F429439

General Info

Members Datasets Scaffolds Average Seq Length
382 195 764 137

Family's Representative Sequence

Representative Sequence 3300053090|Ga0500646_0002649|Ga0500646_0002649_2221_2748
Length 156
Sequence VFSTEKYRDNHLFYPQIWRTLPIIKIYIVMIKMQVIGHLGKDCTTNLANGRSVMNFTIAHTEKYKDAQGAMKEKTTWVDCAYWTDRTGIAPYLKKGTQVFVEGTPDLRMFTRNDGTNGGTLTLTVRQVQLLGGGRSENSSSVATTENPEPIDDLPF

Samples

Sample ID Description Type Environment
1 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
59 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
66 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
69 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
70 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
73 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
74 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
75 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
76 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
77 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
78 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
79 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
80 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
81 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
82 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
83 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
84 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
85 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
90 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
91 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
142 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
143 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
144 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
149 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
150 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
151 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
152 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
153 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
154 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
155 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
156 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
157 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
158 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
159 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
160 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
161 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
162 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
163 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
164 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
165 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
166 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
167 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
168 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
169 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
170 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
173 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
174 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
175 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
176 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
177 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
178 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
179 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
180 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
181 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
182 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
183 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
184 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
187 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
190 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
191 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
192 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
193 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
194 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
195 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 1.57
Rhizosphere 95.55
Stem 0
Stem Tuber 0
Unclassified 16.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500646_0002649 3300053090 Bacteria 4632
2 SwRhRL2b_contig_3747236 2162886007 Unclassified 944
3 rootH1_10055709 3300003316 Bacteria 3174
4 rootL2_10151316 3300003322 Bacteria 4585
5 Ga0065704_10188741 3300005289 Bacteria 1200
6 Ga0065712_10021502 3300005290 Bacteria 1676
7 Ga0065712_10029017 3300005290 Bacteria 1548
8 Ga0065712_10462298 3300005290 Bacteria 675
9 Ga0065707_10396757 3300005295 Bacteria 858
10 Ga0065707_10418818 3300005295 Bacteria 833
11 Ga0070658_10345120 3300005327 Bacteria 1274
12 Ga0070676_10046343 3300005328 Unclassified 2535
13 Ga0070683_101015832 3300005329 Bacteria 796
14 Ga0070690_100027625 3300005330 Bacteria 3508
15 Ga0070690_100693118 3300005330 Bacteria 782
16 Ga0070670_100167182 3300005331 Bacteria 1907
17 Ga0070670_100174825 3300005331 Bacteria 1863
18 Ga0070670_100886603 3300005331 Bacteria 808
19 Ga0070670_101166215 3300005331 Unclassified 703
20 Ga0068869_100047469 3300005334 Bacteria 3102
21 Ga0068869_100089666 3300005334 Bacteria 2310
22 Ga0068869_100496943 3300005334 Bacteria 1018
23 Ga0068869_100497069 3300005334 Bacteria 1018
24 Ga0068869_101231236 3300005334 Bacteria 659
25 Ga0070666_10051177 3300005335 Bacteria 2781
26 Ga0070666_10465696 3300005335 Bacteria 914
27 Ga0070680_100122935 3300005336 Bacteria 2167
28 Ga0070680_101345812 3300005336 Bacteria 618
29 Ga0070682_100000044 3300005337 Bacteria 133653
30 Ga0070682_100065804 3300005337 Unclassified 2304
31 Ga0070682_100595443 3300005337 Bacteria 872
32 Ga0068868_100109096 3300005338 Bacteria 2247
33 Ga0068868_100343390 3300005338 Bacteria 1277
34 Ga0068868_100694236 3300005338 Bacteria 910
35 Ga0068868_102060185 3300005338 Bacteria 542
36 Ga0070660_100111324 3300005339 Unclassified 2178
37 Ga0070689_100822020 3300005340 Bacteria 818
38 Ga0070687_100090302 3300005343 Bacteria 1693
39 Ga0070687_101024559 3300005343 Bacteria 599
40 Ga0070692_10935575 3300005345 Bacteria 602
41 Ga0070668_100110726 3300005347 Unclassified 2185
42 Ga0070668_100255019 3300005347 Bacteria 1457
43 Ga0070668_100340053 3300005347 Bacteria 1268
44 Ga0070669_100094318 3300005353 Bacteria 2249
45 Ga0070669_100206041 3300005353 Bacteria 1549
46 Ga0070669_100364018 3300005353 Bacteria 1176
47 Ga0070675_100028844 3300005354 Bacteria 4470
48 Ga0070675_100290909 3300005354 Bacteria 1438
49 Ga0070675_100755371 3300005354 Bacteria 887
50 Ga0070671_100113583 3300005355 Bacteria 2276
51 Ga0070671_100421305 3300005355 Bacteria 1143
52 Ga0070674_100659422 3300005356 Bacteria 890
53 Ga0070674_100933304 3300005356 Bacteria 758
54 Ga0070674_101247495 3300005356 Bacteria 661
55 Ga0070673_100309336 3300005364 Bacteria 1393
56 Ga0070673_101055432 3300005364 Bacteria 758
57 Ga0070688_100346159 3300005365 Bacteria 1087
58 Ga0070688_100652517 3300005365 Bacteria 810
59 Ga0070688_100995822 3300005365 Bacteria 665
60 Ga0070659_100568234 3300005366 Bacteria 972
61 Ga0070659_100689035 3300005366 Unclassified 883
62 Ga0070667_100501590 3300005367 Bacteria 1112
63 Ga0070667_100511341 3300005367 Bacteria 1101
64 Ga0070667_101118508 3300005367 Bacteria 736
65 Ga0070663_100632570 3300005455 Bacteria 903
66 Ga0070678_100115771 3300005456 Bacteria 2105
67 Ga0070678_100147110 3300005456 Bacteria 1893
68 Ga0070678_100533389 3300005456 Bacteria 1040
69 Ga0070662_100342987 3300005457 Bacteria 1222
70 Ga0070681_10401128 3300005458 Bacteria 1283
71 Ga0068867_100108991 3300005459 Bacteria 2125
72 Ga0068867_100145874 3300005459 Bacteria 1855
73 Ga0068867_100277494 3300005459 Bacteria 1373
74 Ga0068867_100685609 3300005459 Bacteria 903
75 Ga0068867_101163315 3300005459 Bacteria 707
76 Ga0070685_10014616 3300005466 Bacteria 4159
77 Ga0070706_101788985 3300005467 Unclassified 559
78 Ga0070707_101148269 3300005468 Unclassified 743
79 Ga0070698_100001166 3300005471 Bacteria 29161
80 Ga0070698_100012949 3300005471 Bacteria 8829
81 Ga0070698_100176969 3300005471 Unclassified 2072
82 Ga0070699_100945724 3300005518 Bacteria 790
83 Ga0070699_101262292 3300005518 Unclassified 678
84 Ga0070679_100000634 3300005530 Bacteria 29900
85 Ga0070679_100229614 3300005530 Bacteria 1815
86 Ga0068853_100091375 3300005539 Bacteria 2677
87 Ga0068853_101204757 3300005539 Bacteria 731
88 Ga0070672_100201013 3300005543 Bacteria 1666
89 Ga0070672_100201835 3300005543 Bacteria 1663
90 Ga0070672_100237408 3300005543 Bacteria 1532
91 Ga0070672_100446483 3300005543 Bacteria 1113
92 Ga0070672_100498965 3300005543 Bacteria 1053
93 Ga0070672_100535714 3300005543 Bacteria 1015
94 Ga0070672_100793530 3300005543 Bacteria 833
95 Ga0070672_101020449 3300005543 Bacteria 733
96 Ga0070686_100291336 3300005544 Bacteria 1207
97 Ga0070686_101103958 3300005544 Bacteria 655
98 Ga0070696_101795074 3300005546 Bacteria 530
99 Ga0068855_100746851 3300005563 Bacteria 1043
100 Ga0070664_100352707 3300005564 Bacteria 1339
101 Ga0068857_100058547 3300005577 Bacteria 3421
102 Ga0068857_100658788 3300005577 Unclassified 992
103 Ga0068857_100966414 3300005577 Unclassified 819
104 Ga0068854_100204835 3300005578 Bacteria 1553
105 Ga0068854_100243992 3300005578 Bacteria 1432
106 Ga0068854_100810070 3300005578 Bacteria 817
107 Ga0068852_100424133 3300005616 Bacteria 1312
108 Ga0068859_100258120 3300005617 Bacteria 1834
109 Ga0068859_100259043 3300005617 Bacteria 1830
110 Ga0068859_100531675 3300005617 Bacteria 1271
111 Ga0068859_100695570 3300005617 Bacteria 1107
112 Ga0068859_100987244 3300005617 Bacteria 924
113 Ga0068859_101513994 3300005617 Bacteria 740
114 Ga0068859_102106205 3300005617 Unclassified 623
115 Ga0068864_100006576 3300005618 Bacteria 9517
116 Ga0068864_100044734 3300005618 Unclassified 3796
117 Ga0068864_100080462 3300005618 Bacteria 2854
118 Ga0068864_100695593 3300005618 Bacteria 993
119 Ga0068866_10599323 3300005718 Bacteria 743
120 Ga0068851_10440617 3300005834 Bacteria 773
121 Ga0068851_10629763 3300005834 Bacteria 655
122 Ga0068870_10623271 3300005840 Unclassified 736
123 Ga0068870_10792279 3300005840 Bacteria 661
124 Ga0068870_11194211 3300005840 Unclassified 551
125 Ga0068863_100863251 3300005841 Bacteria 904
126 Ga0068858_100390259 3300005842 Bacteria 1337
127 Ga0068862_100888858 3300005844 Bacteria 875
128 Ga0070715_10132139 3300006163 Unclassified 1202
129 Ga0070715_10200428 3300006163 Bacteria 1014
130 Ga0097621_100020045 3300006237 Bacteria 5148
131 Ga0097621_101801878 3300006237 Bacteria 583
132 Ga0068871_100055105 3300006358 Bacteria 3227
133 Ga0068871_100153486 3300006358 Bacteria 1965
134 Ga0075428_100068415 3300006844 Unclassified 3884
135 Ga0075428_100289428 3300006844 Bacteria 1762
136 Ga0075428_100544759 3300006844 Bacteria 1240
137 Ga0075430_100758916 3300006846 Bacteria 799
138 Ga0075431_100003390 3300006847 Bacteria 15444
139 Ga0075431_100043907 3300006847 Bacteria 4610
140 Ga0075429_100018947 3300006880 Bacteria 5962
141 Ga0075429_100053329 3300006880 Bacteria 3519
142 Ga0075429_100160242 3300006880 Bacteria 1970
143 Ga0068865_100174705 3300006881 Bacteria 1650
144 Ga0068865_101290960 3300006881 Bacteria 649
145 Ga0097620_100258137 3300006931 Bacteria 1834
146 Ga0097620_100259019 3300006931 Bacteria 1830
147 Ga0097620_100531621 3300006931 Bacteria 1271
148 Ga0097620_100695568 3300006931 Bacteria 1107
149 Ga0097620_100987236 3300006931 Bacteria 924
150 Ga0097620_101514030 3300006931 Bacteria 740
151 Ga0097620_102106075 3300006931 Unclassified 623
152 Ga0105240_10242501 3300009093 Bacteria 2089
153 Ga0114129_10009265 3300009147 Bacteria 14039
154 Ga0114129_10364098 3300009147 Bacteria 1912
155 Ga0114129_10446390 3300009147 Bacteria 1697
156 Ga0105243_12159782 3300009148 Unclassified 593
157 Ga0105242_10007224 3300009176 Bacteria 8563
158 Ga0105242_10117352 3300009176 Bacteria 2278
159 Ga0105242_10416704 3300009176 Bacteria 1257
160 Ga0105249_10087513 3300009553 Unclassified 2907
161 Ga0105249_10128212 3300009553 Bacteria 2419
162 Ga0105249_11256702 3300009553 Bacteria 812
163 Ga0105249_11617349 3300009553 Unclassified 720
164 Ga0105249_11781605 3300009553 Unclassified 688
165 Ga0105239_10214987 3300010375 Unclassified 2155
166 Ga0105246_10094310 3300011119 Bacteria 2164
167 Ga0105246_10429458 3300011119 Bacteria 1105
168 Ga0157373_10072738 3300013100 Bacteria 2426
169 Ga0157373_10976003 3300013100 Bacteria 631
170 Ga0157371_10090232 3300013102 Bacteria 2171
171 Ga0157371_10097515 3300013102 Bacteria 2084
172 Ga0157371_10164354 3300013102 Bacteria 1585
173 Ga0157371_10174509 3300013102 Bacteria 1536
174 Ga0157370_10249144 3300013104 Unclassified 1643
175 Ga0157369_10160957 3300013105 Unclassified 2369
176 Ga0157374_10849724 3300013296 Bacteria 929
177 Ga0157378_10039913 3300013297 Bacteria 4163
178 Ga0157378_10120680 3300013297 Unclassified 2416
179 Ga0157378_10396279 3300013297 Bacteria 1359
180 Ga0157378_11224958 3300013297 Bacteria 790
181 Ga0163162_10000518 3300013306 Bacteria 35823
182 Ga0163162_10005852 3300013306 Bacteria 11895
183 Ga0163162_10031499 3300013306 Bacteria 5260
184 Ga0163162_10065751 3300013306 Bacteria 3674
185 Ga0163162_10361970 3300013306 Bacteria 1584
186 Ga0163162_11240039 3300013306 Bacteria 847
187 Ga0163162_11814776 3300013306 Unclassified 697
188 Ga0157372_10020929 3300013307 Bacteria 7060
189 Ga0157372_10117871 3300013307 Bacteria 3045
190 Ga0157372_10167403 3300013307 Unclassified 2542
191 Ga0157372_10371053 3300013307 Bacteria 1667
192 Ga0157372_10670489 3300013307 Bacteria 1207
193 Ga0157372_11030152 3300013307 Unclassified 953
194 Ga0157372_12986463 3300013307 Bacteria 541
195 Ga0157375_10082129 3300013308 Bacteria 3263
196 Ga0157375_10091557 3300013308 Bacteria 3103
197 Ga0157375_10500840 3300013308 Bacteria 1379
198 Ga0157375_10632130 3300013308 Bacteria 1228
199 Ga0157375_11556409 3300013308 Bacteria 781
200 Ga0163163_10099768 3300014325 Unclassified 2925
201 Ga0163163_10693741 3300014325 Bacteria 1082
202 Ga0163163_10959983 3300014325 Unclassified 918
203 Ga0157380_10120884 3300014326 Bacteria 2218
204 Ga0157380_10201083 3300014326 Bacteria 1768
205 Ga0157380_10268433 3300014326 Bacteria 1554
206 Ga0157380_11443507 3300014326 Bacteria 740
207 Ga0157377_10080218 3300014745 Bacteria 1906
208 Ga0157379_10214860 3300014968 Unclassified 1742
209 Ga0157379_10299495 3300014968 Unclassified 1465
210 Ga0157379_10609390 3300014968 Bacteria 1020
211 Ga0157376_10014159 3300014969 Bacteria 5975
212 Ga0157376_10059659 3300014969 Bacteria 3199
213 Ga0157376_10366825 3300014969 Bacteria 1383
214 Ga0163161_10015999 3300017792 Bacteria 5235
215 Ga0163161_10063204 3300017792 Bacteria 2698
216 Ga0163161_10125181 3300017792 Bacteria 1934
217 Ga0209646_1000883 3300025246 Bacteria 9927
218 Ga0207656_10432025 3300025321 Bacteria 664
219 Ga0207682_10005919 3300025893 Bacteria 4949
220 Ga0207642_10547707 3300025899 Bacteria 714
221 Ga0207688_10502506 3300025901 Bacteria 759
222 Ga0207680_10074208 3300025903 Bacteria 2117
223 Ga0207685_10045527 3300025905 Bacteria 1664
224 Ga0207685_10104325 3300025905 Bacteria 1218
225 Ga0207645_10028044 3300025907 Bacteria 3635
226 Ga0207645_10174857 3300025907 Bacteria 1408
227 Ga0207643_10031158 3300025908 Bacteria 2971
228 Ga0207643_10607535 3300025908 Unclassified 704
229 Ga0207705_10119881 3300025909 Bacteria 1951
230 Ga0207705_10130573 3300025909 Bacteria 1870
231 Ga0207695_10418987 3300025913 Bacteria 1223
232 Ga0207662_10224038 3300025918 Bacteria 1226
233 Ga0207662_10348485 3300025918 Bacteria 994
234 Ga0207657_10044524 3300025919 Unclassified 3901
235 Ga0207652_10011158 3300025921 Bacteria 7243
236 Ga0207652_10114087 3300025921 Bacteria 2399
237 Ga0207681_10783021 3300025923 Bacteria 796
238 Ga0207681_11346075 3300025923 Bacteria 599
239 Ga0207650_10035482 3300025925 Bacteria 3622
240 Ga0207650_10321515 3300025925 Bacteria 1267
241 Ga0207650_11069111 3300025925 Unclassified 687
242 Ga0207659_10044618 3300025926 Bacteria 3120
243 Ga0207659_10133944 3300025926 Bacteria 1916
244 Ga0207644_10153301 3300025931 Bacteria 1785
245 Ga0207644_10740981 3300025931 Bacteria 820
246 Ga0207690_10465543 3300025932 Unclassified 1018
247 Ga0207706_10064329 3300025933 Bacteria 3229
248 Ga0207686_10000202 3300025934 Bacteria 45854
249 Ga0207686_10033935 3300025934 Bacteria 3050
250 Ga0207686_11088549 3300025934 Bacteria 651
251 Ga0207670_10126188 3300025936 Bacteria 1868
252 Ga0207669_10838127 3300025937 Bacteria 765
253 Ga0207704_10250678 3300025938 Bacteria 1329
254 Ga0207665_10931200 3300025939 Bacteria 690
255 Ga0207691_10027842 3300025940 Bacteria 5296
256 Ga0207691_10096466 3300025940 Bacteria 2643
257 Ga0207691_10254678 3300025940 Bacteria 1514
258 Ga0207691_10265570 3300025940 Bacteria 1479
259 Ga0207689_10021762 3300025942 Bacteria 5391
260 Ga0207689_10059587 3300025942 Bacteria 3140
261 Ga0207689_10105494 3300025942 Bacteria 2315
262 Ga0207689_10114988 3300025942 Bacteria 2211
263 Ga0207667_10666689 3300025949 Bacteria 1045
264 Ga0207651_10070237 3300025960 Bacteria 2477
265 Ga0207651_10151744 3300025960 Bacteria 1804
266 Ga0207651_10882667 3300025960 Bacteria 796
267 Ga0207651_11821577 3300025960 Bacteria 548
268 Ga0207712_10025047 3300025961 Bacteria 3960
269 Ga0207712_10040592 3300025961 Bacteria 3195
270 Ga0207712_10060786 3300025961 Bacteria 2679
271 Ga0207712_10146035 3300025961 Unclassified 1821
272 Ga0207668_10321429 3300025972 Bacteria 1284
273 Ga0207668_10684385 3300025972 Bacteria 900
274 Ga0207640_10921623 3300025981 Bacteria 764
275 Ga0207658_10124832 3300025986 Unclassified 2058
276 Ga0207658_10194212 3300025986 Bacteria 1690
277 Ga0207658_10380708 3300025986 Bacteria 1236
278 Ga0207677_10244298 3300026023 Bacteria 1454
279 Ga0207677_10692126 3300026023 Bacteria 904
280 Ga0207677_10809761 3300026023 Bacteria 839
281 Ga0207677_12294349 3300026023 Bacteria 502
282 Ga0207703_10742694 3300026035 Bacteria 935
283 Ga0207703_11905998 3300026035 Bacteria 570
284 Ga0207639_10092376 3300026041 Bacteria 2425
285 Ga0207639_10395737 3300026041 Bacteria 1244
286 Ga0207639_10596251 3300026041 Bacteria 1018
287 Ga0207678_10419148 3300026067 Bacteria 1161
288 Ga0207678_11358575 3300026067 Bacteria 628
289 Ga0207708_10794629 3300026075 Bacteria 814
290 Ga0207641_10000377 3300026088 Bacteria 53065
291 Ga0207641_10036115 3300026088 Bacteria 4123
292 Ga0207641_10645244 3300026088 Bacteria 1039
293 Ga0207648_10024271 3300026089 Bacteria 5415
294 Ga0207648_10747186 3300026089 Bacteria 908
295 Ga0207648_11122082 3300026089 Bacteria 738
296 Ga0207676_10020222 3300026095 Bacteria 4867
297 Ga0207676_10056036 3300026095 Bacteria 3097
298 Ga0207676_10177381 3300026095 Unclassified 1862
299 Ga0207676_10490708 3300026095 Bacteria 1165
300 Ga0207676_11117947 3300026095 Unclassified 779
301 Ga0207676_11775123 3300026095 Bacteria 615
302 Ga0207674_10091568 3300026116 Bacteria 3030
303 Ga0207674_10250603 3300026116 Bacteria 1718
304 Ga0207675_100128808 3300026118 Bacteria 2399
305 Ga0207675_100198239 3300026118 Bacteria 1928
306 Ga0207683_10331075 3300026121 Unclassified 1396
307 Ga0207683_10408640 3300026121 Bacteria 1249
308 Ga0207698_10004744 3300026142 Bacteria 8313
309 Ga0207698_10270836 3300026142 Bacteria 1565
310 Ga0207698_10807661 3300026142 Bacteria 940
311 Ga0209969_1040610 3300027360 Bacteria 722
312 Ga0209968_1013117 3300027526 Bacteria 1297
313 Ga0209966_1076048 3300027695 Unclassified 740
314 Ga0268265_10113314 3300028380 Unclassified 2219
315 Ga0268265_10287411 3300028380 Bacteria 1474
316 Ga0268264_10694068 3300028381 Bacteria 1010
317 Ga0268264_11267577 3300028381 Bacteria 747
318 Ga0265327_10007629 3300031251 Bacteria 8292
319 Ga0307412_10220636 3300031911 Bacteria 1453
320 Ga0307414_10278766 3300032004 Bacteria 1404
321 Ga0307414_10351173 3300032004 Bacteria 1266
322 Ga0373944_0057499 3300035089 Bacteria 1240
323 Ga0373953_0161974 3300035117 Bacteria 962
324 Ga0373943_0209582 3300035170 Unclassified 1082
325 Ga0373935_0684623 3300035692 Bacteria 754
326 Ga0373927_0977772 3300035695 Unclassified 558
327 Ga0373933_0863377 3300035724 Bacteria 596
328 Ga0373947_0376895 3300035725 Unclassified 955
329 Ga0373937_0173046 3300036401 Bacteria 2026
330 Ga0373937_1033399 3300036401 Unclassified 770
331 Ga0373925_0129031 3300037068 Bacteria 1970
332 Ga0436365_0701356 3300039437 Unclassified 591
333 Ga0451800_0151987 3300041459 Bacteria 602
334 Ga0451802_1926220 3300041460 Bacteria 602
335 Ga0451804_0861802 3300041463 Bacteria 698
336 Ga0451807_1129680 3300041486 Bacteria 1583
337 Ga0451807_1445937 3300041486 Bacteria 887
338 Ga0451851_0980360 3300041507 Unclassified 548
339 Ga0451853_0084697 3300041512 Bacteria 1002
340 Ga0451853_3443351 3300041512 Bacteria 938
341 Ga0439431_0044632 3300041997 Bacteria 1137
342 Ga0439433_0051575 3300041999 Bacteria 971
343 Ga0439443_071380 3300042003 Bacteria 634
344 Ga0439449_0074680 3300042007 Bacteria 1249
345 Ga0439462_0012870 3300042015 Bacteria 2141
346 Ga0450923_002237 3300042125 Bacteria 2741
347 Ga0439446_0096478 3300042156 Bacteria 931
348 Ga0439435_0088537 3300042436 Unclassified 938
349 Ga0439460_0129847 3300042461 Bacteria 830
350 Ga0495585_0613081 3300046492 Bacteria 511
351 Ga0495594_0097427 3300046499 Unclassified 1653
352 Ga0495608_0069809 3300046511 Unclassified 2294
353 Ga0495608_0684069 3300046511 Bacteria 611
354 Ga0495598_0210968 3300046537 Unclassified 705
355 Ga0495621_0318846 3300046539 Bacteria 647
356 Ga0495667_0182152 3300046559 Unclassified 1348
357 Ga0495656_0457856 3300046615 Bacteria 673
358 Ga0495668_0000774 3300046616 Bacteria 37260
359 Ga0495635_0649809 3300046663 Unclassified 686
360 Ga0495657_0522795 3300046675 Unclassified 691
361 Ga0495670_0216389 3300046691 Bacteria 1017
362 Ga0495649_0393903 3300046694 Unclassified 696
363 Ga0495581_0718719 3300047315 Unclassified 576
364 Ga0495672_0025053 3300047320 Bacteria 3828
365 Ga0495680_0919417 3300047322 Unclassified 564
366 Ga0495675_0202484 3300047444 Bacteria 1208
367 Ga0495684_0140782 3300047471 Unclassified 1809
368 Ga0496112_0769216 3300048915 Bacteria 889
369 Ga0496126_0914299 3300048929 Bacteria 664
370 Ga0501044_0144238 3300049823 Bacteria 2368
371 nmdc:mga0k408_700655_c1 3300050493 Bacteria 593
372 nmdc:mga05p37_18106_c1 3300050507 Bacteria 8509
373 nmdc:mga05p37_602369_c1 3300050507 Unclassified 1240
374 nmdc:mga09592_12677_c1 3300050508 Bacteria 6872
375 nmdc:mga09592_307238_c1 3300050508 Bacteria 1375
376 nmdc:mga09592_560654_c1 3300050508 Bacteria 981
377 nmdc:mga0qj67_1383141_c1 3300050509 Bacteria 544
378 nmdc:mga06r32_332505_c1 3300050510 Bacteria 1504
379 nmdc:mga06r32_4775_c1 3300050510 Bacteria 12192
380 nmdc:mga08y16_1886233_c1 3300050511 Bacteria 549
381 Ga0495619_0546287 3300053085 Bacteria 795
382 Ga0500650_0101334 3300053098 Bacteria 1347
383 Ga0500646_0002649
384 SwRhRL2b_contig_3747236
385 rootH1_10055709
386 rootL2_10151316
387 Ga0065704_10188741
388 Ga0065712_10021502
389 Ga0065712_10029017
390 Ga0065712_10462298
391 Ga0065707_10396757
392 Ga0065707_10418818
393 Ga0070658_10345120
394 Ga0070676_10046343
395 Ga0070683_101015832
396 Ga0070690_100027625
397 Ga0070690_100693118
398 Ga0070670_100167182
399 Ga0070670_100174825
400 Ga0070670_100886603
401 Ga0070670_101166215
402 Ga0068869_100047469
403 Ga0068869_100089666
404 Ga0068869_100496943
405 Ga0068869_100497069
406 Ga0068869_101231236
407 Ga0070666_10051177
408 Ga0070666_10465696
409 Ga0070680_100122935
410 Ga0070680_101345812
411 Ga0070682_100000044
412 Ga0070682_100065804
413 Ga0070682_100595443
414 Ga0068868_100109096
415 Ga0068868_100343390
416 Ga0068868_100694236
417 Ga0068868_102060185
418 Ga0070660_100111324
419 Ga0070689_100822020
420 Ga0070687_100090302
421 Ga0070687_101024559
422 Ga0070692_10935575
423 Ga0070668_100110726
424 Ga0070668_100255019
425 Ga0070668_100340053
426 Ga0070669_100094318
427 Ga0070669_100206041
428 Ga0070669_100364018
429 Ga0070675_100028844
430 Ga0070675_100290909
431 Ga0070675_100755371
432 Ga0070671_100113583
433 Ga0070671_100421305
434 Ga0070674_100659422
435 Ga0070674_100933304
436 Ga0070674_101247495
437 Ga0070673_100309336
438 Ga0070673_101055432
439 Ga0070688_100346159
440 Ga0070688_100652517
441 Ga0070688_100995822
442 Ga0070659_100568234
443 Ga0070659_100689035
444 Ga0070667_100501590
445 Ga0070667_100511341
446 Ga0070667_101118508
447 Ga0070663_100632570
448 Ga0070678_100115771
449 Ga0070678_100147110
450 Ga0070678_100533389
451 Ga0070662_100342987
452 Ga0070681_10401128
453 Ga0068867_100108991
454 Ga0068867_100145874
455 Ga0068867_100277494
456 Ga0068867_100685609
457 Ga0068867_101163315
458 Ga0070685_10014616
459 Ga0070706_101788985
460 Ga0070707_101148269
461 Ga0070698_100001166
462 Ga0070698_100012949
463 Ga0070698_100176969
464 Ga0070699_100945724
465 Ga0070699_101262292
466 Ga0070679_100000634
467 Ga0070679_100229614
468 Ga0068853_100091375
469 Ga0068853_101204757
470 Ga0070672_100201013
471 Ga0070672_100201835
472 Ga0070672_100237408
473 Ga0070672_100446483
474 Ga0070672_100498965
475 Ga0070672_100535714
476 Ga0070672_100793530
477 Ga0070672_101020449
478 Ga0070686_100291336
479 Ga0070686_101103958
480 Ga0070696_101795074
481 Ga0068855_100746851
482 Ga0070664_100352707
483 Ga0068857_100058547
484 Ga0068857_100658788
485 Ga0068857_100966414
486 Ga0068854_100204835
487 Ga0068854_100243992
488 Ga0068854_100810070
489 Ga0068852_100424133
490 Ga0068859_100258120
491 Ga0068859_100259043
492 Ga0068859_100531675
493 Ga0068859_100695570
494 Ga0068859_100987244
495 Ga0068859_101513994
496 Ga0068859_102106205
497 Ga0068864_100006576
498 Ga0068864_100044734
499 Ga0068864_100080462
500 Ga0068864_100695593
501 Ga0068866_10599323
502 Ga0068851_10440617
503 Ga0068851_10629763
504 Ga0068870_10623271
505 Ga0068870_10792279
506 Ga0068870_11194211
507 Ga0068863_100863251
508 Ga0068858_100390259
509 Ga0068862_100888858
510 Ga0070715_10132139
511 Ga0070715_10200428
512 Ga0097621_100020045
513 Ga0097621_101801878
514 Ga0068871_100055105
515 Ga0068871_100153486
516 Ga0075428_100068415
517 Ga0075428_100289428
518 Ga0075428_100544759
519 Ga0075430_100758916
520 Ga0075431_100003390
521 Ga0075431_100043907
522 Ga0075429_100018947
523 Ga0075429_100053329
524 Ga0075429_100160242
525 Ga0068865_100174705
526 Ga0068865_101290960
527 Ga0097620_100258137
528 Ga0097620_100259019
529 Ga0097620_100531621
530 Ga0097620_100695568
531 Ga0097620_100987236
532 Ga0097620_101514030
533 Ga0097620_102106075
534 Ga0105240_10242501
535 Ga0114129_10009265
536 Ga0114129_10364098
537 Ga0114129_10446390
538 Ga0105243_12159782
539 Ga0105242_10007224
540 Ga0105242_10117352
541 Ga0105242_10416704
542 Ga0105249_10087513
543 Ga0105249_10128212
544 Ga0105249_11256702
545 Ga0105249_11617349
546 Ga0105249_11781605
547 Ga0105239_10214987
548 Ga0105246_10094310
549 Ga0105246_10429458
550 Ga0157373_10072738
551 Ga0157373_10976003
552 Ga0157371_10090232
553 Ga0157371_10097515
554 Ga0157371_10164354
555 Ga0157371_10174509
556 Ga0157370_10249144
557 Ga0157369_10160957
558 Ga0157374_10849724
559 Ga0157378_10039913
560 Ga0157378_10120680
561 Ga0157378_10396279
562 Ga0157378_11224958
563 Ga0163162_10000518
564 Ga0163162_10005852
565 Ga0163162_10031499
566 Ga0163162_10065751
567 Ga0163162_10361970
568 Ga0163162_11240039
569 Ga0163162_11814776
570 Ga0157372_10020929
571 Ga0157372_10117871
572 Ga0157372_10167403
573 Ga0157372_10371053
574 Ga0157372_10670489
575 Ga0157372_11030152
576 Ga0157372_12986463
577 Ga0157375_10082129
578 Ga0157375_10091557
579 Ga0157375_10500840
580 Ga0157375_10632130
581 Ga0157375_11556409
582 Ga0163163_10099768
583 Ga0163163_10693741
584 Ga0163163_10959983
585 Ga0157380_10120884
586 Ga0157380_10201083
587 Ga0157380_10268433
588 Ga0157380_11443507
589 Ga0157377_10080218
590 Ga0157379_10214860
591 Ga0157379_10299495
592 Ga0157379_10609390
593 Ga0157376_10014159
594 Ga0157376_10059659
595 Ga0157376_10366825
596 Ga0163161_10015999
597 Ga0163161_10063204
598 Ga0163161_10125181
599 Ga0209646_1000883
600 Ga0207656_10432025
601 Ga0207682_10005919
602 Ga0207642_10547707
603 Ga0207688_10502506
604 Ga0207680_10074208
605 Ga0207685_10045527
606 Ga0207685_10104325
607 Ga0207645_10028044
608 Ga0207645_10174857
609 Ga0207643_10031158
610 Ga0207643_10607535
611 Ga0207705_10119881
612 Ga0207705_10130573
613 Ga0207695_10418987
614 Ga0207662_10224038
615 Ga0207662_10348485
616 Ga0207657_10044524
617 Ga0207652_10011158
618 Ga0207652_10114087
619 Ga0207681_10783021
620 Ga0207681_11346075
621 Ga0207650_10035482
622 Ga0207650_10321515
623 Ga0207650_11069111
624 Ga0207659_10044618
625 Ga0207659_10133944
626 Ga0207644_10153301
627 Ga0207644_10740981
628 Ga0207690_10465543
629 Ga0207706_10064329
630 Ga0207686_10000202
631 Ga0207686_10033935
632 Ga0207686_11088549
633 Ga0207670_10126188
634 Ga0207669_10838127
635 Ga0207704_10250678
636 Ga0207665_10931200
637 Ga0207691_10027842
638 Ga0207691_10096466
639 Ga0207691_10254678
640 Ga0207691_10265570
641 Ga0207689_10021762
642 Ga0207689_10059587
643 Ga0207689_10105494
644 Ga0207689_10114988
645 Ga0207667_10666689
646 Ga0207651_10070237
647 Ga0207651_10151744
648 Ga0207651_10882667
649 Ga0207651_11821577
650 Ga0207712_10025047
651 Ga0207712_10040592
652 Ga0207712_10060786
653 Ga0207712_10146035
654 Ga0207668_10321429
655 Ga0207668_10684385
656 Ga0207640_10921623
657 Ga0207658_10124832
658 Ga0207658_10194212
659 Ga0207658_10380708
660 Ga0207677_10244298
661 Ga0207677_10692126
662 Ga0207677_10809761
663 Ga0207677_12294349
664 Ga0207703_10742694
665 Ga0207703_11905998
666 Ga0207639_10092376
667 Ga0207639_10395737
668 Ga0207639_10596251
669 Ga0207678_10419148
670 Ga0207678_11358575
671 Ga0207708_10794629
672 Ga0207641_10000377
673 Ga0207641_10036115
674 Ga0207641_10645244
675 Ga0207648_10024271
676 Ga0207648_10747186
677 Ga0207648_11122082
678 Ga0207676_10020222
679 Ga0207676_10056036
680 Ga0207676_10177381
681 Ga0207676_10490708
682 Ga0207676_11117947
683 Ga0207676_11775123
684 Ga0207674_10091568
685 Ga0207674_10250603
686 Ga0207675_100128808
687 Ga0207675_100198239
688 Ga0207683_10331075
689 Ga0207683_10408640
690 Ga0207698_10004744
691 Ga0207698_10270836
692 Ga0207698_10807661
693 Ga0209969_1040610
694 Ga0209968_1013117
695 Ga0209966_1076048
696 Ga0268265_10113314
697 Ga0268265_10287411
698 Ga0268264_10694068
699 Ga0268264_11267577
700 Ga0265327_10007629
701 Ga0307412_10220636
702 Ga0307414_10278766
703 Ga0307414_10351173
704 Ga0373944_0057499
705 Ga0373953_0161974
706 Ga0373943_0209582
707 Ga0373935_0684623
708 Ga0373927_0977772
709 Ga0373933_0863377
710 Ga0373947_0376895
711 Ga0373937_0173046
712 Ga0373937_1033399
713 Ga0373925_0129031
714 Ga0436365_0701356
715 Ga0451800_0151987
716 Ga0451802_1926220
717 Ga0451804_0861802
718 Ga0451807_1129680
719 Ga0451807_1445937
720 Ga0451851_0980360
721 Ga0451853_0084697
722 Ga0451853_3443351
723 Ga0439431_0044632
724 Ga0439433_0051575
725 Ga0439443_071380
726 Ga0439449_0074680
727 Ga0439462_0012870
728 Ga0450923_002237
729 Ga0439446_0096478
730 Ga0439435_0088537
731 Ga0439460_0129847
732 Ga0495585_0613081
733 Ga0495594_0097427
734 Ga0495608_0069809
735 Ga0495608_0684069
736 Ga0495598_0210968
737 Ga0495621_0318846
738 Ga0495667_0182152
739 Ga0495656_0457856
740 Ga0495668_0000774
741 Ga0495635_0649809
742 Ga0495657_0522795
743 Ga0495670_0216389
744 Ga0495649_0393903
745 Ga0495581_0718719
746 Ga0495672_0025053
747 Ga0495680_0919417
748 Ga0495675_0202484
749 Ga0495684_0140782
750 Ga0496112_0769216
751 Ga0496126_0914299
752 Ga0501044_0144238
753 nmdc:mga0k408_700655_c1
754 nmdc:mga05p37_18106_c1
755 nmdc:mga05p37_602369_c1
756 nmdc:mga09592_12677_c1
757 nmdc:mga09592_307238_c1
758 nmdc:mga09592_560654_c1
759 nmdc:mga0qj67_1383141_c1
760 nmdc:mga06r32_332505_c1
761 nmdc:mga06r32_4775_c1
762 nmdc:mga08y16_1886233_c1
763 Ga0495619_0546287
764 Ga0500650_0101334

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00436

SSB

Single-strand binding protein family

30

131

0.94

Structural Annotation

Top 5 Hits

ID Description Score Start End
3udg-assembly2.cif.gz_B structure of deinococcus radiodurans ssb bound to ssdna 0.8467 1 103
4dam-assembly1.cif.gz_C crystal structure of small single-stranded dna-binding protein from streptomyces coelicolor 0.8304 2 101
1txy-assembly1.cif.gz_A e. coli prib 0.8234 3 102
7f5y-assembly1.cif.gz_A-2 crystal structure of the single-stranded dna-binding protein from mycobacterium tuberculosis- form iii 0.8184 3 102
1se8-assembly1.cif.gz_A-2 structure of single-stranded dna-binding protein (ssb) from d. radiodurans 0.8131 1 103
ID Description Score Start End Superfamily
3udgB02 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8467 1 103 2.40.50.140
2fxqA01 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.813 1 105 2.40.50.140
af_P34496_51_170_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8074 3 110 2.40.50.140
af_Q4E154_11_127_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8044 2 103 2.40.50.140
af_K7M5J7_70_166_2.40.50.140 Mainly Beta;Beta Barrel;OB fold (Dihydrolipoamide Acetyltransferase, E2P);Nucleic acid-binding proteins 0.8043 2 100 2.40.50.140
ID Description Score Start End GO Terms
AF-A0A3C1R5N8-F1-model_v4 deleted 0.9456 1 100
AF-A0A6A2GJZ1-F1-model_v4 deleted 0.9279 1 102
AF-A0A6A2GJZ1-F1-model_v4 deleted 0.9192 1 102
AF-A0A2W7MZ39-F1-model_v4 Single-stranded DNA-binding protein 0.9156 1 103 GO:0003697
GO:0006260
AF-A0A3C1R5N8-F1-model_v4 deleted 0.9108 1 100

Map