F429291

General Info

Members Datasets Scaffolds Average Seq Length
382 190 381 174

Family's Representative Sequence

Representative Sequence 3300025940|Ga0207691_10045055|Ga0207691_100450553
Length 209
Sequence LLRDGFFMEGSVNILNDSLHTTPNSQPPTVNQLSVIFVIITMSDTIINKVAESGLITIDLESFFPADEIVGFDLKDFLFMGLILKEKDFREALTAFDWENMRSKKVAIYCSADAIIPLWAYMLVSSYLQPVAKLVFSGTPEELKKQEFIKNIQQLDATTFEDKRVVVKGCGDMEIGEYAFVEITNKLRPVVKSLMYGEPCSTVPVYKKR

Samples

Sample ID Description Type Environment
1 2896109856 Chitinophaga sp. SYP-B3965 Isolate Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
4 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
5 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
6 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
38 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
39 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
40 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
41 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
47 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
48 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
49 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
50 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
51 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
52 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
55 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
62 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
63 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
64 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
69 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
70 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
71 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
73 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
74 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
75 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
76 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
77 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
78 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
79 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
80 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
81 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
82 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
83 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
84 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
85 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
95 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
145 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
146 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
147 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
148 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
149 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
150 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
151 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
152 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
153 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
159 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
160 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
161 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
162 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
165 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
166 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
167 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
168 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
169 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
170 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
171 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
172 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
173 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
176 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
177 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
179 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
180 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
181 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
182 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
183 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
184 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
185 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
186 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
187 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
188 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
189 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
190 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.62
Nodule 0
Rhizoplane 0.52
Rhizosphere 93.72
Stem 0
Stem Tuber 0
Unclassified 3.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10155573 3300003316 Bacteria 1374
2 rootL2_10143996 3300003322 Bacteria 4621
3 rootL2_10235023 3300003322 Unclassified 1601
4 rootH1_10099088 3300003323 Bacteria 5161
5 rootH1_10341299 3300003323 Unclassified 3061
6 JGI25160J50197_1000375 3300003354 Bacteria 29260
7 Ga0065704_10129942 3300005289 Bacteria 1642
8 Ga0065704_10148615 3300005289 Unclassified 1449
9 Ga0065712_10005258 3300005290 Unclassified 2935
10 Ga0065715_10009378 3300005293 Bacteria 4944
11 Ga0070658_10044331 3300005327 Unclassified 3595
12 Ga0070658_10500852 3300005327 Bacteria 1049
13 Ga0070683_100225861 3300005329 Unclassified 1779
14 Ga0070670_100235985 3300005331 Bacteria 1592
15 Ga0070670_100399113 3300005331 Bacteria 1214
16 Ga0070670_101096938 3300005331 Bacteria 726
17 Ga0070677_10073470 3300005333 Unclassified 1445
18 Ga0070677_10473170 3300005333 Bacteria 674
19 Ga0068869_100008852 3300005334 Bacteria 6513
20 Ga0068869_100028501 3300005334 Bacteria 3902
21 Ga0070666_10000030 3300005335 Bacteria 137543
22 Ga0070666_10038104 3300005335 Bacteria 3198
23 Ga0070680_100072919 3300005336 Bacteria 2823
24 Ga0070682_100458933 3300005337 Unclassified 978
25 Ga0068868_100785993 3300005338 Bacteria 858
26 Ga0068868_101171457 3300005338 Unclassified 710
27 Ga0068868_101416108 3300005338 Bacteria 649
28 Ga0070660_100044144 3300005339 Bacteria 3408
29 Ga0070689_100025280 3300005340 Bacteria 4460
30 Ga0070689_100838092 3300005340 Unclassified 810
31 Ga0070691_10386405 3300005341 Unclassified 785
32 Ga0070687_100651226 3300005343 Bacteria 730
33 Ga0070668_100624483 3300005347 Unclassified 945
34 Ga0070668_100702210 3300005347 Unclassified 892
35 Ga0070669_100045943 3300005353 Bacteria 3183
36 Ga0070675_100049305 3300005354 Bacteria 3456
37 Ga0070675_100286458 3300005354 Bacteria 1449
38 Ga0070675_100357209 3300005354 Bacteria 1297
39 Ga0070675_100969928 3300005354 Unclassified 780
40 Ga0070671_100011034 3300005355 Bacteria 7251
41 Ga0070671_100053047 3300005355 Bacteria 3371
42 Ga0070671_100270163 3300005355 Bacteria 1445
43 Ga0070671_100432406 3300005355 Bacteria 1128
44 Ga0070674_100031069 3300005356 Bacteria 3535
45 Ga0070674_100176947 3300005356 Unclassified 1631
46 Ga0070674_100350752 3300005356 Bacteria 1192
47 Ga0070673_100257055 3300005364 Unclassified 1524
48 Ga0070673_100353600 3300005364 Unclassified 1304
49 Ga0070673_101753857 3300005364 Unclassified 588
50 Ga0070688_100100349 3300005365 Bacteria 1907
51 Ga0070688_100287045 3300005365 Bacteria 1184
52 Ga0070688_100585145 3300005365 Unclassified 852
53 Ga0070659_100019085 3300005366 Bacteria 5186
54 Ga0070667_100079582 3300005367 Unclassified 2802
55 Ga0070667_100139426 3300005367 Bacteria 2122
56 Ga0070667_100218207 3300005367 Bacteria 1697
57 Ga0070667_100348944 3300005367 Bacteria 1339
58 Ga0070667_100970260 3300005367 Bacteria 792
59 Ga0070701_10082585 3300005438 Unclassified 1743
60 Ga0070700_100080218 3300005441 Bacteria 2105
61 Ga0070700_100135710 3300005441 Bacteria 1666
62 Ga0070700_100143991 3300005441 Unclassified 1623
63 Ga0070663_100770927 3300005455 Bacteria 823
64 Ga0070678_100035313 3300005456 Bacteria 3489
65 Ga0070678_100129425 3300005456 Bacteria 2003
66 Ga0070678_100258667 3300005456 Bacteria 1463
67 Ga0070678_100350833 3300005456 Bacteria 1269
68 Ga0068867_100126477 3300005459 Bacteria 1981
69 Ga0068867_100993120 3300005459 Bacteria 761
70 Ga0068867_101237904 3300005459 Bacteria 687
71 Ga0070685_10034877 3300005466 Bacteria 2836
72 Ga0070706_101214017 3300005467 Unclassified 693
73 Ga0070707_100351288 3300005468 Bacteria 1432
74 Ga0070698_100001103 3300005471 Bacteria 29751
75 Ga0070698_100021829 3300005471 Bacteria 6705
76 Ga0070698_100026571 3300005471 Bacteria 6026
77 Ga0070699_100108261 3300005518 Unclassified 2439
78 Ga0070679_100219445 3300005530 Bacteria 1863
79 Ga0068853_101116427 3300005539 Unclassified 760
80 Ga0070672_100106896 3300005543 Unclassified 2277
81 Ga0070672_100366086 3300005543 Bacteria 1231
82 Ga0070686_100003077 3300005544 Bacteria 9137
83 Ga0070665_100076488 3300005548 Unclassified 3354
84 Ga0068855_100000795 3300005563 Bacteria 39086
85 Ga0070664_100012885 3300005564 Bacteria 6804
86 Ga0068857_100039491 3300005577 Bacteria 4181
87 Ga0068857_100281752 3300005577 Bacteria 1529
88 Ga0068852_100038137 3300005616 Bacteria 4036
89 Ga0068852_100105668 3300005616 Unclassified 2551
90 Ga0068852_101420752 3300005616 Unclassified 716
91 Ga0068859_100000003 3300005617 Bacteria 479218
92 Ga0068859_100197215 3300005617 Bacteria 2098
93 Ga0068859_100207189 3300005617 Unclassified 2046
94 Ga0068859_100260373 3300005617 Unclassified 1826
95 Ga0068859_100296013 3300005617 Unclassified 1711
96 Ga0068864_100020481 3300005618 Bacteria 5534
97 Ga0068864_100082551 3300005618 Unclassified 2820
98 Ga0068864_100390300 3300005618 Bacteria 1321
99 Ga0068866_10049163 3300005718 Bacteria 2135
100 Ga0068866_10106289 3300005718 Unclassified 1558
101 Ga0068866_10198682 3300005718 Bacteria 1197
102 Ga0068866_10578021 3300005718 Bacteria 755
103 Ga0068861_100003315 3300005719 Bacteria 10661
104 Ga0068861_100027557 3300005719 Bacteria 4140
105 Ga0068861_100424027 3300005719 Bacteria 1186
106 Ga0068861_101021232 3300005719 Unclassified 790
107 Ga0068851_10007506 3300005834 Bacteria 5011
108 Ga0068851_10249387 3300005834 Unclassified 1007
109 Ga0068851_10551927 3300005834 Unclassified 696
110 Ga0068870_10013805 3300005840 Unclassified 3804
111 Ga0068870_10243604 3300005840 Unclassified 1111
112 Ga0068863_100004042 3300005841 Bacteria 14481
113 Ga0068863_100049408 3300005841 Unclassified 3989
114 Ga0068863_100062650 3300005841 Bacteria 3517
115 Ga0068863_100137939 3300005841 Bacteria 2330
116 Ga0068858_100012504 3300005842 Bacteria 8006
117 Ga0068858_100425104 3300005842 Unclassified 1278
118 Ga0068860_100004265 3300005843 Bacteria 14642
119 Ga0068860_100237123 3300005843 Unclassified 1774
120 Ga0068860_100506399 3300005843 Unclassified 1206
121 Ga0068862_100595538 3300005844 Unclassified 1061
122 Ga0081455_10255763 3300005937 Bacteria 1278
123 Ga0075366_10019670 3300006195 Bacteria 3911
124 Ga0075366_10299129 3300006195 Bacteria 984
125 Ga0097621_100000352 3300006237 Bacteria 31757
126 Ga0097621_100195915 3300006237 Bacteria 1752
127 Ga0068871_100073855 3300006358 Bacteria 2812
128 Ga0068871_100253215 3300006358 Bacteria 1534
129 Ga0075428_100023526 3300006844 Bacteria 6820
130 Ga0075428_100093656 3300006844 Bacteria 3275
131 Ga0075431_100153606 3300006847 Unclassified 2369
132 Ga0075429_100015805 3300006880 Bacteria 6536
133 Ga0075429_100046759 3300006880 Bacteria 3765
134 Ga0097620_100000003 3300006931 Bacteria 479218
135 Ga0097620_100197203 3300006931 Bacteria 2098
136 Ga0097620_100207189 3300006931 Unclassified 2046
137 Ga0097620_100260388 3300006931 Unclassified 1826
138 Ga0097620_100296012 3300006931 Unclassified 1711
139 Ga0111539_10054803 3300009094 Bacteria 4742
140 Ga0111539_11113384 3300009094 Bacteria 917
141 Ga0111539_11786489 3300009094 Bacteria 713
142 Ga0105245_10651770 3300009098 Bacteria 1083
143 Ga0105247_10088179 3300009101 Bacteria 1966
144 Ga0105247_10122219 3300009101 Unclassified 1688
145 Ga0114129_10204970 3300009147 Bacteria 2669
146 Ga0105241_10000831 3300009174 Bacteria 23378
147 Ga0105241_10900763 3300009174 Bacteria 821
148 Ga0105242_10019535 3300009176 Bacteria 5311
149 Ga0105242_10165544 3300009176 Unclassified 1939
150 Ga0105242_10197886 3300009176 Bacteria 1783
151 Ga0105242_10301866 3300009176 Bacteria 1462
152 Ga0105242_10858929 3300009176 Bacteria 904
153 Ga0105248_10081795 3300009177 Unclassified 3631
154 Ga0105248_10297966 3300009177 Unclassified 1816
155 Ga0105237_10110501 3300009545 Bacteria 2741
156 Ga0105249_10002081 3300009553 Bacteria 17352
157 Ga0105249_10006036 3300009553 Bacteria 10499
158 Ga0105249_10260583 3300009553 Bacteria 1723
159 Ga0105249_10357206 3300009553 Unclassified 1482
160 Ga0105239_10121267 3300010375 Unclassified 2904
161 Ga0105246_10035861 3300011119 Bacteria 3318
162 Ga0105246_10080104 3300011119 Unclassified 2324
163 Ga0105246_10551842 3300011119 Unclassified 988
164 Ga0157373_10142702 3300013100 Bacteria 1684
165 Ga0157371_10000668 3300013102 Bacteria 40664
166 Ga0157371_10026811 3300013102 Bacteria 4185
167 Ga0157370_10026304 3300013104 Bacteria 5746
168 Ga0157370_10034600 3300013104 Bacteria 4917
169 Ga0157370_10281116 3300013104 Bacteria 1538
170 Ga0157374_10154610 3300013296 Bacteria 2232
171 Ga0157374_11210502 3300013296 Unclassified 777
172 Ga0157378_10024140 3300013297 Bacteria 5349
173 Ga0157378_10087806 3300013297 Unclassified 2821
174 Ga0157378_10109434 3300013297 Bacteria 2531
175 Ga0157378_10470642 3300013297 Bacteria 1250
176 Ga0157378_11770002 3300013297 Bacteria 666
177 Ga0163162_10000237 3300013306 Bacteria 50279
178 Ga0163162_10000824 3300013306 Bacteria 28851
179 Ga0163162_10618258 3300013306 Unclassified 1209
180 Ga0163162_11955486 3300013306 Bacteria 672
181 Ga0157372_10031301 3300013307 Bacteria 5826
182 Ga0157372_10035710 3300013307 Bacteria 5473
183 Ga0157372_10164190 3300013307 Bacteria 2568
184 Ga0157372_10200983 3300013307 Unclassified 2308
185 Ga0157372_10305261 3300013307 Unclassified 1852
186 Ga0157372_10662078 3300013307 Bacteria 1216
187 Ga0157375_10000599 3300013308 Bacteria 31988
188 Ga0157375_10032249 3300013308 Bacteria 4967
189 Ga0157375_10152426 3300013308 Bacteria 2448
190 Ga0157375_11458587 3300013308 Unclassified 807
191 Ga0163163_10001228 3300014325 Bacteria 21670
192 Ga0163163_10071388 3300014325 Bacteria 3460
193 Ga0163163_10611061 3300014325 Unclassified 1153
194 Ga0163163_11348649 3300014325 Unclassified 775
195 Ga0163163_11934140 3300014325 Unclassified 650
196 Ga0157380_10146760 3300014326 Unclassified 2034
197 Ga0157380_10233164 3300014326 Unclassified 1654
198 Ga0157380_10775248 3300014326 Unclassified 973
199 Ga0157380_10835483 3300014326 Bacteria 941
200 Ga0157380_11290491 3300014326 Bacteria 777
201 Ga0157377_10008371 3300014745 Bacteria 5043
202 Ga0157377_10098627 3300014745 Bacteria 1737
203 Ga0157377_10239656 3300014745 Unclassified 1170
204 Ga0157377_10406739 3300014745 Unclassified 928
205 Ga0157377_10506919 3300014745 Bacteria 844
206 Ga0157379_10002064 3300014968 Bacteria 16687
207 Ga0157379_10270584 3300014968 Unclassified 1545
208 Ga0157376_10000971 3300014969 Bacteria 18693
209 Ga0157376_10093677 3300014969 Bacteria 2608
210 Ga0157376_10239270 3300014969 Unclassified 1691
211 Ga0163161_10006338 3300017792 Bacteria 8189
212 Ga0163161_10428261 3300017792 Bacteria 1066
213 Ga0207666_1017641 3300025271 Unclassified 1032
214 Ga0207426_1000026 3300025302 Bacteria 515228
215 Ga0207656_10222273 3300025321 Unclassified 918
216 Ga0207682_10206617 3300025893 Unclassified 904
217 Ga0207642_10027537 3300025899 Bacteria 2327
218 Ga0207642_10028087 3300025899 Unclassified 2312
219 Ga0207710_10015100 3300025900 Bacteria 3261
220 Ga0207710_10301194 3300025900 Unclassified 810
221 Ga0207688_10187056 3300025901 Unclassified 1237
222 Ga0207680_10000014 3300025903 Bacteria 179035
223 Ga0207680_10040002 3300025903 Bacteria 2725
224 Ga0207647_10067188 3300025904 Bacteria 2173
225 Ga0207643_10003843 3300025908 Bacteria 8081
226 Ga0207643_10183097 3300025908 Unclassified 1269
227 Ga0207643_10240752 3300025908 Bacteria 1112
228 Ga0207705_10015886 3300025909 Bacteria 5405
229 Ga0207684_10336485 3300025910 Unclassified 1300
230 Ga0207654_10002088 3300025911 Bacteria 10232
231 Ga0207671_10007006 3300025914 Bacteria 9882
232 Ga0207660_10039630 3300025917 Bacteria 3294
233 Ga0207662_10002816 3300025918 Bacteria 8792
234 Ga0207662_10787152 3300025918 Bacteria 670
235 Ga0207657_10040339 3300025919 Bacteria 4137
236 Ga0207652_10037515 3300025921 Bacteria 4102
237 Ga0207652_10359222 3300025921 Bacteria 1315
238 Ga0207646_10351148 3300025922 Bacteria 1333
239 Ga0207681_10303393 3300025923 Unclassified 1264
240 Ga0207681_10490300 3300025923 Unclassified 1005
241 Ga0207650_10196716 3300025925 Bacteria 1613
242 Ga0207650_10611076 3300025925 Unclassified 917
243 Ga0207659_10743079 3300025926 Bacteria 841
244 Ga0207644_10315327 3300025931 Bacteria 1263
245 Ga0207644_10972538 3300025931 Bacteria 712
246 Ga0207706_10130361 3300025933 Bacteria 2212
247 Ga0207686_10000372 3300025934 Bacteria 31309
248 Ga0207670_10123207 3300025936 Bacteria 1888
249 Ga0207670_10148166 3300025936 Unclassified 1738
250 Ga0207669_10054518 3300025937 Bacteria 2415
251 Ga0207669_10149321 3300025937 Unclassified 1635
252 Ga0207669_10500443 3300025937 Unclassified 972
253 Ga0207704_10378858 3300025938 Bacteria 1110
254 Ga0207691_10021904 3300025940 Bacteria 6031
255 Ga0207691_10045055 3300025940 Unclassified 4057
256 Ga0207691_10192290 3300025940 Bacteria 1779
257 Ga0207711_10181115 3300025941 Bacteria 1916
258 Ga0207689_10003396 3300025942 Bacteria 14542
259 Ga0207689_10027798 3300025942 Bacteria 4733
260 Ga0207689_10098140 3300025942 Bacteria 2406
261 Ga0207689_10169692 3300025942 Bacteria 1798
262 Ga0207661_10627992 3300025944 Bacteria 987
263 Ga0207661_11374901 3300025944 Bacteria 648
264 Ga0207679_10013776 3300025945 Bacteria 5303
265 Ga0207667_10614351 3300025949 Bacteria 1095
266 Ga0207651_10027740 3300025960 Bacteria 3562
267 Ga0207651_10314287 3300025960 Unclassified 1307
268 Ga0207651_11049364 3300025960 Unclassified 729
269 Ga0207651_11207752 3300025960 Bacteria 679
270 Ga0207712_10000874 3300025961 Bacteria 21909
271 Ga0207712_10076595 3300025961 Unclassified 2422
272 Ga0207712_10101541 3300025961 Unclassified 2139
273 Ga0207712_10238134 3300025961 Unclassified 1465
274 Ga0207712_10380291 3300025961 Bacteria 1181
275 Ga0207668_10598353 3300025972 Unclassified 960
276 Ga0207668_10770350 3300025972 Unclassified 850
277 Ga0207658_10298818 3300025986 Bacteria 1386
278 Ga0207658_10357963 3300025986 Bacteria 1272
279 Ga0207677_10767293 3300026023 Bacteria 861
280 Ga0207677_10777438 3300026023 Bacteria 855
281 Ga0207703_10009595 3300026035 Bacteria 7601
282 Ga0207639_11076188 3300026041 Bacteria 754
283 Ga0207708_10121818 3300026075 Unclassified 2032
284 Ga0207708_10192006 3300026075 Bacteria 1626
285 Ga0207708_10208980 3300026075 Unclassified 1559
286 Ga0207641_10000015 3300026088 Bacteria 321332
287 Ga0207641_10000088 3300026088 Bacteria 131959
288 Ga0207641_10021048 3300026088 Bacteria 5360
289 Ga0207641_10346110 3300026088 Bacteria 1416
290 Ga0207641_11027152 3300026088 Bacteria 822
291 Ga0207648_10006875 3300026089 Bacteria 11280
292 Ga0207648_10049475 3300026089 Bacteria 3678
293 Ga0207648_10275840 3300026089 Bacteria 1503
294 Ga0207648_10306410 3300026089 Unclassified 1425
295 Ga0207676_10036336 3300026095 Bacteria 3746
296 Ga0207676_10040224 3300026095 Bacteria 3582
297 Ga0207676_10522001 3300026095 Bacteria 1131
298 Ga0207676_10825868 3300026095 Unclassified 905
299 Ga0207674_10039749 3300026116 Bacteria 4875
300 Ga0207675_100007647 3300026118 Bacteria 10204
301 Ga0207675_100066647 3300026118 Bacteria 3366
302 Ga0207675_100588485 3300026118 Unclassified 1115
303 Ga0207675_100721552 3300026118 Unclassified 1007
304 Ga0207675_100997049 3300026118 Bacteria 856
305 Ga0207675_101147956 3300026118 Unclassified 797
306 Ga0207683_10020009 3300026121 Bacteria 5719
307 Ga0207683_10034547 3300026121 Bacteria 4394
308 Ga0207683_10085565 3300026121 Bacteria 2802
309 Ga0207683_10262968 3300026121 Bacteria 1575
310 Ga0207683_10866887 3300026121 Unclassified 838
311 Ga0207698_10029558 3300026142 Bacteria 3927
312 Ga0207698_10047315 3300026142 Unclassified 3257
313 Ga0207698_10473302 3300026142 Unclassified 1214
314 Ga0207698_10545417 3300026142 Unclassified 1136
315 Ga0268265_10739301 3300028380 Bacteria 954
316 Ga0268265_10806265 3300028380 Unclassified 915
317 Ga0268265_11268831 3300028380 Unclassified 736
318 Ga0268264_10006198 3300028381 Bacteria 10098
319 Ga0268264_10058014 3300028381 Bacteria 3240
320 Ga0268264_10473685 3300028381 Bacteria 1217
321 Ga0265324_10126367 3300029957 Bacteria 868
322 Ga0265328_10028171 3300031239 Bacteria 2103
323 Ga0265320_10065231 3300031240 Bacteria 1728
324 Ga0265331_10015721 3300031250 Bacteria 3989
325 Ga0265316_10247160 3300031344 Unclassified 1311
326 Ga0307509_10035284 3300031507 Bacteria 5491
327 Ga0307508_10000694 3300031616 Bacteria 40289
328 Ga0307508_10105711 3300031616 Unclassified 2413
329 Ga0307507_10327720 3300033179 Bacteria 917
330 Ga0395899_0007117 3300037312 Bacteria 8655
331 Ga0395900_0710536 3300037418 Unclassified 938
332 Ga0395898_0013909 3300037466 Bacteria 8270
333 Ga0395905_0549855 3300037471 Bacteria 1056
334 Ga0395901_0005761 3300038443 Bacteria 12552
335 Ga0436365_0450598 3300039437 Bacteria 38661
336 Ga0436362_0681831 3300039453 Bacteria 676
337 Ga0451791_1093420 3300041451 Bacteria 927
338 Ga0451804_0659079 3300041463 Unclassified 671
339 Ga0451853_1571982 3300041512 Bacteria 738
340 Ga0453684_0008300 3300044712 Bacteria 18697
341 Ga0453684_0712824 3300044712 Bacteria 1089
342 Ga0453684_0730719 3300044712 Bacteria 1073
343 Ga0451576_0160097 3300045051 Bacteria 2349
344 Ga0466967_0229313 3300045976 Bacteria 1768
345 Ga0466967_0684680 3300045976 Bacteria 1015
346 Ga0495594_0193142 3300046499 Unclassified 1160
347 Ga0495598_0050080 3300046537 Unclassified 1254
348 Ga0495621_0045868 3300046539 Bacteria 1549
349 Ga0495633_0396482 3300046558 Bacteria 624
350 Ga0495667_0341848 3300046559 Bacteria 946
351 Ga0495668_0001096 3300046616 Bacteria 28039
352 Ga0495659_0242823 3300046664 Bacteria 749
353 Ga0495588_0429018 3300046674 Bacteria 694
354 Ga0495670_0275201 3300046691 Bacteria 900
355 Ga0495674_0780271 3300047319 Unclassified 745
356 Ga0495686_0008111 3300047472 Bacteria 7767
357 Ga0496124_0039021 3300048927 Bacteria 4119
358 Ga0501034_0007543 3300049571 Bacteria 11573
359 Ga0501034_0055320 3300049571 Unclassified 3993
360 Ga0501034_0340930 3300049571 Bacteria 1429
361 Ga0501034_0412282 3300049571 Unclassified 1273
362 Ga0501070_0490098 3300049586 Bacteria 988
363 Ga0501269_002266 3300049766 Bacteria 2388
364 Ga0501035_0031625 3300049822 Bacteria 4820
365 Ga0501035_0261774 3300049822 Unclassified 1466
366 Ga0501044_0026045 3300049823 Bacteria 6194
367 Ga0501044_0609641 3300049823 Bacteria 984
368 nmdc:mga0k408_315174_c1 3300050493 Bacteria 933
369 nmdc:mga0k408_40414_c1 3300050493 Bacteria 2684
370 nmdc:mga05p37_279856_c1 3300050507 Unclassified 1990
371 nmdc:mga09592_397459_c1 3300050508 Bacteria 1191
372 nmdc:mga09592_79056_c1 3300050508 Bacteria 2799
373 nmdc:mga09592_945896_c1 3300050508 Bacteria 722
374 nmdc:mga09592_9597_c1 3300050508 Bacteria 7862
375 nmdc:mga06r32_77047_c1 3300050510 Unclassified 3238
376 nmdc:mga08y16_140864_c1 3300050511 Unclassified 2507
377 nmdc:mga08y16_50064_c1 3300050511 Unclassified 4371
378 Ga0500556_0019116 3300053104 Bacteria 2173
379 Ga0500559_0172154 3300053136 Bacteria 1018
380 Ga0500616_0003979 3300053153 Bacteria 10817
381 Ga0500627_0000843 3300053158 Bacteria 8198

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2896109856 2896113025 163
2 3300003316 rootH1_10155573 rootH1_101555732 168
3 3300003322 rootL2_10143996 rootL2_101439967 168
4 3300003322 rootL2_10235023 rootL2_102350232 168
5 3300003323 rootH1_10099088 rootH1_100990884 168
6 3300003323 rootH1_10341299 rootH1_103412992 168
7 3300003354 JGI25160J50197_1000375 JGI25160J50197_100037511 168
8 3300005289 Ga0065704_10129942 Ga0065704_101299422 168
9 3300005289 Ga0065704_10148615 Ga0065704_101486152 168
10 3300005290 Ga0065712_10005258 Ga0065712_100052582 168
11 3300005293 Ga0065715_10009378 Ga0065715_100093782 168
12 3300005327 Ga0070658_10044331 Ga0070658_100443312 168
13 3300005327 Ga0070658_10500852 Ga0070658_105008521 168
14 3300005329 Ga0070683_100225861 Ga0070683_1002258612 168
15 3300005331 Ga0070670_100235985 Ga0070670_1002359852 168
16 3300005331 Ga0070670_100399113 Ga0070670_1003991132 168
17 3300005331 Ga0070670_101096938 Ga0070670_1010969381 168
18 3300005333 Ga0070677_10073470 Ga0070677_100734701 168
19 3300005333 Ga0070677_10473170 Ga0070677_104731701 168
20 3300005334 Ga0068869_100008852 Ga0068869_1000088523 168
21 3300005334 Ga0068869_100028501 Ga0068869_1000285012 168
22 3300005335 Ga0070666_10000030 Ga0070666_1000003073 168
23 3300005335 Ga0070666_10038104 Ga0070666_100381042 168
24 3300005336 Ga0070680_100072919 Ga0070680_1000729192 168
25 3300005337 Ga0070682_100458933 Ga0070682_1004589332 168
26 3300005338 Ga0068868_100785993 Ga0068868_1007859932 168
27 3300005338 Ga0068868_101171457 Ga0068868_1011714571 168
28 3300005338 Ga0068868_101416108 Ga0068868_1014161081 168
29 3300005339 Ga0070660_100044144 Ga0070660_1000441443 168
30 3300005340 Ga0070689_100025280 Ga0070689_1000252802 168
31 3300005340 Ga0070689_100838092 Ga0070689_1008380921 168
32 3300005341 Ga0070691_10386405 Ga0070691_103864052 168
33 3300005343 Ga0070687_100651226 Ga0070687_1006512262 168
34 3300005347 Ga0070668_100624483 Ga0070668_1006244831 168
35 3300005347 Ga0070668_100702210 Ga0070668_1007022102 168
36 3300005353 Ga0070669_100045943 Ga0070669_1000459432 168
37 3300005354 Ga0070675_100049305 Ga0070675_1000493052 168
38 3300005354 Ga0070675_100286458 Ga0070675_1002864582 168
39 3300005354 Ga0070675_100357209 Ga0070675_1003572092 168
40 3300005354 Ga0070675_100969928 Ga0070675_1009699281 168
41 3300005355 Ga0070671_100011034 Ga0070671_1000110344 168
42 3300005355 Ga0070671_100053047 Ga0070671_1000530473 168
43 3300005355 Ga0070671_100270163 Ga0070671_1002701632 168
44 3300005355 Ga0070671_100432406 Ga0070671_1004324062 168
45 3300005356 Ga0070674_100031069 Ga0070674_1000310692 168
46 3300005356 Ga0070674_100176947 Ga0070674_1001769472 168
47 3300005356 Ga0070674_100350752 Ga0070674_1003507522 168
48 3300005364 Ga0070673_100257055 Ga0070673_1002570552 168
49 3300005364 Ga0070673_100353600 Ga0070673_1003536001 168
50 3300005364 Ga0070673_101753857 Ga0070673_1017538571 168
51 3300005365 Ga0070688_100100349 Ga0070688_1001003491 168
52 3300005365 Ga0070688_100287045 Ga0070688_1002870452 168
53 3300005365 Ga0070688_100585145 Ga0070688_1005851451 168
54 3300005366 Ga0070659_100019085 Ga0070659_1000190852 168
55 3300005367 Ga0070667_100079582 Ga0070667_1000795822 168
56 3300005367 Ga0070667_100139426 Ga0070667_1001394263 168
57 3300005367 Ga0070667_100218207 Ga0070667_1002182072 168
58 3300005367 Ga0070667_100348944 Ga0070667_1003489442 168
59 3300005367 Ga0070667_100970260 Ga0070667_1009702602 168
60 3300005438 Ga0070701_10082585 Ga0070701_100825852 168
61 3300005441 Ga0070700_100080218 Ga0070700_1000802182 168
62 3300005441 Ga0070700_100135710 Ga0070700_1001357102 168
63 3300005441 Ga0070700_100143991 Ga0070700_1001439912 168
64 3300005455 Ga0070663_100770927 Ga0070663_1007709272 168
65 3300005456 Ga0070678_100035313 Ga0070678_1000353132 168
66 3300005456 Ga0070678_100129425 Ga0070678_1001294252 168
67 3300005456 Ga0070678_100258667 Ga0070678_1002586672 168
68 3300005456 Ga0070678_100350833 Ga0070678_1003508332 168
69 3300005459 Ga0068867_100126477 Ga0068867_1001264772 168
70 3300005459 Ga0068867_100993120 Ga0068867_1009931201 168
71 3300005459 Ga0068867_101237904 Ga0068867_1012379041 168
72 3300005466 Ga0070685_10034877 Ga0070685_100348771 168
73 3300005467 Ga0070706_101214017 Ga0070706_1012140171 168
74 3300005468 Ga0070707_100351288 Ga0070707_1003512882 168
75 3300005471 Ga0070698_100001103 Ga0070698_10000110326 168
76 3300005471 Ga0070698_100021829 Ga0070698_1000218295 168
77 3300005471 Ga0070698_100026571 Ga0070698_1000265712 168
78 3300005518 Ga0070699_100108261 Ga0070699_1001082612 168
79 3300005530 Ga0070679_100219445 Ga0070679_1002194453 168
80 3300005539 Ga0068853_101116427 Ga0068853_1011164271 168
81 3300005543 Ga0070672_100106896 Ga0070672_1001068962 168
82 3300005543 Ga0070672_100366086 Ga0070672_1003660862 168
83 3300005544 Ga0070686_100003077 Ga0070686_10000307711 168
84 3300005548 Ga0070665_100076488 Ga0070665_1000764884 168
85 3300005563 Ga0068855_100000795 Ga0068855_10000079537 168
86 3300005564 Ga0070664_100012885 Ga0070664_1000128858 168
87 3300005577 Ga0068857_100039491 Ga0068857_1000394913 168
88 3300005577 Ga0068857_100281752 Ga0068857_1002817522 168
89 3300005616 Ga0068852_100038137 Ga0068852_1000381372 168
90 3300005616 Ga0068852_100105668 Ga0068852_1001056682 168
91 3300005616 Ga0068852_101420752 Ga0068852_1014207521 168
92 3300005617 Ga0068859_100000003 Ga0068859_100000003413 168
93 3300005617 Ga0068859_100197215 Ga0068859_1001972152 168
94 3300005617 Ga0068859_100207189 Ga0068859_1002071892 168
95 3300005617 Ga0068859_100260373 Ga0068859_1002603732 168
96 3300005617 Ga0068859_100296013 Ga0068859_1002960132 168
97 3300005618 Ga0068864_100020481 Ga0068864_1000204814 168
98 3300005618 Ga0068864_100082551 Ga0068864_1000825512 168
99 3300005618 Ga0068864_100390300 Ga0068864_1003903002 168
100 3300005718 Ga0068866_10049163 Ga0068866_100491631 168
101 3300005718 Ga0068866_10106289 Ga0068866_101062892 168
102 3300005718 Ga0068866_10198682 Ga0068866_101986822 168
103 3300005718 Ga0068866_10578021 Ga0068866_105780212 168
104 3300005719 Ga0068861_100003315 Ga0068861_1000033153 168
105 3300005719 Ga0068861_100027557 Ga0068861_1000275572 168
106 3300005719 Ga0068861_100424027 Ga0068861_1004240272 168
107 3300005719 Ga0068861_101021232 Ga0068861_1010212321 168
108 3300005834 Ga0068851_10007506 Ga0068851_100075064 168
109 3300005834 Ga0068851_10249387 Ga0068851_102493872 168
110 3300005834 Ga0068851_10551927 Ga0068851_105519271 168
111 3300005840 Ga0068870_10013805 Ga0068870_100138052 168
112 3300005840 Ga0068870_10243604 Ga0068870_102436041 168
113 3300005841 Ga0068863_100004042 Ga0068863_10000404210 168
114 3300005841 Ga0068863_100049408 Ga0068863_1000494082 168
115 3300005841 Ga0068863_100062650 Ga0068863_1000626501 168
116 3300005841 Ga0068863_100137939 Ga0068863_1001379392 168
117 3300005842 Ga0068858_100012504 Ga0068858_1000125045 168
118 3300005842 Ga0068858_100425104 Ga0068858_1004251042 168
119 3300005843 Ga0068860_100004265 Ga0068860_1000042656 168
120 3300005843 Ga0068860_100237123 Ga0068860_1002371232 168
121 3300005843 Ga0068860_100506399 Ga0068860_1005063992 168
122 3300005844 Ga0068862_100595538 Ga0068862_1005955382 168
123 3300005937 Ga0081455_10255763 Ga0081455_102557632 168
124 3300006195 Ga0075366_10019670 Ga0075366_100196702 168
125 3300006195 Ga0075366_10299129 Ga0075366_102991292 168
126 3300006237 Ga0097621_100000352 Ga0097621_10000035231 168
127 3300006237 Ga0097621_100195915 Ga0097621_1001959152 168
128 3300006358 Ga0068871_100073855 Ga0068871_1000738551 168
129 3300006358 Ga0068871_100253215 Ga0068871_1002532152 168
130 3300006844 Ga0075428_100023526 Ga0075428_1000235262 168
131 3300006844 Ga0075428_100093656 Ga0075428_1000936562 168
132 3300006847 Ga0075431_100153606 Ga0075431_1001536062 168
133 3300006880 Ga0075429_100015805 Ga0075429_1000158052 168
134 3300006880 Ga0075429_100046759 Ga0075429_1000467592 168
135 3300006931 Ga0097620_100000003 Ga0097620_100000003413 168
136 3300006931 Ga0097620_100197203 Ga0097620_1001972031 168
137 3300006931 Ga0097620_100207189 Ga0097620_1002071892 168
138 3300006931 Ga0097620_100260388 Ga0097620_1002603882 168
139 3300006931 Ga0097620_100296012 Ga0097620_1002960122 168
140 3300009094 Ga0111539_10054803 Ga0111539_100548034 168
141 3300009094 Ga0111539_11113384 Ga0111539_111133841 168
142 3300009094 Ga0111539_11786489 Ga0111539_117864891 168
143 3300009098 Ga0105245_10651770 Ga0105245_106517702 168
144 3300009101 Ga0105247_10088179 Ga0105247_100881792 168
145 3300009101 Ga0105247_10122219 Ga0105247_101222192 168
146 3300009147 Ga0114129_10204970 Ga0114129_102049702 168
147 3300009174 Ga0105241_10000831 Ga0105241_1000083113 168
148 3300009174 Ga0105241_10900763 Ga0105241_109007632 168
149 3300009176 Ga0105242_10019535 Ga0105242_100195352 168
150 3300009176 Ga0105242_10165544 Ga0105242_101655442 168
151 3300009176 Ga0105242_10197886 Ga0105242_101978862 168
152 3300009176 Ga0105242_10301866 Ga0105242_103018662 168
153 3300009176 Ga0105242_10858929 Ga0105242_108589291 168
154 3300009177 Ga0105248_10081795 Ga0105248_100817954 168
155 3300009177 Ga0105248_10297966 Ga0105248_102979662 168
156 3300009545 Ga0105237_10110501 Ga0105237_101105012 168
157 3300009553 Ga0105249_10002081 Ga0105249_100020812 168
158 3300009553 Ga0105249_10006036 Ga0105249_100060363 168
159 3300009553 Ga0105249_10260583 Ga0105249_102605832 168
160 3300009553 Ga0105249_10357206 Ga0105249_103572062 168
161 3300010375 Ga0105239_10121267 Ga0105239_101212672 168
162 3300011119 Ga0105246_10035861 Ga0105246_100358613 168
163 3300011119 Ga0105246_10080104 Ga0105246_100801042 168
164 3300011119 Ga0105246_10551842 Ga0105246_105518421 168
165 3300013100 Ga0157373_10142702 Ga0157373_101427022 168
166 3300013102 Ga0157371_10000668 Ga0157371_100006683 168
167 3300013102 Ga0157371_10026811 Ga0157371_100268112 168
168 3300013104 Ga0157370_10026304 Ga0157370_100263042 168
169 3300013104 Ga0157370_10034600 Ga0157370_100346005 168
170 3300013104 Ga0157370_10281116 Ga0157370_102811162 168
171 3300013296 Ga0157374_10154610 Ga0157374_101546102 168
172 3300013296 Ga0157374_11210502 Ga0157374_112105022 168
173 3300013297 Ga0157378_10024140 Ga0157378_100241404 168
174 3300013297 Ga0157378_10087806 Ga0157378_100878062 168
175 3300013297 Ga0157378_10109434 Ga0157378_101094342 168
176 3300013297 Ga0157378_10470642 Ga0157378_104706421 168
177 3300013297 Ga0157378_11770002 Ga0157378_117700021 168
178 3300013306 Ga0163162_10000237 Ga0163162_1000023728 168
179 3300013306 Ga0163162_10000824 Ga0163162_1000082424 168
180 3300013306 Ga0163162_10618258 Ga0163162_106182582 168
181 3300013306 Ga0163162_11955486 Ga0163162_119554861 168
182 3300013307 Ga0157372_10031301 Ga0157372_100313015 168
183 3300013307 Ga0157372_10035710 Ga0157372_100357103 168
184 3300013307 Ga0157372_10164190 Ga0157372_101641902 168
185 3300013307 Ga0157372_10200983 Ga0157372_102009832 168
186 3300013307 Ga0157372_10305261 Ga0157372_103052612 168
187 3300013307 Ga0157372_10662078 Ga0157372_106620782 168
188 3300013308 Ga0157375_10000599 Ga0157375_1000059932 168
189 3300013308 Ga0157375_10032249 Ga0157375_100322493 168
190 3300013308 Ga0157375_10152426 Ga0157375_101524261 168
191 3300013308 Ga0157375_11458587 Ga0157375_114585871 168
192 3300014325 Ga0163163_10001228 Ga0163163_100012282 168
193 3300014325 Ga0163163_10071388 Ga0163163_100713883 168
194 3300014325 Ga0163163_10611061 Ga0163163_106110612 168
195 3300014325 Ga0163163_11348649 Ga0163163_113486491 168
196 3300014325 Ga0163163_11934140 Ga0163163_119341401 168
197 3300014326 Ga0157380_10146760 Ga0157380_101467602 168
198 3300014326 Ga0157380_10233164 Ga0157380_102331641 168
199 3300014326 Ga0157380_10775248 Ga0157380_107752482 168
200 3300014326 Ga0157380_10835483 Ga0157380_108354831 168
201 3300014326 Ga0157380_11290491 Ga0157380_112904911 168
202 3300014745 Ga0157377_10008371 Ga0157377_100083712 168
203 3300014745 Ga0157377_10098627 Ga0157377_100986272 168
204 3300014745 Ga0157377_10239656 Ga0157377_102396562 168
205 3300014745 Ga0157377_10406739 Ga0157377_104067391 168
206 3300014745 Ga0157377_10506919 Ga0157377_105069191 168
207 3300014968 Ga0157379_10002064 Ga0157379_1000206410 168
208 3300014968 Ga0157379_10270584 Ga0157379_102705842 168
209 3300014969 Ga0157376_10000971 Ga0157376_1000097116 168
210 3300014969 Ga0157376_10093677 Ga0157376_100936772 168
211 3300014969 Ga0157376_10239270 Ga0157376_102392702 168
212 3300017792 Ga0163161_10006338 Ga0163161_100063385 168
213 3300017792 Ga0163161_10428261 Ga0163161_104282612 168
214 3300025271 Ga0207666_1017641 Ga0207666_10176412 168
215 3300025302 Ga0207426_1000026 Ga0207426_1000026273 168
216 3300025321 Ga0207656_10222273 Ga0207656_102222731 168
217 3300025893 Ga0207682_10206617 Ga0207682_102066171 168
218 3300025899 Ga0207642_10027537 Ga0207642_100275373 168
219 3300025899 Ga0207642_10028087 Ga0207642_100280872 168
220 3300025900 Ga0207710_10015100 Ga0207710_100151003 168
221 3300025900 Ga0207710_10301194 Ga0207710_103011942 168
222 3300025901 Ga0207688_10187056 Ga0207688_101870562 168
223 3300025903 Ga0207680_10000014 Ga0207680_1000001433 168
224 3300025903 Ga0207680_10040002 Ga0207680_100400023 168
225 3300025904 Ga0207647_10067188 Ga0207647_100671881 168
226 3300025908 Ga0207643_10003843 Ga0207643_100038432 168
227 3300025908 Ga0207643_10183097 Ga0207643_101830972 168
228 3300025908 Ga0207643_10240752 Ga0207643_102407522 168
229 3300025909 Ga0207705_10015886 Ga0207705_100158863 168
230 3300025910 Ga0207684_10336485 Ga0207684_103364852 168
231 3300025911 Ga0207654_10002088 Ga0207654_100020885 168
232 3300025914 Ga0207671_10007006 Ga0207671_100070066 168
233 3300025917 Ga0207660_10039630 Ga0207660_100396302 168
234 3300025918 Ga0207662_10002816 Ga0207662_100028164 168
235 3300025918 Ga0207662_10787152 Ga0207662_107871521 168
236 3300025919 Ga0207657_10040339 Ga0207657_100403392 168
237 3300025921 Ga0207652_10037515 Ga0207652_100375152 168
238 3300025921 Ga0207652_10359222 Ga0207652_103592222 168
239 3300025922 Ga0207646_10351148 Ga0207646_103511482 168
240 3300025923 Ga0207681_10303393 Ga0207681_103033931 168
241 3300025923 Ga0207681_10490300 Ga0207681_104903002 168
242 3300025925 Ga0207650_10196716 Ga0207650_101967162 168
243 3300025925 Ga0207650_10611076 Ga0207650_106110761 168
244 3300025926 Ga0207659_10743079 Ga0207659_107430792 168
245 3300025931 Ga0207644_10315327 Ga0207644_103153272 168
246 3300025931 Ga0207644_10972538 Ga0207644_109725381 168
247 3300025933 Ga0207706_10130361 Ga0207706_101303612 168
248 3300025934 Ga0207686_10000372 Ga0207686_1000037217 168
249 3300025936 Ga0207670_10123207 Ga0207670_101232072 168
250 3300025936 Ga0207670_10148166 Ga0207670_101481662 168
251 3300025937 Ga0207669_10054518 Ga0207669_100545182 168
252 3300025937 Ga0207669_10149321 Ga0207669_101493212 168
253 3300025937 Ga0207669_10500443 Ga0207669_105004432 168
254 3300025938 Ga0207704_10378858 Ga0207704_103788581 168
255 3300025940 Ga0207691_10021904 Ga0207691_100219043 168
256 3300025940 Ga0207691_10045055 Ga0207691_100450553 168
257 3300025940 Ga0207691_10192290 Ga0207691_101922902 168
258 3300025941 Ga0207711_10181115 Ga0207711_101811152 168
259 3300025942 Ga0207689_10003396 Ga0207689_100033963 168
260 3300025942 Ga0207689_10027798 Ga0207689_100277982 168
261 3300025942 Ga0207689_10098140 Ga0207689_100981402 168
262 3300025942 Ga0207689_10169692 Ga0207689_101696921 168
263 3300025944 Ga0207661_10627992 Ga0207661_106279921 168
264 3300025944 Ga0207661_11374901 Ga0207661_113749011 168
265 3300025945 Ga0207679_10013776 Ga0207679_100137762 168
266 3300025949 Ga0207667_10614351 Ga0207667_106143512 168
267 3300025960 Ga0207651_10027740 Ga0207651_100277402 168
268 3300025960 Ga0207651_10314287 Ga0207651_103142872 168
269 3300025960 Ga0207651_11049364 Ga0207651_110493642 168
270 3300025960 Ga0207651_11207752 Ga0207651_112077521 168
271 3300025961 Ga0207712_10000874 Ga0207712_100008744 168
272 3300025961 Ga0207712_10076595 Ga0207712_100765952 168
273 3300025961 Ga0207712_10101541 Ga0207712_101015412 168
274 3300025961 Ga0207712_10238134 Ga0207712_102381341 168
275 3300025961 Ga0207712_10380291 Ga0207712_103802912 168
276 3300025972 Ga0207668_10598353 Ga0207668_105983531 168
277 3300025972 Ga0207668_10770350 Ga0207668_107703501 168
278 3300025986 Ga0207658_10298818 Ga0207658_102988182 168
279 3300025986 Ga0207658_10357963 Ga0207658_103579631 168
280 3300026023 Ga0207677_10767293 Ga0207677_107672932 168
281 3300026023 Ga0207677_10777438 Ga0207677_107774382 168
282 3300026035 Ga0207703_10009595 Ga0207703_100095954 168
283 3300026041 Ga0207639_11076188 Ga0207639_110761881 168
284 3300026075 Ga0207708_10121818 Ga0207708_101218182 168
285 3300026075 Ga0207708_10192006 Ga0207708_101920062 168
286 3300026075 Ga0207708_10208980 Ga0207708_102089802 168
287 3300026088 Ga0207641_10000015 Ga0207641_10000015125 168
288 3300026088 Ga0207641_10000088 Ga0207641_100000882 168
289 3300026088 Ga0207641_10021048 Ga0207641_100210482 168
290 3300026088 Ga0207641_10346110 Ga0207641_103461101 168
291 3300026088 Ga0207641_11027152 Ga0207641_110271522 168
292 3300026089 Ga0207648_10006875 Ga0207648_1000687511 168
293 3300026089 Ga0207648_10049475 Ga0207648_100494751 168
294 3300026089 Ga0207648_10275840 Ga0207648_102758402 168
295 3300026089 Ga0207648_10306410 Ga0207648_103064101 168
296 3300026095 Ga0207676_10036336 Ga0207676_100363362 168
297 3300026095 Ga0207676_10040224 Ga0207676_100402243 168
298 3300026095 Ga0207676_10522001 Ga0207676_105220011 168
299 3300026095 Ga0207676_10825868 Ga0207676_108258682 168
300 3300026116 Ga0207674_10039749 Ga0207674_100397492 168
301 3300026118 Ga0207675_100007647 Ga0207675_1000076474 168
302 3300026118 Ga0207675_100066647 Ga0207675_1000666472 168
303 3300026118 Ga0207675_100588485 Ga0207675_1005884851 168
304 3300026118 Ga0207675_100721552 Ga0207675_1007215522 168
305 3300026118 Ga0207675_100997049 Ga0207675_1009970491 168
306 3300026118 Ga0207675_101147956 Ga0207675_1011479561 168
307 3300026121 Ga0207683_10020009 Ga0207683_100200095 168
308 3300026121 Ga0207683_10034547 Ga0207683_100345472 168
309 3300026121 Ga0207683_10085565 Ga0207683_100855652 168
310 3300026121 Ga0207683_10262968 Ga0207683_102629682 168
311 3300026121 Ga0207683_10866887 Ga0207683_108668871 168
312 3300026142 Ga0207698_10029558 Ga0207698_100295583 168
313 3300026142 Ga0207698_10047315 Ga0207698_100473151 168
314 3300026142 Ga0207698_10473302 Ga0207698_104733022 168
315 3300026142 Ga0207698_10545417 Ga0207698_105454171 168
316 3300028380 Ga0268265_10739301 Ga0268265_107393011 168
317 3300028380 Ga0268265_10806265 Ga0268265_108062652 168
318 3300028380 Ga0268265_11268831 Ga0268265_112688312 168
319 3300028381 Ga0268264_10006198 Ga0268264_100061984 168
320 3300028381 Ga0268264_10058014 Ga0268264_100580142 168
321 3300028381 Ga0268264_10473685 Ga0268264_104736851 168
322 3300029957 Ga0265324_10126367 Ga0265324_101263672 168
323 3300031239 Ga0265328_10028171 Ga0265328_100281712 168
324 3300031240 Ga0265320_10065231 Ga0265320_100652312 168
325 3300031250 Ga0265331_10015721 Ga0265331_100157211 168
326 3300031344 Ga0265316_10247160 Ga0265316_102471602 168
327 3300031507 Ga0307509_10035284 Ga0307509_100352843 168
328 3300031616 Ga0307508_10000694 Ga0307508_100006946 168
329 3300031616 Ga0307508_10105711 Ga0307508_101057112 168
330 3300033179 Ga0307507_10327720 Ga0307507_103277201 168
331 3300037312 Ga0395899_0007117 Ga0395899_0007117_230_739 168
332 3300037418 Ga0395900_0710536 Ga0395900_0710536_248_754 168
333 3300037466 Ga0395898_0013909 Ga0395898_0013909_7071_7580 168
334 3300037471 Ga0395905_0549855 Ga0395905_0549855_281_790 168
335 3300038443 Ga0395901_0005761 Ga0395901_0005761_8181_8690 168
336 3300039437 Ga0436365_0450598 Ga0436365_0450598_37956_38462 168
337 3300039453 Ga0436362_0681831 Ga0436362_0681831_79_585 168
338 3300041451 Ga0451791_1093420 Ga0451791_1093420_86_592 168
339 3300041463 Ga0451804_0659079 Ga0451804_0659079_45_551 168
340 3300041512 Ga0451853_1571982 Ga0451853_1571982_152_670 168
341 3300044712 Ga0453684_0008300 Ga0453684_0008300_7937_8488 168
342 3300044712 Ga0453684_0712824 Ga0453684_0712824_113_619 168
343 3300044712 Ga0453684_0730719 Ga0453684_0730719_300_818 168
344 3300045051 Ga0451576_0160097 Ga0451576_0160097_1675_2226 168
345 3300045976 Ga0466967_0229313 Ga0466967_0229313_1206_1712 168
346 3300045976 Ga0466967_0684680 Ga0466967_0684680_388_894 168
347 3300046499 Ga0495594_0193142 Ga0495594_0193142_186_695 168
348 3300046537 Ga0495598_0050080 Ga0495598_0050080_590_1099 168
349 3300046539 Ga0495621_0045868 Ga0495621_0045868_947_1456 168
350 3300046558 Ga0495633_0396482 Ga0495633_0396482_80_589 168
351 3300046559 Ga0495667_0341848 Ga0495667_0341848_361_867 168
352 3300046616 Ga0495668_0001096 Ga0495668_0001096_10687_11196 168
353 3300046664 Ga0495659_0242823 Ga0495659_0242823_216_722 168
354 3300046674 Ga0495588_0429018 Ga0495588_0429018_143_652 168
355 3300046691 Ga0495670_0275201 Ga0495670_0275201_175_684 168
356 3300047319 Ga0495674_0780271 Ga0495674_0780271_83_589 168
357 3300047472 Ga0495686_0008111 Ga0495686_0008111_5201_5707 168
358 3300048927 Ga0496124_0039021 Ga0496124_0039021_323_829 168
359 3300049571 Ga0501034_0007543 Ga0501034_0007543_2226_2732 168
360 3300049571 Ga0501034_0055320 Ga0501034_0055320_2226_2732 168
361 3300049571 Ga0501034_0340930 Ga0501034_0340930_812_1333 168
362 3300049571 Ga0501034_0412282 Ga0501034_0412282_401_907 168
363 3300049586 Ga0501070_0490098 Ga0501070_0490098_241_747 168
364 3300049766 Ga0501269_002266 Ga0501269_002266_140_649 168
365 3300049822 Ga0501035_0031625 Ga0501035_0031625_523_1029 168
366 3300049822 Ga0501035_0261774 Ga0501035_0261774_417_923 168
367 3300049823 Ga0501044_0026045 Ga0501044_0026045_4127_4633 168
368 3300049823 Ga0501044_0609641 Ga0501044_0609641_372_878 168
369 3300050493 nmdc:mga0k408_315174_c1 nmdc:mga0k408_315174_c1_259_774 168
370 3300050493 nmdc:mga0k408_40414_c1 nmdc:mga0k408_40414_c1_1320_1826 168
371 3300050507 nmdc:mga05p37_279856_c1 nmdc:mga05p37_279856_c1_550_1059 168
372 3300050508 nmdc:mga09592_397459_c1 nmdc:mga09592_397459_c1_492_1001 168
373 3300050508 nmdc:mga09592_79056_c1 nmdc:mga09592_79056_c1_1191_1697 168
374 3300050508 nmdc:mga09592_945896_c1 nmdc:mga09592_945896_c1_189_698 168
375 3300050508 nmdc:mga09592_9597_c1 nmdc:mga09592_9597_c1_4790_5299 168
376 3300050510 nmdc:mga06r32_77047_c1 nmdc:mga06r32_77047_c1_2662_3171 168
377 3300050511 nmdc:mga08y16_140864_c1 nmdc:mga08y16_140864_c1_1612_2121 168
378 3300050511 nmdc:mga08y16_50064_c1 nmdc:mga08y16_50064_c1_1010_1516 168
379 3300053104 Ga0500556_0019116 Ga0500556_0019116_690_1199 168
380 3300053136 Ga0500559_0172154 Ga0500559_0172154_301_807 168
381 3300053153 Ga0500616_0003979 Ga0500616_0003979_1813_2322 168
382 3300053158 Ga0500627_0000843 Ga0500627_0000843_6069_6578 168

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10652

DUF2480

Protein of unknown function (DUF2480)

44

208

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
7zrz-assembly1.cif.gz_BP4 structure of the human trna splicing endonuclease defines substrate recognition 0.6411 125 168
1rgi-assembly1.cif.gz_A crystal structure of gelsolin domains g1-g3 bound to actin 0.5548 36 97
4lu9-assembly1.cif.gz_C crystal structure of e.coli sbcd at 2.5 angstrom resolution 0.5544 25 96
2q0x-assembly1.cif.gz_B alpha/beta hydrolase fold protein of unknown function 0.5175 49 113
4czh-assembly1.cif.gz_A c. crescentus mreb, single filament, adp, mp265 inhibitor 0.4849 40 100
ID Description Score Start End Superfamily
2gjwB03 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.6013 125 168 3.40.1350.10
af_I1LMG0_20_152_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.5517 43 98 3.30.420.40
af_O18391_39_325_3.40.50.1820 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Alpha/Beta hydrolase fold, catalytic domain 0.5517 62 97 3.40.50.1820
af_A0A1D8PCJ9_329_593_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.5294 46 101 3.30.420.40
af_A0A7I2V3D3_1_121_3.30.420.40 Alpha Beta;2-Layer Sandwich;Nucleotidyltransferase; domain 5;ATPase, nucleotide binding domain 0.5152 36 98 3.30.420.40
ID Description Score Start End GO Terms
AF-A0A358G5C4-F1-model_v4 deleted 0.9816 42 97
AF-A0A520I116-F1-model_v4 DUF2480 family protein 0.9722 33 168
AF-A0A7Y1VN74-F1-model_v4 DUF2480 family protein 0.9649 37 168
AF-A0A520I116-F1-model_v4 DUF2480 family protein 0.9584 33 168
AF-A0A3D6EVN4-F1-model_v4 DUF2480 family protein 0.9564 1 168

Feature Viewer

pLDDT pTM Quality
90.21 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map