_0107527 3300049823 Bacteria 2800
352 Ga0501044_0113247 3300049823 Bacteria 2720
353 nmdc:mga06z11_3055_c1 3300050494 Bacteria 6442
354 nmdc:mga0a205_50053_c1 3300050515 Bacteria 4034
355 Ga0466962_0006494 3300061719 Bacteria 5613
356 Ga0466962_0006871 3300061719 Bacteria 5457
357 Ga0466962_0007389 3300061719 Bacteria 5271
358 Ga0466962_0046552 3300061719 Bacteria 2072
359 2990066472 2990059506 Bacteria 9321252
360 2585321489 2582581314 Bacteria 11452267
361 2644269010 2643221647 Bacteria 10741251
362 2753265516 2751185782 Bacteria 11227053
363 2768644993 2767802112 Bacteria 6465194
364 2785341308 2784746763 Bacteria 9783172
365 2812358091 2811994879 Bacteria 9313447
366 2837186581 2837183177 Bacteria 4637169
367 2852636656 2852635781 Bacteria 8251373
368 2862392426 2862382967 Bacteria 10317375
369 2862511840 2862507626 Bacteria 9425308
370 2862708458 2862705112 Bacteria 6563286
371 2863408503 2863404153 Bacteria 9672205
372 2867351697 2867346516 Bacteria 7608576
373 2912719941 2912715099 Bacteria 9460473
374 2947233021 2947224130 Bacteria 9938529
375 2954381190 2954380949 Bacteria 10050426
376 2954698137 2954691527 Bacteria 10720516
377 2954704080 2954701450 Bacteria 10834262
378 2990047125 2990044586 Bacteria 6603797
379 8008488501 8008485437 Bacteria 7198341
380 8008562674 8008558824 Bacteria 10610750
381 8025527452 8025524527 Bacteria 7197316
382 8048406568 8048406513 Bacteria 8936924
383 JGI24735J21928_10032223
384 rootL2_10181916
385 Ga0070683_100005556
386 Ga0070666_10007363
387 Ga0070682_100051541
388 Ga0068868_100004445
389 Ga0070660_100005532
390 Ga0070692_10000870
391 Ga0070668_100003900
392 Ga0070668_100027097
393 Ga0070669_100024784
394 Ga0070671_100020384
395 Ga0070671_100038783
396 Ga0070674_100162360
397 Ga0070673_100055442
398 Ga0070688_100020922
399 Ga0070659_100004319
400 Ga0070667_100011999
401 Ga0070709_10001781
402 Ga0070709_10070623
403 Ga0070714_100000002
404 Ga0070714_100011642
405 Ga0070713_100006656
406 Ga0070713_100051128
407 Ga0070713_100206215
408 Ga0070710_10001218
409 Ga0070710_10005228
410 Ga0070711_100090338
411 Ga0070711_100136379
412 Ga0070705_100053459
413 Ga0070700_100000072
414 Ga0070708_100438561
415 Ga0070663_100013712
416 Ga0070662_100220264
417 Ga0070681_10069893
418 Ga0070684_100000803
419 Ga0068853_100035356
420 Ga0070672_100113781
421 Ga0070665_100000821
422 Ga0070665_100044015
423 Ga0070665_100091573
424 Ga0070665_100115244
425 Ga0070704_100064015
426 Ga0068855_100005481
427 Ga0068855_100024155
428 Ga0068855_100101952
429 Ga0068855_100205735
430 Ga0068857_100112540
431 Ga0068856_100006632
432 Ga0068856_100120423
433 Ga0070702_100001951
434 Ga0068852_100007755
435 Ga0068852_100073197
436 Ga0068866_10006674
437 Ga0068861_100039462
438 Ga0068851_10115459
439 Ga0068863_100008952
440 Ga0068863_100033488
441 Ga0068858_100031373
442 Ga0068858_100035910
443 Ga0068858_100083580
444 Ga0068860_100000035
445 Ga0068860_100015611
446 Ga0068860_100023677
447 Ga0068862_100035545
448 Ga0070717_10002316
449 Ga0070717_10045346
450 Ga0070716_100025235
451 Ga0070712_100004800
452 Ga0070712_100020928
453 Ga0075367_10001469
454 Ga0068871_100132162
455 Ga0075433_10010821
456 Ga0068865_100049956
457 Ga0075436_100013081
458 Ga0075435_100056046
459 Ga0105240_10050482
460 Ga0105240_10155437
461 Ga0105245_10032459
462 Ga0105247_10008254
463 Ga0105241_10013462
464 Ga0105242_10033097
465 Ga0105248_10022097
466 Ga0105237_10073611
467 Ga0105237_10105180
468 Ga0105237_10494573
469 Ga0105238_10003076
470 Ga0105249_10030663
471 Ga0105249_10457472
472 Ga0105239_10035517
473 Ga0105246_10003969
474 Ga0157370_10030245
475 Ga0157369_10054495
476 Ga0157374_10030044
477 Ga0157374_10096439
478 Ga0157378_10076299
479 Ga0157378_10238943
480 Ga0163162_10038308
481 Ga0157372_10000534
482 Ga0157372_10025756
483 Ga0157375_10078257
484 Ga0163163_10024392
485 Ga0157379_10013574
486 Ga0157376_10037165
487 Ga0163161_10006721
488 Ga0206353_10684355
489 Ga0206353_10708941
490 Ga0207653_10008177
491 Ga0207692_10001131
492 Ga0207688_10000969
493 Ga0207647_10008139
494 Ga0207647_10148388
495 Ga0207685_10006279
496 Ga0207699_10003132
497 Ga0207705_10150311
498 Ga0207705_10152062
499 Ga0207654_10074934
500 Ga0207654_10103838
501 Ga0207707_10135427
502 Ga0207695_10004038
503 Ga0207695_10125481
504 Ga0207695_10190489
505 Ga0207671_10000044
506 Ga0207671_10098646
507 Ga0207671_10194749
508 Ga0207693_10000801
509 Ga0207693_10002033
510 Ga0207657_10012593
511 Ga0207681_10024023
512 Ga0207694_10001402
513 Ga0207694_10301729
514 Ga0207687_10032981
515 Ga0207700_10019302
516 Ga0207700_10175473
517 Ga0207664_10000038
518 Ga0207664_10006376
519 Ga0207664_10036815
520 Ga0207664_10181587
521 Ga0207644_10040397
522 Ga0207706_10035653
523 Ga0207670_10032836
524 Ga0207704_10024719
525 Ga0207665_10001622
526 Ga0207665_10080577
527 Ga0207691_10319735
528 Ga0207661_10005433
529 Ga0207667_10014248
530 Ga0207667_10033819
531 Ga0207667_10087055
532 Ga0207667_10094800
533 Ga0207667_10274054
534 Ga0207668_10019574
535 Ga0207640_10031990
536 Ga0207658_10006150
537 Ga0207703_10053245
538 Ga0207639_10206201
539 Ga0207678_10004480
540 Ga0207708_10000023
541 Ga0207708_10065749
542 Ga0207702_10009984
543 Ga0207702_10040797
544 Ga0207641_10005529
545 Ga0207641_10143778
546 Ga0207674_10132408
547 Ga0207675_100014461
548 Ga0207683_10001840
549 Ga0207698_10299422
550 Ga0268266_10003777
551 Ga0268265_10093341
552 Ga0268264_10000031
553 Ga0307515_10152764
554 Ga0307513_10019461
555 Ga0307508_10002892
556 Ga0307415_100187857
557 Ga0373929_0004154
558 Ga0373940_0005756
559 Ga0373951_0005988
560 Ga0373932_0008455
561 Ga0373960_0001968
562 Ga0373942_0026871
563 Ga0373931_0042725
564 Ga0373927_0094389
565 Ga0372808_008526
566 Ga0395898_0059207
567 Ga0436365_0579365
568 Ga0439436_0001391
569 Ga0439439_0019459
570 Ga0451853_0023316
571 Ga0451853_1333405
572 Ga0439433_0002150
573 Ga0439433_0007582
574 Ga0439442_015096
575 Ga0439449_0008074
576 Ga0439449_0036796
577 Ga0439457_000032
578 Ga0439457_001067
579 Ga0439462_0003046
580 Ga0450894_000803
581 Ga0450896_001633
582 Ga0450906_000533
583 Ga0466969_0033003
584 Ga0466969_0040565
585 Ga0466972_0016983
586 Ga0466972_0019529
587 Ga0466972_0138985
588 Ga0466965_0060132
589 Ga0466965_0088607
590 Ga0466965_0094551
591 Ga0466966_0024763
592 Ga0466966_0070287
593 Ga0466966_0072660
594 Ga0466966_0083602
595 Ga0466966_0084976
596 Ga0466966_0106365
597 Ga0466966_0142336
598 Ga0466961_0007418
599 Ga0466961_0008737
600 Ga0466961_0009410
601 Ga0466961_0010245
602 Ga0466961_0013548
603 Ga0466961_0086049
604 Ga0466961_0199954
605 Ga0466961_0201860
606 Ga0466963_0002645
607 Ga0466963_0009635
608 Ga0466963_0011640
609 Ga0466963_0020560
610 Ga0466963_0029116
611 Ga0466963_0032262
612 Ga0466963_0034593
613 Ga0466963_0038227
614 Ga0466963_0083813
615 Ga0466963_0167430
616 Ga0466963_0285810
617 Ga0466964_0000816
618 Ga0466964_0077371
619 Ga0466971_0005818
620 Ga0466971_0050726
621 Ga0466968_0012903
622 Ga0466957_0002190
623 Ga0466957_0015450
624 Ga0466957_0096123
625 Ga0466960_0005245
626 Ga0466960_0009893
627 Ga0466959_0065230
628 Ga0466959_0094680
629 Ga0466959_0100199
630 Ga0466958_0007533
631 Ga0466958_0014624
632 Ga0466958_0029847
633 Ga0466958_0060919
634 Ga0466958_0068425
635 Ga0466958_0073327
636 Ga0466958_0218384
637 Ga0466958_0235756
638 Ga0466967_0000184
639 Ga0466967_0001144
640 Ga0466967_0003429
641 Ga0466967_0014361
642 Ga0466967_0025761
643 Ga0466967_0036798
644 Ga0466967_0039399
645 Ga0466967_0042641
646 Ga0466967_0046523
647 Ga0466967_0046682
648 Ga0466967_0058401
649 Ga0466967_0060280
650 Ga0466967_0067964
651 Ga0466967_0186967
652 Ga0495617_002123
653 Ga0495617_021320
654 Ga0495603_0039735
655 Ga0495603_0129273
656 Ga0495629_0003250
657 Ga0495629_0011637
658 Ga0495651_0025485
659 Ga0495605_0006033
660 Ga0495585_0009129
661 Ga0495594_0018564
662 Ga0495594_0085570
663 Ga0495583_0007426
664 Ga0495606_0010214
665 Ga0495620_0028059
666 Ga0495628_0024563
667 Ga0495628_0066736
668 Ga0495666_0020930
669 Ga0495652_0000482
670 Ga0495652_0010162
671 Ga0495640_0099137
672 Ga0495597_0011307
673 Ga0495622_0005599
674 Ga0495633_0030264
675 Ga0495668_0009663
676 Ga0495668_0040911
677 Ga0495634_0023570
678 Ga0495634_0127539
679 Ga0495611_0007307
680 Ga0495625_0024864
681 Ga0495657_0007820
682 Ga0495623_0007447
683 Ga0495646_0021584
684 Ga0495613_0085460
685 Ga0495613_0209530
686 Ga0495624_0019680
687 Ga0495624_0092634
688 Ga0495624_0122235
689 Ga0495649_0050286
690 Ga0495589_0018263
691 Ga0495600_0035443
692 Ga0495660_0031931
693 Ga0495581_0018337
694 Ga0495604_0008202
695 Ga0495676_0006529
696 Ga0495676_0015914
697 Ga0495683_0053369
698 Ga0495687_013705
699 Ga0495675_0145287
700 Ga0495685_005969
701 Ga0496102_0000439
702 Ga0496102_0112130
703 Ga0496102_0185335
704 Ga0496103_0016772
705 Ga0496104_0020950
706 Ga0496105_0345054
707 Ga0496107_0048146
708 Ga0496108_0044335
709 Ga0496109_0017254
710 Ga0496109_0120693
711 Ga0496110_0007696
712 Ga0496110_0177173
713 Ga0496111_0024234
714 Ga0496111_0098031
715 Ga0496113_0010189
716 Ga0496114_0033363
717 Ga0496119_0001193
718 Ga0496120_0010523
719 Ga0496121_0021221
720 Ga0496126_0000006
721 Ga0501033_0058283
722 Ga0501036_0064351
723 Ga0501037_0033649
724 Ga0501037_0229867
725 Ga0501038_0001252
726 Ga0501043_0002000
727 Ga0501046_0114800
728 Ga0501048_0000047
729 Ga0501070_0003775
730 Ga0501081_0048698
731 Ga0501035_0234637
732 Ga0501044_0038646
733 Ga0501044_0107527
734 Ga0501044_0113247
735 nmdc:mga06z11_3055_c1
736 nmdc:mga0a205_50053_c1
737 Ga0466962_0006494
738 Ga0466962_0006871
739 Ga0466962_0007389
740 Ga0466962_0046552
741 2990066472
742 2585321489
743 2644269010
744 2753265516
745 2768644993
746 2785341308
747 2812358091
748 2837186581
749 2852636656
750 2862392426
751 2862511840
752 2862708458
753 2863408503
754 2867351697
755 2912719941
756 2947233021
757 2954381190
758 2954698137
759 2954704080
760 2990047125
761 8008488501
762 8008562674
763 8025527452
764 8048406568

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00356

LacI

Bacterial regulatory proteins, lacI family

45

90

0.96

PF13377

Peripla_BP_3

Periplasmic binding protein-like domain

208

371

0.87

PF13407

Peripla_BP_4

Periplasmic binding protein domain

104

352

0.83

PF00532

Peripla_BP_1

Periplasmic binding proteins and sugar binding domain of LacI family

101

369

0.79

Structural Annotation

Top 5 Hits

ID Description Score Start End
1osl-assembly1.cif.gz_A solution structure of a dimeric lactose dna-binding domain complexed to a nonspecific dna sequence 0.9164 3 47
1sxg-assembly3.cif.gz_F structural studies on the apo transcription factor form b. megaterium 0.91 62 330
2fep-assembly1.cif.gz_A-2 structure of truncated ccpa in complex with p-ser-hpr and sulfate ions 0.907 61 330
3k4h-assembly1.cif.gz_A crystal structure of putative transcriptional regulator laci from bacillus cereus subsp. cytotoxis nvh 391-98 0.9033 62 329
3clk-assembly1.cif.gz_A crystal structure of a transcription regulator from lactobacillus plantarum 0.899 60 330
ID Description Score Start End Superfamily
2jcgA01 Mainly Alpha;Orthogonal Bundle;434 Repressor (Amino-terminal Domain);lambda repressor-like DNA-binding domains 0.952 3 50 1.10.260.40
1jhzB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9506 160 288 3.40.50.2300
2jcgA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9289 158 288 3.40.50.2300
2rgyA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9176 158 288 3.40.50.2300
3clkB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9128 160 288 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A0F0G9R0-F1-model_v4 LacI family transcriptional regulator 0.9527 170 292 GO:0000976
GO:0003700
AF-A0A6M1HZD1-F1-model_v4 deleted 0.9517 159 292
AF-A0A3B9JCF2-F1-model_v4 Transcriptional regulator LacI/GalR-like sensor domain-containing protein 0.9453 222 330 GO:0000976
GO:0003700
AF-A0A6I2WUB6-F1-model_v4 deleted 0.9428 111 330
AF-A0A4Q6DTD8-F1-model_v4 deleted 0.9333 174 330

Map