F429317

General Info

Members Datasets Scaffolds Average Seq Length
382 204 764 159

Family's Representative Sequence

Representative Sequence 3300032002|Ga0307416_101779362|Ga0307416_1017793622
Length 161
Sequence MAIHVVLVHPEIHWNTGNAGRTCLAAGATLHLVEPLGFSLDERQVRRAGLDYWEHVDVRVWPDWDAFERELPGLGETFFFSTKATRPFWDAPVASSNIVLVFGRETGGLPAEIHQRYRDRFVGIPMVSPLVRSLNLSTSVAVAVYEVLRQRRQHQVSSTSQ

Samples

Sample ID Description Type Environment
1 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
9 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
22 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
23 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
24 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
25 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
26 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
30 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
35 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
36 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
37 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
38 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
39 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
40 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
43 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
44 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
45 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
48 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
49 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
50 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
53 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
54 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
55 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
56 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
59 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
60 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
73 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
74 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
75 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
78 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
79 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
80 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
81 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
82 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
83 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
84 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
85 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
86 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
87 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
88 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
89 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
137 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
143 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
144 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
145 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
146 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
147 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
148 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
149 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
150 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
151 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
152 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
153 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
154 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
155 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
156 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
157 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
158 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
161 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
162 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
163 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
164 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
165 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
166 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
167 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
168 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
169 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
170 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
171 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
175 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
180 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
181 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
182 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
183 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
184 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
185 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
186 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
187 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
188 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
189 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
190 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
191 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
192 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
193 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
194 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
195 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
196 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
197 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
198 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
199 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
200 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
201 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
202 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
203 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
204 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.66
Nodule 0
Rhizoplane 2.36
Rhizosphere 92.15
Stem 0
Stem Tuber 0
Unclassified 21.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307416_101779362 3300032002 Unclassified 720
2 JGI25406J46586_10060374 3300003203 Bacteria 1227
3 Ga0065712_10070920 3300005290 Bacteria 5602
4 Ga0070658_11064173 3300005327 Bacteria 704
5 Ga0070683_100043069 3300005329 Bacteria 4159
6 Ga0070683_100072895 3300005329 Bacteria 3206
7 Ga0070683_100605602 3300005329 Unclassified 1048
8 Ga0070670_100140840 3300005331 Bacteria 2085
9 Ga0070670_100888895 3300005331 Bacteria 807
10 Ga0070677_10033914 3300005333 Archaea 1969
11 Ga0070677_10067542 3300005333 Bacteria 1494
12 Ga0070677_10357574 3300005333 Unclassified 758
13 Ga0068869_100073122 3300005334 Bacteria 2542
14 Ga0070666_10335275 3300005335 Bacteria 1081
15 Ga0070680_100045598 3300005336 Unclassified 3565
16 Ga0070680_100052759 3300005336 Bacteria 3318
17 Ga0070680_100109573 3300005336 Unclassified 2298
18 Ga0070680_100297336 3300005336 Unclassified 1369
19 Ga0070682_100062219 3300005337 Unclassified 2364
20 Ga0068868_100491013 3300005338 Unclassified 1074
21 Ga0070660_100069587 3300005339 Bacteria 2745
22 Ga0070660_100073697 3300005339 Bacteria 2670
23 Ga0070689_100835292 3300005340 Bacteria 812
24 Ga0070691_10006761 3300005341 Bacteria 5248
25 Ga0070687_100045765 3300005343 Bacteria 2236
26 Ga0070661_100106688 3300005344 Bacteria 2089
27 Ga0070692_10046941 3300005345 Bacteria 2234
28 Ga0070669_100020916 3300005353 Bacteria 4674
29 Ga0070669_100170982 3300005353 Bacteria 1694
30 Ga0070675_100018633 3300005354 Bacteria 5526
31 Ga0070675_100136229 3300005354 Bacteria 2096
32 Ga0070674_100016422 3300005356 Bacteria 4639
33 Ga0070674_100563391 3300005356 Unclassified 958
34 Ga0070688_100013496 3300005365 Bacteria 4608
35 Ga0070688_100188222 3300005365 Bacteria 1436
36 Ga0070659_100034974 3300005366 Bacteria 3910
37 Ga0070659_100114575 3300005366 Bacteria 2178
38 Ga0070667_100135277 3300005367 Bacteria 2155
39 Ga0070714_100051829 3300005435 Bacteria 3500
40 Ga0070714_100080600 3300005435 Bacteria 2833
41 Ga0070714_100133954 3300005435 Bacteria 2216
42 Ga0070713_100001290 3300005436 Bacteria 16015
43 Ga0070713_100052488 3300005436 Unclassified 3376
44 Ga0070713_100161899 3300005436 Bacteria 1998
45 Ga0070711_100260206 3300005439 Bacteria 1365
46 Ga0070705_100062761 3300005440 Bacteria 2214
47 Ga0070700_100680943 3300005441 Bacteria 815
48 Ga0070694_100129444 3300005444 Bacteria 1822
49 Ga0070694_100813693 3300005444 Unclassified 767
50 Ga0070678_100058505 3300005456 Unclassified 2829
51 Ga0070678_100171614 3300005456 Archaea 1767
52 Ga0070678_100320116 3300005456 Bacteria 1324
53 Ga0070681_10001030 3300005458 Bacteria 23631
54 Ga0070681_10008234 3300005458 Bacteria 10202
55 Ga0070681_10129589 3300005458 Bacteria 2455
56 Ga0070681_10257685 3300005458 Bacteria 1656
57 Ga0070681_10832820 3300005458 Unclassified 840
58 Ga0068867_100215816 3300005459 Bacteria 1543
59 Ga0070685_10132078 3300005466 Bacteria 1562
60 Ga0070706_100156109 3300005467 Bacteria 2130
61 Ga0070707_100687055 3300005468 Bacteria 986
62 Ga0070698_100142904 3300005471 Bacteria 2344
63 Ga0070698_100329134 3300005471 Bacteria 1459
64 Ga0070698_100993344 3300005471 Bacteria 786
65 Ga0070699_100237103 3300005518 Bacteria 1627
66 Ga0070699_100330917 3300005518 Bacteria 1370
67 Ga0070679_100030816 3300005530 Bacteria 5298
68 Ga0070679_100051335 3300005530 Bacteria 4108
69 Ga0070679_100127415 3300005530 Bacteria 2527
70 Ga0070679_100153364 3300005530 Unclassified 2280
71 Ga0070679_100829026 3300005530 Bacteria 868
72 Ga0070684_100005545 3300005535 Bacteria 9684
73 Ga0070684_100034564 3300005535 Bacteria 4322
74 Ga0070684_100041986 3300005535 Bacteria 3946
75 Ga0070684_100096427 3300005535 Bacteria 2636
76 Ga0070684_100098200 3300005535 Unclassified 2612
77 Ga0070684_100271425 3300005535 Bacteria 1553
78 Ga0070684_100349703 3300005535 Bacteria 1359
79 Ga0070684_100855058 3300005535 Bacteria 851
80 Ga0070672_100232846 3300005543 Bacteria 1548
81 Ga0070696_100307606 3300005546 Bacteria 1216
82 Ga0070693_100000769 3300005547 Bacteria 14152
83 Ga0070693_100295663 3300005547 Unclassified 1090
84 Ga0070665_100109002 3300005548 Bacteria 2771
85 Ga0070665_100544214 3300005548 Bacteria 1173
86 Ga0070664_100030749 3300005564 Bacteria 4482
87 Ga0070664_100039876 3300005564 Unclassified 3959
88 Ga0070664_100051167 3300005564 Bacteria 3497
89 Ga0070664_100059726 3300005564 Bacteria 3245
90 Ga0070664_100159732 3300005564 Unclassified 1993
91 Ga0070664_100716570 3300005564 Bacteria 933
92 Ga0068857_100002799 3300005577 Bacteria 14342
93 Ga0068857_100161411 3300005577 Bacteria 2034
94 Ga0068857_100168757 3300005577 Bacteria 1988
95 Ga0068857_100992051 3300005577 Bacteria 808
96 Ga0068857_101348844 3300005577 Bacteria 693
97 Ga0068854_100035546 3300005578 Bacteria 3487
98 Ga0068854_100124073 3300005578 Unclassified 1964
99 Ga0068854_100242362 3300005578 Bacteria 1436
100 Ga0068856_101428911 3300005614 Unclassified 706
101 Ga0070702_100091060 3300005615 Bacteria 1849
102 Ga0068852_100138209 3300005616 Bacteria 2252
103 Ga0068852_100459697 3300005616 Bacteria 1262
104 Ga0068852_101470023 3300005616 Bacteria 704
105 Ga0068864_100007697 3300005618 Bacteria 8871
106 Ga0068864_100170189 3300005618 Bacteria 1986
107 Ga0068864_100334891 3300005618 Bacteria 1425
108 Ga0068864_100538011 3300005618 Bacteria 1128
109 Ga0068851_10094585 3300005834 Bacteria 1578
110 Ga0068862_100388179 3300005844 Bacteria 1304
111 Ga0081455_10354177 3300005937 Unclassified 1034
112 Ga0081539_10029734 3300005985 Bacteria 3406
113 Ga0075368_10104208 3300006042 Bacteria 1167
114 Ga0075364_10126754 3300006051 Bacteria 1712
115 Ga0075364_10149599 3300006051 Bacteria 1573
116 Ga0070712_100016111 3300006175 Unclassified 4824
117 Ga0075362_10037581 3300006177 Bacteria 2123
118 Ga0075366_10051829 3300006195 Bacteria 2438
119 Ga0097621_100117113 3300006237 Unclassified 2257
120 Ga0075370_10021187 3300006353 Bacteria 3561
121 Ga0068871_100562041 3300006358 Unclassified 1034
122 Ga0068871_100606197 3300006358 Unclassified 996
123 Ga0075428_100630510 3300006844 Bacteria 1144
124 Ga0075428_100887784 3300006844 Unclassified 946
125 Ga0075430_100002246 3300006846 Bacteria 16013
126 Ga0075430_100015742 3300006846 Bacteria 6442
127 Ga0075430_100076181 3300006846 Bacteria 2811
128 Ga0075431_100002181 3300006847 Bacteria 18713
129 Ga0075431_100020131 3300006847 Bacteria 6814
130 Ga0075431_100070550 3300006847 Bacteria 3605
131 Ga0075434_100068747 3300006871 Bacteria 3530
132 Ga0075429_100049398 3300006880 Bacteria 3658
133 Ga0075429_100093464 3300006880 Unclassified 2623
134 Ga0075429_100105367 3300006880 Unclassified 2463
135 Ga0068865_100239773 3300006881 Bacteria 1426
136 Ga0068865_100275597 3300006881 Unclassified 1337
137 Ga0068865_100673514 3300006881 Bacteria 881
138 Ga0111539_10008537 3300009094 Bacteria 13015
139 Ga0111539_10056307 3300009094 Bacteria 4673
140 Ga0111539_10059487 3300009094 Bacteria 4531
141 Ga0111539_10502516 3300009094 Bacteria 1412
142 Ga0111539_11357781 3300009094 Unclassified 825
143 Ga0114129_10116629 3300009147 Bacteria 3679
144 Ga0114129_12176531 3300009147 Bacteria 668
145 Ga0105243_10886924 3300009148 Bacteria 886
146 Ga0105243_11017122 3300009148 Unclassified 832
147 Ga0105241_10321138 3300009174 Unclassified 1335
148 Ga0105241_11331663 3300009174 Unclassified 685
149 Ga0105237_10107428 3300009545 Bacteria 2783
150 Ga0105238_10080996 3300009551 Unclassified 3235
151 Ga0105238_10884863 3300009551 Bacteria 911
152 Ga0105238_10980327 3300009551 Bacteria 866
153 Ga0105238_11954326 3300009551 Bacteria 620
154 Ga0105238_12096572 3300009551 Bacteria 600
155 Ga0105239_10738678 3300010375 Bacteria 1126
156 Ga0105239_11417244 3300010375 Unclassified 802
157 Ga0157373_10262486 3300013100 Bacteria 1222
158 Ga0157370_10021836 3300013104 Bacteria 6376
159 Ga0157370_10143084 3300013104 Bacteria 2228
160 Ga0157369_10322519 3300013105 Bacteria 1606
161 Ga0163162_10006179 3300013306 Bacteria 11605
162 Ga0163162_10595840 3300013306 Bacteria 1232
163 Ga0163162_12472148 3300013306 Bacteria 597
164 Ga0157372_10093378 3300013307 Bacteria 3424
165 Ga0157372_10138358 3300013307 Bacteria 2805
166 Ga0157372_11131601 3300013307 Bacteria 905
167 Ga0157375_10920007 3300013308 Bacteria 1018
168 Ga0163163_10875197 3300014325 Bacteria 962
169 Ga0157380_10002812 3300014326 Bacteria 11831
170 Ga0157380_10005572 3300014326 Bacteria 8797
171 Ga0157380_10209136 3300014326 Bacteria 1737
172 Ga0157380_10436810 3300014326 Bacteria 1253
173 Ga0157380_10513655 3300014326 Bacteria 1167
174 Ga0157380_10607820 3300014326 Bacteria 1083
175 Ga0157377_10204005 3300014745 Bacteria 1257
176 Ga0182005_1047278 3300015265 Unclassified 1169
177 Ga0206354_11084306 3300020081 Unclassified 1069
178 Ga0213876_10409427 3300021384 Unclassified 721
179 Ga0207656_10063839 3300025321 Bacteria 1622
180 Ga0207656_10160758 3300025321 Bacteria 1069
181 Ga0207682_10017869 3300025893 Unclassified 2768
182 Ga0207682_10019443 3300025893 Bacteria 2659
183 Ga0207688_10113518 3300025901 Bacteria 1575
184 Ga0207680_10116748 3300025903 Bacteria 1740
185 Ga0207680_10190430 3300025903 Bacteria 1392
186 Ga0207645_10026967 3300025907 Bacteria 3712
187 Ga0207645_10170037 3300025907 Bacteria 1428
188 Ga0207705_10050081 3300025909 Bacteria 3006
189 Ga0207654_10599939 3300025911 Bacteria 786
190 Ga0207654_10661465 3300025911 Unclassified 749
191 Ga0207707_10013910 3300025912 Bacteria 7016
192 Ga0207707_10030823 3300025912 Bacteria 4691
193 Ga0207707_10067379 3300025912 Bacteria 3118
194 Ga0207707_10178245 3300025912 Bacteria 1856
195 Ga0207707_10204733 3300025912 Bacteria 1720
196 Ga0207695_10411645 3300025913 Bacteria 1237
197 Ga0207671_10523156 3300025914 Bacteria 946
198 Ga0207663_10792915 3300025916 Bacteria 754
199 Ga0207660_10038372 3300025917 Unclassified 3343
200 Ga0207660_10063859 3300025917 Bacteria 2656
201 Ga0207660_10106006 3300025917 Unclassified 2107
202 Ga0207660_10131031 3300025917 Unclassified 1909
203 Ga0207660_10269164 3300025917 Unclassified 1349
204 Ga0207662_10044782 3300025918 Bacteria 2613
205 Ga0207657_10059549 3300025919 Bacteria 3280
206 Ga0207657_10225551 3300025919 Bacteria 1500
207 Ga0207649_10080624 3300025920 Bacteria 2105
208 Ga0207649_10245366 3300025920 Bacteria 1287
209 Ga0207649_10680379 3300025920 Bacteria 797
210 Ga0207652_10026302 3300025921 Bacteria 4845
211 Ga0207652_10124964 3300025921 Unclassified 2291
212 Ga0207681_10433787 3300025923 Bacteria 1066
213 Ga0207694_10144605 3300025924 Bacteria 1914
214 Ga0207694_10618971 3300025924 Bacteria 911
215 Ga0207650_10007137 3300025925 Bacteria 7613
216 Ga0207650_10023600 3300025925 Unclassified 4364
217 Ga0207659_10222645 3300025926 Bacteria 1518
218 Ga0207659_10888864 3300025926 Bacteria 766
219 Ga0207700_11218456 3300025928 Bacteria 672
220 Ga0207664_10009025 3300025929 Bacteria 6983
221 Ga0207664_10036676 3300025929 Bacteria 3789
222 Ga0207664_10106058 3300025929 Bacteria 2330
223 Ga0207644_10679189 3300025931 Bacteria 858
224 Ga0207690_10022049 3300025932 Bacteria 3957
225 Ga0207690_10060234 3300025932 Bacteria 2575
226 Ga0207690_10390831 3300025932 Bacteria 1107
227 Ga0207670_10027479 3300025936 Bacteria 3597
228 Ga0207669_11143507 3300025937 Bacteria 658
229 Ga0207704_10316473 3300025938 Unclassified 1202
230 Ga0207704_10343265 3300025938 Bacteria 1160
231 Ga0207691_10236143 3300025940 Bacteria 1582
232 Ga0207689_10022802 3300025942 Bacteria 5260
233 Ga0207661_10022093 3300025944 Bacteria 4783
234 Ga0207661_10028499 3300025944 Bacteria 4277
235 Ga0207661_10062791 3300025944 Bacteria 3006
236 Ga0207661_10088237 3300025944 Bacteria 2578
237 Ga0207661_10600122 3300025944 Bacteria 1010
238 Ga0207661_10660268 3300025944 Unclassified 961
239 Ga0207679_10049204 3300025945 Bacteria 3074
240 Ga0207679_10066132 3300025945 Bacteria 2708
241 Ga0207679_10126369 3300025945 Bacteria 2044
242 Ga0207679_10160323 3300025945 Bacteria 1841
243 Ga0207679_10190025 3300025945 Bacteria 1706
244 Ga0207679_11187281 3300025945 Unclassified 700
245 Ga0207679_11313448 3300025945 Unclassified 664
246 Ga0207667_10155837 3300025949 Bacteria 2350
247 Ga0207667_10232866 3300025949 Bacteria 1886
248 Ga0207651_10024526 3300025960 Bacteria 3733
249 Ga0207668_10047368 3300025972 Bacteria 2943
250 Ga0207640_10077704 3300025981 Bacteria 2257
251 Ga0207640_10225762 3300025981 Bacteria 1437
252 Ga0207640_10346824 3300025981 Unclassified 1191
253 Ga0207640_10660650 3300025981 Bacteria 892
254 Ga0207658_10030470 3300025986 Bacteria 3820
255 Ga0207677_10254834 3300026023 Unclassified 1427
256 Ga0207639_10233833 3300026041 Bacteria 1594
257 Ga0207639_10785899 3300026041 Bacteria 886
258 Ga0207708_10033958 3300026075 Unclassified 3879
259 Ga0207708_10049864 3300026075 Bacteria 3188
260 Ga0207708_10383557 3300026075 Bacteria 1159
261 Ga0207708_10673183 3300026075 Bacteria 882
262 Ga0207702_10175536 3300026078 Bacteria 1969
263 Ga0207702_10786595 3300026078 Unclassified 940
264 Ga0207702_11380008 3300026078 Unclassified 698
265 Ga0207641_10164112 3300026088 Bacteria 2022
266 Ga0207641_10314656 3300026088 Unclassified 1483
267 Ga0207648_11397061 3300026089 Bacteria 658
268 Ga0207676_10010542 3300026095 Bacteria 6585
269 Ga0207676_10310079 3300026095 Bacteria 1444
270 Ga0207676_10395069 3300026095 Bacteria 1291
271 Ga0207674_10002108 3300026116 Bacteria 25182
272 Ga0207674_10004645 3300026116 Bacteria 16491
273 Ga0207674_10440999 3300026116 Bacteria 1259
274 Ga0207675_100035215 3300026118 Bacteria 4670
275 Ga0207683_10185302 3300026121 Unclassified 1888
276 Ga0207683_11258899 3300026121 Bacteria 685
277 Ga0207698_10035494 3300026142 Bacteria 3648
278 Ga0207698_10112531 3300026142 Bacteria 2285
279 Ga0207698_10134890 3300026142 Bacteria 2116
280 Ga0207698_10327155 3300026142 Bacteria 1438
281 Ga0207428_10020005 3300027907 Bacteria 5701
282 Ga0268266_10062343 3300028379 Bacteria 3218
283 Ga0268265_10115663 3300028380 Bacteria 2199
284 Ga0268264_11399715 3300028381 Unclassified 710
285 Ga0307413_10144987 3300031824 Bacteria 1647
286 Ga0307413_10306289 3300031824 Bacteria 1207
287 Ga0307413_10590807 3300031824 Bacteria 907
288 Ga0307410_10374329 3300031852 Bacteria 1144
289 Ga0307410_11494834 3300031852 Bacteria 595
290 Ga0307409_100838737 3300031995 Bacteria 929
291 Ga0307409_100853640 3300031995 Bacteria 921
292 Ga0307409_101311399 3300031995 Archaea 749
293 Ga0307409_101606366 3300031995 Bacteria 678
294 Ga0307416_100237850 3300032002 Bacteria 1762
295 Ga0307416_100281081 3300032002 Bacteria 1641
296 Ga0307414_11579363 3300032004 Bacteria 611
297 Ga0307411_10093472 3300032005 Bacteria 2106
298 Ga0307411_10390645 3300032005 Bacteria 1147
299 Ga0373947_0443529 3300035725 Bacteria 879
300 Ga0395900_1100294 3300037418 Unclassified 712
301 Ga0436365_0219339 3300039437 Unclassified 721
302 Ga0436365_1650109 3300039437 Bacteria 991
303 Ga0436365_1840768 3300039437 Unclassified 2623
304 Ga0451807_1356620 3300041486 Bacteria 1056
305 Ga0451835_0096043 3300041492 Bacteria 624
306 Ga0451845_0479186 3300041501 Bacteria 740
307 Ga0451847_0426965 3300041503 Unclassified 640
308 Ga0451576_0318975 3300045051 Unclassified 1626
309 Ga0466967_0118809 3300045976 Bacteria 2439
310 Ga0466967_0359064 3300045976 Unclassified 1411
311 Ga0495629_0129402 3300046459 Unclassified 1759
312 Ga0495594_0006772 3300046499 Bacteria 5894
313 Ga0495594_0502650 3300046499 Bacteria 688
314 Ga0495586_0170255 3300046535 Unclassified 1231
315 Ga0495645_0196040 3300046543 Unclassified 1373
316 Ga0495659_0156354 3300046664 Bacteria 918
317 Ga0495599_0254551 3300046678 Bacteria 1068
318 Ga0495613_0245485 3300046689 Unclassified 1251
319 Ga0495670_0573387 3300046691 Bacteria 614
320 Ga0495589_0327883 3300046794 Bacteria 707
321 Ga0495581_0704074 3300047315 Bacteria 582
322 Ga0495677_0162504 3300047445 Bacteria 862
323 Ga0496100_0183115 3300048903 Bacteria 1516
324 Ga0496101_0134275 3300048904 Bacteria 1882
325 Ga0496109_0547241 3300048912 Unclassified 1092
326 Ga0496109_0638670 3300048912 Unclassified 1001
327 Ga0496111_0396058 3300048914 Unclassified 1021
328 Ga0496112_0048221 3300048915 Bacteria 4177
329 Ga0496112_1016257 3300048915 Unclassified 749
330 Ga0496113_0516782 3300048916 Unclassified 958
331 Ga0501031_0471630 3300049568 Bacteria 810
332 Ga0501033_0031264 3300049570 Bacteria 4001
333 Ga0501033_0096605 3300049570 Bacteria 2159
334 Ga0501034_0001470 3300049571 Bacteria 31214
335 Ga0501036_0326717 3300049572 Bacteria 1281
336 Ga0501036_0565953 3300049572 Bacteria 944
337 Ga0501042_0233509 3300049578 Bacteria 1327
338 Ga0501042_0960188 3300049578 Bacteria 623
339 Ga0501043_0129015 3300049579 Bacteria 1982
340 Ga0501047_0015667 3300049581 Bacteria 7225
341 Ga0501048_0753453 3300049582 Bacteria 699
342 Ga0501069_0674253 3300049585 Unclassified 623
343 Ga0501070_0037994 3300049586 Bacteria 4018
344 Ga0501070_1128351 3300049586 Bacteria 604
345 Ga0501071_0128098 3300049587 Bacteria 1885
346 Ga0501073_0662390 3300049589 Bacteria 720
347 Ga0501074_0158200 3300049590 Bacteria 1618
348 Ga0501075_0107278 3300049591 Bacteria 2123
349 Ga0501075_0455741 3300049591 Bacteria 975
350 Ga0501077_0243164 3300049593 Bacteria 1144
351 Ga0501080_0255372 3300049742 Bacteria 1598
352 Ga0501280_107704 3300049776 Unclassified 542
353 Ga0501035_0190988 3300049822 Bacteria 1761
354 Ga0501035_0195914 3300049822 Bacteria 1735
355 Ga0501044_0032022 3300049823 Bacteria 5528
356 Ga0501045_0066573 3300049824 Bacteria 2645
357 Ga0501045_0686515 3300049824 Unclassified 756
358 nmdc:mga03683_8117_c1 3300050489 Bacteria 3676
359 nmdc:mga00v17_298859_c1 3300050491 Bacteria 1046
360 nmdc:mga00v17_99592_c1 3300050491 Bacteria 1833
361 nmdc:mga0yw44_227593_c1 3300050492 Unclassified 1237
362 nmdc:mga0k408_31684_c1 3300050493 Bacteria 3020
363 nmdc:mga0k408_682976_c1 3300050493 Bacteria 602
364 nmdc:mga07m45_48532_c1 3300050496 Bacteria 2388
365 nmdc:mga05p37_127595_c1 3300050507 Bacteria 3123
366 nmdc:mga09592_327912_c1 3300050508 Unclassified 1326
367 nmdc:mga09592_681511_c1 3300050508 Bacteria 876
368 nmdc:mga09592_85363_c1 3300050508 Bacteria 2693
369 nmdc:mga0qj67_12385_c1 3300050509 Bacteria 6424
370 nmdc:mga0qj67_97055_c1 3300050509 Unclassified 2373
371 nmdc:mga06r32_17628_c1 3300050510 Bacteria 6522
372 nmdc:mga06r32_447056_c1 3300050510 Bacteria 1272
373 nmdc:mga08y16_1212962_c1 3300050511 Unclassified 725
374 nmdc:mga08y16_20061_c1 3300050511 Bacteria 7052
375 nmdc:mga08y16_235076_c1 3300050511 Bacteria 1895
376 nmdc:mga08y16_419815_c1 3300050511 Bacteria 1367
377 nmdc:mga08y16_841470_c1 3300050511 Unclassified 907
378 nmdc:mga08y16_87436_c1 3300050511 Bacteria 3248
379 nmdc:mga0n895_13601_c1 3300050512 Bacteria 7352
380 Ga0500641_0011782 3300053096 Bacteria 3179
381 Ga0501084_0086011 3300054114 Bacteria 2640
382 Ga0590071_074983 3300059421 Unclassified 837
383 Ga0307416_101779362
384 JGI25406J46586_10060374
385 Ga0065712_10070920
386 Ga0070658_11064173
387 Ga0070683_100043069
388 Ga0070683_100072895
389 Ga0070683_100605602
390 Ga0070670_100140840
391 Ga0070670_100888895
392 Ga0070677_10033914
393 Ga0070677_10067542
394 Ga0070677_10357574
395 Ga0068869_100073122
396 Ga0070666_10335275
397 Ga0070680_100045598
398 Ga0070680_100052759
399 Ga0070680_100109573
400 Ga0070680_100297336
401 Ga0070682_100062219
402 Ga0068868_100491013
403 Ga0070660_100069587
404 Ga0070660_100073697
405 Ga0070689_100835292
406 Ga0070691_10006761
407 Ga0070687_100045765
408 Ga0070661_100106688
409 Ga0070692_10046941
410 Ga0070669_100020916
411 Ga0070669_100170982
412 Ga0070675_100018633
413 Ga0070675_100136229
414 Ga0070674_100016422
415 Ga0070674_100563391
416 Ga0070688_100013496
417 Ga0070688_100188222
418 Ga0070659_100034974
419 Ga0070659_100114575
420 Ga0070667_100135277
421 Ga0070714_100051829
422 Ga0070714_100080600
423 Ga0070714_100133954
424 Ga0070713_100001290
425 Ga0070713_100052488
426 Ga0070713_100161899
427 Ga0070711_100260206
428 Ga0070705_100062761
429 Ga0070700_100680943
430 Ga0070694_100129444
431 Ga0070694_100813693
432 Ga0070678_100058505
433 Ga0070678_100171614
434 Ga0070678_100320116
435 Ga0070681_10001030
436 Ga0070681_10008234
437 Ga0070681_10129589
438 Ga0070681_10257685
439 Ga0070681_10832820
440 Ga0068867_100215816
441 Ga0070685_10132078
442 Ga0070706_100156109
443 Ga0070707_100687055
444 Ga0070698_100142904
445 Ga0070698_100329134
446 Ga0070698_100993344
447 Ga0070699_100237103
448 Ga0070699_100330917
449 Ga0070679_100030816
450 Ga0070679_100051335
451 Ga0070679_100127415
452 Ga0070679_100153364
453 Ga0070679_100829026
454 Ga0070684_100005545
455 Ga0070684_100034564
456 Ga0070684_100041986
457 Ga0070684_100096427
458 Ga0070684_100098200
459 Ga0070684_100271425
460 Ga0070684_100349703
461 Ga0070684_100855058
462 Ga0070672_100232846
463 Ga0070696_100307606
464 Ga0070693_100000769
465 Ga0070693_100295663
466 Ga0070665_100109002
467 Ga0070665_100544214
468 Ga0070664_100030749
469 Ga0070664_100039876
470 Ga0070664_100051167
471 Ga0070664_100059726
472 Ga0070664_100159732
473 Ga0070664_100716570
474 Ga0068857_100002799
475 Ga0068857_100161411
476 Ga0068857_100168757
477 Ga0068857_100992051
478 Ga0068857_101348844
479 Ga0068854_100035546
480 Ga0068854_100124073
481 Ga0068854_100242362
482 Ga0068856_101428911
483 Ga0070702_100091060
484 Ga0068852_100138209
485 Ga0068852_100459697
486 Ga0068852_101470023
487 Ga0068864_100007697
488 Ga0068864_100170189
489 Ga0068864_100334891
490 Ga0068864_100538011
491 Ga0068851_10094585
492 Ga0068862_100388179
493 Ga0081455_10354177
494 Ga0081539_10029734
495 Ga0075368_10104208
496 Ga0075364_10126754
497 Ga0075364_10149599
498 Ga0070712_100016111
499 Ga0075362_10037581
500 Ga0075366_10051829
501 Ga0097621_100117113
502 Ga0075370_10021187
503 Ga0068871_100562041
504 Ga0068871_100606197
505 Ga0075428_100630510
506 Ga0075428_100887784
507 Ga0075430_100002246
508 Ga0075430_100015742
509 Ga0075430_100076181
510 Ga0075431_100002181
511 Ga0075431_100020131
512 Ga0075431_100070550
513 Ga0075434_100068747
514 Ga0075429_100049398
515 Ga0075429_100093464
516 Ga0075429_100105367
517 Ga0068865_100239773
518 Ga0068865_100275597
519 Ga0068865_100673514
520 Ga0111539_10008537
521 Ga0111539_10056307
522 Ga0111539_10059487
523 Ga0111539_10502516
524 Ga0111539_11357781
525 Ga0114129_10116629
526 Ga0114129_12176531
527 Ga0105243_10886924
528 Ga0105243_11017122
529 Ga0105241_10321138
530 Ga0105241_11331663
531 Ga0105237_10107428
532 Ga0105238_10080996
533 Ga0105238_10884863
534 Ga0105238_10980327
535 Ga0105238_11954326
536 Ga0105238_12096572
537 Ga0105239_10738678
538 Ga0105239_11417244
539 Ga0157373_10262486
540 Ga0157370_10021836
541 Ga0157370_10143084
542 Ga0157369_10322519
543 Ga0163162_10006179
544 Ga0163162_10595840
545 Ga0163162_12472148
546 Ga0157372_10093378
547 Ga0157372_10138358
548 Ga0157372_11131601
549 Ga0157375_10920007
550 Ga0163163_10875197
551 Ga0157380_10002812
552 Ga0157380_10005572
553 Ga0157380_10209136
554 Ga0157380_10436810
555 Ga0157380_10513655
556 Ga0157380_10607820
557 Ga0157377_10204005
558 Ga0182005_1047278
559 Ga0206354_11084306
560 Ga0213876_10409427
561 Ga0207656_10063839
562 Ga0207656_10160758
563 Ga0207682_10017869
564 Ga0207682_10019443
565 Ga0207688_10113518
566 Ga0207680_10116748
567 Ga0207680_10190430
568 Ga0207645_10026967
569 Ga0207645_10170037
570 Ga0207705_10050081
571 Ga0207654_10599939
572 Ga0207654_10661465
573 Ga0207707_10013910
574 Ga0207707_10030823
575 Ga0207707_10067379
576 Ga0207707_10178245
577 Ga0207707_10204733
578 Ga0207695_10411645
579 Ga0207671_10523156
580 Ga0207663_10792915
581 Ga0207660_10038372
582 Ga0207660_10063859
583 Ga0207660_10106006
584 Ga0207660_10131031
585 Ga0207660_10269164
586 Ga0207662_10044782
587 Ga0207657_10059549
588 Ga0207657_10225551
589 Ga0207649_10080624
590 Ga0207649_10245366
591 Ga0207649_10680379
592 Ga0207652_10026302
593 Ga0207652_10124964
594 Ga0207681_10433787
595 Ga0207694_10144605
596 Ga0207694_10618971
597 Ga0207650_10007137
598 Ga0207650_10023600
599 Ga0207659_10222645
600 Ga0207659_10888864
601 Ga0207700_11218456
602 Ga0207664_10009025
603 Ga0207664_10036676
604 Ga0207664_10106058
605 Ga0207644_10679189
606 Ga0207690_10022049
607 Ga0207690_10060234
608 Ga0207690_10390831
609 Ga0207670_10027479
610 Ga0207669_11143507
611 Ga0207704_10316473
612 Ga0207704_10343265
613 Ga0207691_10236143
614 Ga0207689_10022802
615 Ga0207661_10022093
616 Ga0207661_10028499
617 Ga0207661_10062791
618 Ga0207661_10088237
619 Ga0207661_10600122
620 Ga0207661_10660268
621 Ga0207679_10049204
622 Ga0207679_10066132
623 Ga0207679_10126369
624 Ga0207679_10160323
625 Ga0207679_10190025
626 Ga0207679_11187281
627 Ga0207679_11313448
628 Ga0207667_10155837
629 Ga0207667_10232866
630 Ga0207651_10024526
631 Ga0207668_10047368
632 Ga0207640_10077704
633 Ga0207640_10225762
634 Ga0207640_10346824
635 Ga0207640_10660650
636 Ga0207658_10030470
637 Ga0207677_10254834
638 Ga0207639_10233833
639 Ga0207639_10785899
640 Ga0207708_10033958
641 Ga0207708_10049864
642 Ga0207708_10383557
643 Ga0207708_10673183
644 Ga0207702_10175536
645 Ga0207702_10786595
646 Ga0207702_11380008
647 Ga0207641_10164112
648 Ga0207641_10314656
649 Ga0207648_11397061
650 Ga0207676_10010542
651 Ga0207676_10310079
652 Ga0207676_10395069
653 Ga0207674_10002108
654 Ga0207674_10004645
655 Ga0207674_10440999
656 Ga0207675_100035215
657 Ga0207683_10185302
658 Ga0207683_11258899
659 Ga0207698_10035494
660 Ga0207698_10112531
661 Ga0207698_10134890
662 Ga0207698_10327155
663 Ga0207428_10020005
664 Ga0268266_10062343
665 Ga0268265_10115663
666 Ga0268264_11399715
667 Ga0307413_10144987
668 Ga0307413_10306289
669 Ga0307413_10590807
670 Ga0307410_10374329
671 Ga0307410_11494834
672 Ga0307409_100838737
673 Ga0307409_100853640
674 Ga0307409_101311399
675 Ga0307409_101606366
676 Ga0307416_100237850
677 Ga0307416_100281081
678 Ga0307414_11579363
679 Ga0307411_10093472
680 Ga0307411_10390645
681 Ga0373947_0443529
682 Ga0395900_1100294
683 Ga0436365_0219339
684 Ga0436365_1650109
685 Ga0436365_1840768
686 Ga0451807_1356620
687 Ga0451835_0096043
688 Ga0451845_0479186
689 Ga0451847_0426965
690 Ga0451576_0318975
691 Ga0466967_0118809
692 Ga0466967_0359064
693 Ga0495629_0129402
694 Ga0495594_0006772
695 Ga0495594_0502650
696 Ga0495586_0170255
697 Ga0495645_0196040
698 Ga0495659_0156354
699 Ga0495599_0254551
700 Ga0495613_0245485
701 Ga0495670_0573387
702 Ga0495589_0327883
703 Ga0495581_0704074
704 Ga0495677_0162504
705 Ga0496100_0183115
706 Ga0496101_0134275
707 Ga0496109_0547241
708 Ga0496109_0638670
709 Ga0496111_0396058
710 Ga0496112_0048221
711 Ga0496112_1016257
712 Ga0496113_0516782
713 Ga0501031_0471630
714 Ga0501033_0031264
715 Ga0501033_0096605
716 Ga0501034_0001470
717 Ga0501036_0326717
718 Ga0501036_0565953
719 Ga0501042_0233509
720 Ga0501042_0960188
721 Ga0501043_0129015
722 Ga0501047_0015667
723 Ga0501048_0753453
724 Ga0501069_0674253
725 Ga0501070_0037994
726 Ga0501070_1128351
727 Ga0501071_0128098
728 Ga0501073_0662390
729 Ga0501074_0158200
730 Ga0501075_0107278
731 Ga0501075_0455741
732 Ga0501077_0243164
733 Ga0501080_0255372
734 Ga0501280_107704
735 Ga0501035_0190988
736 Ga0501035_0195914
737 Ga0501044_0032022
738 Ga0501045_0066573
739 Ga0501045_0686515
740 nmdc:mga03683_8117_c1
741 nmdc:mga00v17_298859_c1
742 nmdc:mga00v17_99592_c1
743 nmdc:mga0yw44_227593_c1
744 nmdc:mga0k408_31684_c1
745 nmdc:mga0k408_682976_c1
746 nmdc:mga07m45_48532_c1
747 nmdc:mga05p37_127595_c1
748 nmdc:mga09592_327912_c1
749 nmdc:mga09592_681511_c1
750 nmdc:mga09592_85363_c1
751 nmdc:mga0qj67_12385_c1
752 nmdc:mga0qj67_97055_c1
753 nmdc:mga06r32_17628_c1
754 nmdc:mga06r32_447056_c1
755 nmdc:mga08y16_1212962_c1
756 nmdc:mga08y16_20061_c1
757 nmdc:mga08y16_235076_c1
758 nmdc:mga08y16_419815_c1
759 nmdc:mga08y16_841470_c1
760 nmdc:mga08y16_87436_c1
761 nmdc:mga0n895_13601_c1
762 Ga0500641_0011782
763 Ga0501084_0086011
764 Ga0590071_074983

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00588

SpoU_methylase

SpoU rRNA Methylase family

2

145

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
5co4-assembly1.cif.gz_A structural insights into the 2-oh methylation of c/u34 on trna 0.9448 2 154
3l8u-assembly1.cif.gz_B crystal structure of smu.1707c, a putative rrna methyltransferase from streptococcus mutans ua159 0.9407 2 155
5co4-assembly1.cif.gz_B structural insights into the 2-oh methylation of c/u34 on trna 0.9307 2 151
3l8u-assembly1.cif.gz_A crystal structure of smu.1707c, a putative rrna methyltransferase from streptococcus mutans ua159 0.9265 1 155
1j85-assembly1.cif.gz_A structure of yibk from haemophilus influenzae (hi0766), a truncated sequence homolog of trna (guanosine-2'-o-) methyltransferase (spou) 0.9162 3 151
ID Description Score Start End Superfamily
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9448 2 154 3.40.1280.10
3l8uA00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9265 1 155 3.40.1280.10
5co4A00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.915 2 154 3.40.1280.10
4pzkB00 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.9148 2 153 3.40.1280.10
5l0zB02 Alpha Beta;3-Layer(aba) Sandwich;Alpha/beta knot;SPOUT methyltransferase, trefoil knot domain 0.8918 2 150 3.40.1280.10
ID Description Score Start End GO Terms
AF-A0A1E3Y7K4-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9888 2 158 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A1E3Y7K4-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9765 2 158 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A257V5N0-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9705 1 153 GO:0002130
GO:0003723
GO:0005737
GO:0141098
GO:0141102
AF-A0A7V4L968-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.97 2 155 GO:0002130
GO:0003723
GO:0005737
GO:0008175
GO:0008757
AF-A0A844G4I2-F1-model_v4 Putative tRNA (cytidine(34)-2'-O)-methyltransferase (EC 2.1.1.207) (tRNA (cytidine/uridine-2'-O-)-methyltransferase) 0.9594 2 156 GO:0002130
GO:0003723
GO:0005737
GO:0008175
GO:0008757

Map