F429192

General Info

Members Datasets Scaffolds Average Seq Length
382 223 764 230

Family's Representative Sequence

Representative Sequence 3300005356|Ga0070674_100127352|Ga0070674_1001273522
Length 255
Sequence MRLPPVTAIDRRDTHRLVPSRYSPRGESVLIRIADPGDDAHLAAIFELDGATNDRLLAERSLLPGIGPDELVFAVPLASVINGAFCHAHPLGSRFAGPDRGAWYAGFEIETAHAEVAFHKSVELAEIGSPDESVTYDDYQADFAGGFHDIREPAGWTSCLSPTSYVASQTLAARLLDAGALGVVYPSVRHTGGTCLACFRPALVGRVRRGGTWRFTWEGGEGPRIEAEADVGRRPSRGAAADRSRARGRQDRRGN

Samples

Sample ID Description Type Environment
1 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
2 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
10 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
11 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
12 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
13 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
14 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
17 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
22 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
23 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
24 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
25 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
26 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
27 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
30 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
31 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
32 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
36 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
37 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
38 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
39 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
40 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
41 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
42 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
45 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
46 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
47 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
53 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
54 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
55 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
56 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
57 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
59 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
62 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
69 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
70 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
71 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
108 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
109 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
111 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
112 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
113 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
114 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
115 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
116 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
117 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
118 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
119 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
120 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
121 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
122 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
123 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
124 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
125 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
126 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
127 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
128 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
129 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
130 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
131 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
132 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
133 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
134 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
135 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
136 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
137 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
140 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
141 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
142 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
143 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
144 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
145 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
149 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
150 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
151 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
152 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
153 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
154 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
155 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
156 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
159 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
160 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
161 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
162 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
163 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
164 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
165 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
166 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
167 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
168 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
169 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
170 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
171 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
172 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
173 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
174 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
175 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
176 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
179 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
180 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
181 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
182 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
184 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
185 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
186 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
187 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
188 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
189 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
190 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
191 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
192 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
193 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
194 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
195 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
196 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
197 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
200 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
201 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
202 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
203 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
204 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
205 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
206 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
207 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
208 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
209 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
210 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
211 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
212 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
213 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
214 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
215 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
216 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
217 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
218 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
219 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
220 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
221 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
222 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
223 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.38
Nodule 0
Rhizoplane 0.52
Rhizosphere 89.01
Stem 0
Stem Tuber 0
Unclassified 17.28

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070674_100127352 3300005356 Bacteria 1894
2 Ga0065712_10166916 3300005290 Unclassified 1267
3 Ga0065715_10342365 3300005293 Unclassified 965
4 Ga0070683_100362067 3300005329 Bacteria 1381
5 Ga0070670_100001800 3300005331 Bacteria 17464
6 Ga0070670_100069888 3300005331 Bacteria 3014
7 Ga0070677_10039924 3300005333 Bacteria 1844
8 Ga0068868_100015622 3300005338 Bacteria 5621
9 Ga0070689_100039110 3300005340 Bacteria 3631
10 Ga0070687_100316876 3300005343 Unclassified 995
11 Ga0070668_100016729 3300005347 Bacteria 5482
12 Ga0070669_100080462 3300005353 Bacteria 2425
13 Ga0070675_100007447 3300005354 Bacteria 8455
14 Ga0070675_100142935 3300005354 Bacteria 2046
15 Ga0070673_100071273 3300005364 Bacteria 2792
16 Ga0070688_100044370 3300005365 Bacteria 2744
17 Ga0070667_100184018 3300005367 Unclassified 1848
18 Ga0070713_100308923 3300005436 Bacteria 1458
19 Ga0070708_100424001 3300005445 Unclassified 1255
20 Ga0070663_100137931 3300005455 Bacteria 1859
21 Ga0070678_100077758 3300005456 Unclassified 2504
22 Ga0070678_100305647 3300005456 Bacteria 1353
23 Ga0070662_100245502 3300005457 Bacteria 1437
24 Ga0070681_10162609 3300005458 Bacteria 2156
25 Ga0070706_100004442 3300005467 Bacteria 13541
26 Ga0070707_100033635 3300005468 Bacteria 4887
27 Ga0070707_100176225 3300005468 Bacteria 2084
28 Ga0070699_100079965 3300005518 Bacteria 2848
29 Ga0070699_100749924 3300005518 Bacteria 893
30 Ga0070679_100007522 3300005530 Bacteria 10188
31 Ga0070684_100346472 3300005535 Bacteria 1366
32 Ga0070672_100001788 3300005543 Bacteria 13451
33 Ga0070672_100037786 3300005543 Bacteria 3685
34 Ga0070672_100251126 3300005543 Unclassified 1490
35 Ga0070665_100039631 3300005548 Bacteria 4737
36 Ga0070704_100226111 3300005549 Bacteria 1524
37 Ga0068855_100072280 3300005563 Bacteria 4010
38 Ga0068859_100063940 3300005617 Unclassified 3712
39 Ga0068864_100006472 3300005618 Bacteria 9595
40 Ga0068864_100096473 3300005618 Bacteria 2617
41 Ga0068860_100308359 3300005843 Bacteria 1552
42 Ga0081455_10048517 3300005937 Unclassified 3668
43 Ga0081540_1023281 3300005983 Bacteria 3627
44 Ga0081539_10000084 3300005985 Bacteria 218801
45 Ga0070717_10022939 3300006028 Bacteria 4939
46 Ga0070717_10211769 3300006028 Bacteria 1701
47 Ga0070717_10432723 3300006028 Bacteria 1184
48 Ga0075365_10103925 3300006038 Bacteria 1947
49 Ga0075368_10018307 3300006042 Bacteria 2631
50 Ga0075368_10048203 3300006042 Bacteria 1688
51 Ga0075368_10055003 3300006042 Bacteria 1586
52 Ga0075368_10128635 3300006042 Bacteria 1052
53 Ga0075363_100014937 3300006048 Bacteria 3807
54 Ga0075363_100101313 3300006048 Bacteria 1594
55 Ga0075363_100120457 3300006048 Bacteria 1465
56 Ga0075364_10027171 3300006051 Bacteria 3654
57 Ga0075364_10174253 3300006051 Bacteria 1454
58 Ga0075362_10000531 3300006177 Bacteria 11088
59 Ga0075367_10095364 3300006178 Bacteria 1814
60 Ga0075367_10214706 3300006178 Bacteria 1203
61 Ga0075367_10262268 3300006178 Bacteria 1085
62 Ga0075366_10005359 3300006195 Bacteria 6951
63 Ga0075366_10020353 3300006195 Bacteria 3850
64 Ga0075370_10132454 3300006353 Bacteria 1455
65 Ga0068871_100170414 3300006358 Unclassified 1866
66 Ga0075428_100012730 3300006844 Bacteria 9357
67 Ga0075428_100213319 3300006844 Bacteria 2086
68 Ga0075428_100273268 3300006844 Bacteria 1818
69 Ga0075428_100670089 3300006844 Unclassified 1106
70 Ga0075430_100074153 3300006846 Unclassified 2853
71 Ga0075430_100147871 3300006846 Bacteria 1957
72 Ga0075431_100239016 3300006847 Unclassified 1848
73 Ga0075431_100460881 3300006847 Bacteria 1266
74 Ga0075431_100596246 3300006847 Unclassified 1089
75 Ga0075433_10064812 3300006852 Bacteria 3203
76 Ga0075434_100000988 3300006871 Bacteria 23007
77 Ga0075434_100231052 3300006871 Bacteria 1869
78 Ga0075434_100373473 3300006871 Bacteria 1447
79 Ga0075429_100135419 3300006880 Bacteria 2156
80 Ga0075436_100010066 3300006914 Bacteria 6469
81 Ga0097620_100063940 3300006931 Unclassified 3712
82 Ga0097620_100749448 3300006931 Bacteria 1065
83 Ga0075435_100099215 3300007076 Unclassified 2412
84 Ga0105240_10100416 3300009093 Bacteria 3521
85 Ga0111539_10064763 3300009094 Bacteria 4323
86 Ga0111539_10305026 3300009094 Bacteria 1853
87 Ga0111539_10485289 3300009094 Bacteria 1439
88 Ga0114129_10008737 3300009147 Bacteria 14446
89 Ga0114129_10010174 3300009147 Bacteria 13410
90 Ga0114129_10018945 3300009147 Bacteria 9803
91 Ga0114129_10043491 3300009147 Bacteria 6319
92 Ga0114129_10174939 3300009147 Bacteria 2924
93 Ga0114129_10403142 3300009147 Bacteria 1802
94 Ga0105248_10013343 3300009177 Bacteria 9044
95 Ga0105248_10135383 3300009177 Bacteria 2779
96 Ga0105249_10000059 3300009553 Bacteria 154729
97 Ga0157373_10034403 3300013100 Unclassified 3639
98 Ga0157369_10002659 3300013105 Bacteria 21329
99 Ga0157369_10101395 3300013105 Bacteria 3067
100 Ga0157374_10015172 3300013296 Bacteria 6757
101 Ga0157378_10136082 3300013297 Unclassified 2278
102 Ga0157372_10045119 3300013307 Unclassified 4888
103 Ga0157375_10013919 3300013308 Bacteria 7173
104 Ga0163163_10019121 3300014325 Bacteria 6428
105 Ga0163163_10426918 3300014325 Bacteria 1385
106 Ga0157376_10028601 3300014969 Bacteria 4432
107 Ga0157376_10738909 3300014969 Bacteria 992
108 Ga0213875_10000001 3300021388 Bacteria 2793540
109 Ga0213875_10087905 3300021388 Bacteria 1449
110 Ga0213871_10000390 3300021441 Bacteria 5804
111 Ga0207682_10101624 3300025893 Unclassified 1258
112 Ga0207688_10282226 3300025901 Unclassified 1012
113 Ga0207699_10376379 3300025906 Bacteria 1007
114 Ga0207643_10032787 3300025908 Bacteria 2903
115 Ga0207643_10262759 3300025908 Bacteria 1066
116 Ga0207684_10130252 3300025910 Bacteria 2159
117 Ga0207707_10001066 3300025912 Bacteria 26278
118 Ga0207695_10011667 3300025913 Bacteria 10620
119 Ga0207657_10600983 3300025919 Bacteria 858
120 Ga0207652_10149150 3300025921 Bacteria 2093
121 Ga0207646_10065548 3300025922 Bacteria 3243
122 Ga0207681_10157101 3300025923 Bacteria 1710
123 Ga0207650_10001060 3300025925 Bacteria 20433
124 Ga0207650_10283627 3300025925 Unclassified 1349
125 Ga0207659_10077508 3300025926 Unclassified 2446
126 Ga0207659_10377761 3300025926 Bacteria 1181
127 Ga0207700_10625494 3300025928 Unclassified 959
128 Ga0207664_10503492 3300025929 Bacteria 1085
129 Ga0207644_10055257 3300025931 Unclassified 2862
130 Ga0207644_10131955 3300025931 Bacteria 1913
131 Ga0207706_10130817 3300025933 Bacteria 2208
132 Ga0207704_10104109 3300025938 Bacteria 1900
133 Ga0207691_10010244 3300025940 Bacteria 8993
134 Ga0207691_10011662 3300025940 Bacteria 8438
135 Ga0207691_10072182 3300025940 Bacteria 3114
136 Ga0207711_10067590 3300025941 Unclassified 3094
137 Ga0207711_10293153 3300025941 Bacteria 1500
138 Ga0207661_10405545 3300025944 Bacteria 1237
139 Ga0207679_10020019 3300025945 Bacteria 4509
140 Ga0207667_10113534 3300025949 Bacteria 2793
141 Ga0207651_10190002 3300025960 Bacteria 1637
142 Ga0207651_10357877 3300025960 Unclassified 1231
143 Ga0207712_10000047 3300025961 Bacteria 161425
144 Ga0207668_10039601 3300025972 Bacteria 3174
145 Ga0207640_10232046 3300025981 Bacteria 1420
146 Ga0207658_10026252 3300025986 Bacteria 4083
147 Ga0207658_10146030 3300025986 Unclassified 1921
148 Ga0207658_10351429 3300025986 Bacteria 1284
149 Ga0207677_10060614 3300026023 Unclassified 2616
150 Ga0207703_10695900 3300026035 Bacteria 966
151 Ga0207678_10083436 3300026067 Unclassified 2733
152 Ga0207641_10028306 3300026088 Bacteria 4630
153 Ga0207648_10101514 3300026089 Bacteria 2521
154 Ga0207648_10290165 3300026089 Bacteria 1465
155 Ga0207676_10171363 3300026095 Unclassified 1891
156 Ga0207675_100070922 3300026118 Bacteria 3257
157 Ga0207675_100368950 3300026118 Bacteria 1410
158 Ga0207683_10005120 3300026121 Bacteria 11253
159 Ga0207683_10128431 3300026121 Bacteria 2279
160 Ga0209813_10008283 3300027866 Bacteria 2620
161 Ga0209813_10026552 3300027866 Bacteria 1675
162 Ga0207428_10257743 3300027907 Bacteria 1299
163 Ga0268266_10012435 3300028379 Bacteria 7358
164 Ga0268266_10029086 3300028379 Bacteria 4697
165 Ga0265338_10041062 3300028800 Bacteria 4333
166 Ga0307511_10024978 3300030521 Bacteria 5520
167 Ga0307406_10282027 3300031901 Bacteria 1268
168 Ga0307412_10056245 3300031911 Bacteria 2621
169 Ga0307416_100303288 3300032002 Unclassified 1589
170 Ga0307414_10045977 3300032004 Unclassified 2993
171 Ga0307415_100029335 3300032126 Bacteria 3514
172 Ga0373934_0012463 3300035086 Plasmid 3209
173 Ga0373923_0035419 3300035111 Bacteria 2032
174 Ga0373945_0093067 3300035116 Unclassified 1170
175 Ga0373953_0065808 3300035117 Bacteria 1488
176 Ga0373953_0209477 3300035117 Unclassified 844
177 Ga0373954_0014240 3300035118 Bacteria 3546
178 Ga0373956_0047903 3300035119 Bacteria 1913
179 Ga0373956_0092237 3300035119 Bacteria 1398
180 Ga0373956_0128762 3300035119 Bacteria 1184
181 Ga0373957_0018518 3300035120 Bacteria 2441
182 Ga0373943_0010812 3300035170 Bacteria 4097
183 Ga0373943_0399819 3300035170 Unclassified 793
184 Ga0373946_0034683 3300035171 Bacteria 2038
185 Ga0373955_0009066 3300035172 Bacteria 4647
186 Ga0373955_0030676 3300035172 Plasmid 2809
187 Ga0373924_0017688 3300035410 Bacteria 2738
188 Ga0373924_0110149 3300035410 Bacteria 1189
189 Ga0373935_0009067 3300035692 Bacteria 5954
190 Ga0373927_0155234 3300035695 Bacteria 1499
191 Ga0373933_0109237 3300035724 Bacteria 1724
192 Ga0373947_0128205 3300035725 Unclassified 1617
193 Ga0373937_0191610 3300036401 Unclassified 1921
194 Ga0373925_0667186 3300037068 Bacteria 857
195 Ga0395898_0021687 3300037466 Bacteria 6511
196 Ga0395898_0581876 3300037466 Bacteria 1062
197 Ga0436364_0061519 3300037853 Bacteria 4653
198 Ga0436364_0273345 3300037853 Bacteria 2794207
199 Ga0436365_0395079 3300039437 Bacteria 14468
200 Ga0436360_0176752 3300039438 Bacteria 2380
201 Ga0436360_0587126 3300039438 Bacteria 17829
202 Ga0436363_0308726 3300039450 Unclassified 1239
203 Ga0436362_0089676 3300039453 Unclassified 816
204 Ga0436362_0618708 3300039453 Bacteria 1238
205 Ga0439453_0015951 3300041408 Bacteria 1305
206 Ga0439435_0013573 3300042436 Bacteria 1995
207 Ga0451577_0109127 3300042876 Bacteria 2474
208 Ga0466959_0175900 3300045049 Archaea 1499
209 Ga0466958_0378452 3300045836 Bacteria 913
210 Ga0495582_0221654 3300046473 Unclassified 1082
211 Ga0495584_0340298 3300046491 Unclassified 762
212 Ga0495608_0004212 3300046511 Bacteria 10310
213 Ga0495608_0115742 3300046511 Bacteria 1721
214 Ga0495628_0152054 3300046516 Bacteria 1762
215 Ga0495630_0007416 3300046517 Bacteria 7837
216 Ga0495652_0013760 3300046529 Bacteria 7280
217 Ga0495640_0076464 3300046533 Bacteria 2234
218 Ga0495640_0161041 3300046533 Bacteria 1438
219 Ga0495609_0071133 3300046538 Bacteria 1529
220 Ga0495645_0180327 3300046543 Unclassified 1447
221 Ga0495667_0006890 3300046559 Bacteria 7717
222 Ga0495667_0182535 3300046559 Bacteria 1346
223 Ga0495599_0116599 3300046678 Unclassified 1661
224 Ga0495658_0145513 3300046683 Unclassified 1452
225 Ga0495613_0000186 3300046689 Bacteria 60855
226 Ga0495613_0163159 3300046689 Bacteria 1584
227 Ga0495600_0128421 3300046809 Bacteria 1648
228 Ga0495581_0101727 3300047315 Bacteria 1670
229 Ga0495604_0109237 3300047317 Unclassified 2019
230 Ga0495672_0051750 3300047320 Bacteria 2417
231 Ga0495675_0119322 3300047444 Bacteria 1643
232 Ga0495684_0000099 3300047471 Bacteria 60765
233 Ga0495684_0067906 3300047471 Bacteria 2711
234 Ga0495602_0147992 3300048088 Bacteria 1850
235 Ga0496110_0496849 3300048913 Bacteria 1111
236 Ga0496113_0394987 3300048916 Unclassified 1110
237 Ga0496126_0017697 3300048929 Bacteria 7098
238 Ga0501031_0018372 3300049568 Bacteria 4551
239 Ga0501031_0293018 3300049568 Bacteria 1055
240 Ga0501032_0037609 3300049569 Bacteria 3299
241 Ga0501032_0053477 3300049569 Bacteria 2719
242 Ga0501033_0002026 3300049570 Bacteria 17617
243 Ga0501033_0030329 3300049570 Bacteria 4064
244 Ga0501033_0038987 3300049570 Unclassified 3549
245 Ga0501033_0052935 3300049570 Bacteria 3007
246 Ga0501033_0176254 3300049570 Bacteria 1534
247 Ga0501034_0046405 3300049571 Bacteria 4390
248 Ga0501034_0562761 3300049571 Bacteria 1048
249 Ga0501034_0712604 3300049571 Bacteria 901
250 Ga0501036_0011191 3300049572 Bacteria 7423
251 Ga0501036_0023113 3300049572 Bacteria 5233
252 Ga0501036_0031390 3300049572 Bacteria 4489
253 Ga0501036_0075190 3300049572 Bacteria 2857
254 Ga0501036_0077429 3300049572 Bacteria 2814
255 Ga0501036_0127964 3300049572 Bacteria 2144
256 Ga0501037_0026832 3300049573 Bacteria 4255
257 Ga0501037_0563783 3300049573 Bacteria 767
258 Ga0501038_0011460 3300049574 Bacteria 8088
259 Ga0501038_0012517 3300049574 Bacteria 7752
260 Ga0501038_0090807 3300049574 Unclassified 2559
261 Ga0501038_0357190 3300049574 Bacteria 1137
262 Ga0501039_0045580 3300049575 Bacteria 3388
263 Ga0501039_0046265 3300049575 Bacteria 3361
264 Ga0501039_0167734 3300049575 Unclassified 1726
265 Ga0501040_0041815 3300049576 Bacteria 3122
266 Ga0501041_0012078 3300049577 Bacteria 5113
267 Ga0501041_0027219 3300049577 Bacteria 3445
268 Ga0501042_0015863 3300049578 Bacteria 5164
269 Ga0501042_0042518 3300049578 Bacteria 3235
270 Ga0501042_0069978 3300049578 Bacteria 2510
271 Ga0501043_0003095 3300049579 Bacteria 13806
272 Ga0501043_0031380 3300049579 Bacteria 4176
273 Ga0501043_0305239 3300049579 Unclassified 1215
274 Ga0501046_0007095 3300049580 Bacteria 9861
275 Ga0501046_0021801 3300049580 Bacteria 5281
276 Ga0501047_0230758 3300049581 Bacteria 1704
277 Ga0501048_0011330 3300049582 Bacteria 6651
278 Ga0501048_0015344 3300049582 Bacteria 5657
279 Ga0501048_0018617 3300049582 Bacteria 5105
280 Ga0501048_0380863 3300049582 Bacteria 1007
281 Ga0501067_0001995 3300049583 Bacteria 11241
282 Ga0501067_0010929 3300049583 Bacteria 5025
283 Ga0501067_0028613 3300049583 Bacteria 3089
284 Ga0501068_0001550 3300049584 Bacteria 12220
285 Ga0501068_0037359 3300049584 Bacteria 2908
286 Ga0501068_0071860 3300049584 Bacteria 2112
287 Ga0501069_0075569 3300049585 Bacteria 1892
288 Ga0501070_0025286 3300049586 Bacteria 4978
289 Ga0501070_0313110 3300049586 Bacteria 1277
290 Ga0501071_0005738 3300049587 Bacteria 8008
291 Ga0501071_0006700 3300049587 Bacteria 7487
292 Ga0501071_0164033 3300049587 Bacteria 1662
293 Ga0501072_0128371 3300049588 Unclassified 2020
294 Ga0501072_0182845 3300049588 Bacteria 1672
295 Ga0501072_0203242 3300049588 Bacteria 1579
296 Ga0501072_0286682 3300049588 Unclassified 1309
297 Ga0501072_0336804 3300049588 Bacteria 1198
298 Ga0501073_0012784 3300049589 Bacteria 6123
299 Ga0501073_0020222 3300049589 Bacteria 4801
300 Ga0501073_0098909 3300049589 Unclassified 2025
301 Ga0501073_0654449 3300049589 Bacteria 725
302 Ga0501074_0017455 3300049590 Bacteria 5208
303 Ga0501075_0006164 3300049591 Bacteria 8240
304 Ga0501075_0012693 3300049591 Bacteria 5993
305 Ga0501075_0050161 3300049591 Bacteria 3137
306 Ga0501076_0009330 3300049592 Bacteria 7241
307 Ga0501076_0051956 3300049592 Bacteria 3245
308 Ga0501076_0120899 3300049592 Bacteria 2121
309 Ga0501076_0271318 3300049592 Bacteria 1389
310 Ga0501076_0333496 3300049592 Unclassified 1244
311 Ga0501079_0000786 3300049741 Bacteria 21668
312 Ga0501079_0003240 3300049741 Bacteria 11921
313 Ga0501079_0033218 3300049741 Bacteria 3968
314 Ga0501079_0109005 3300049741 Unclassified 2150
315 Ga0501079_0273264 3300049741 Unclassified 1321
316 Ga0501079_0304593 3300049741 Bacteria 1247
317 Ga0501079_0466269 3300049741 Bacteria 992
318 Ga0501080_0039058 3300049742 Bacteria 4429
319 Ga0501080_0592701 3300049742 Unclassified 984
320 Ga0501081_0023405 3300049743 Bacteria 4140
321 Ga0501081_0053219 3300049743 Bacteria 2794
322 Ga0501081_0136316 3300049743 Bacteria 1757
323 Ga0501081_0182281 3300049743 Bacteria 1519
324 Ga0501081_0282334 3300049743 Bacteria 1216
325 Ga0501083_0000883 3300049744 Bacteria 19840
326 Ga0501083_0010316 3300049744 Bacteria 6580
327 Ga0501083_0024954 3300049744 Bacteria 4140
328 Ga0501083_0153221 3300049744 Bacteria 1509
329 Ga0501035_0015177 3300049822 Bacteria 7110
330 Ga0501035_0037615 3300049822 Bacteria 4381
331 Ga0501035_0507421 3300049822 Unclassified 992
332 Ga0501044_0143661 3300049823 Bacteria 2373
333 Ga0501044_0603488 3300049823 Unclassified 990
334 Ga0501045_0032265 3300049824 Bacteria 3795
335 Ga0501045_0049426 3300049824 Bacteria 3066
336 Ga0501045_0057650 3300049824 Bacteria 2842
337 Ga0501045_0076236 3300049824 Bacteria 2470
338 Ga0501045_0189000 3300049824 Bacteria 1535
339 nmdc:mga03683_18599_c1 3300050489 Bacteria 2643
340 nmdc:mga03683_246584_c1 3300050489 Bacteria 829
341 nmdc:mga00v17_32639_c1 3300050491 Bacteria 3079
342 nmdc:mga00v17_44438_c1 3300050491 Bacteria 2679
343 nmdc:mga0yw44_74433_c1 3300050492 Bacteria 2115
344 nmdc:mga0k408_45511_c1 3300050493 Bacteria 2532
345 nmdc:mga0k408_88463_c1 3300050493 Bacteria 1819
346 nmdc:mga06z11_120394_c1 3300050494 Bacteria 1464
347 nmdc:mga06z11_253206_c1 3300050494 Bacteria 1037
348 nmdc:mga06z11_8623_c1 3300050494 Bacteria 4263
349 nmdc:mga05p37_311435_c1 3300050507 Bacteria 1866
350 nmdc:mga05p37_477071_c1 3300050507 Bacteria 1438
351 nmdc:mga05p37_580_c1 3300050507 Bacteria 40207
352 nmdc:mga09592_230816_c1 3300050508 Bacteria 1603
353 nmdc:mga0qj67_140604_c1 3300050509 Bacteria 1957
354 nmdc:mga0qj67_16979_c1 3300050509 Bacteria 5530
355 nmdc:mga06r32_43739_c1 3300050510 Unclassified 4262
356 nmdc:mga08y16_40843_c1 3300050511 Bacteria 4860
357 nmdc:mga08y16_568444_c1 3300050511 Bacteria 1146
358 nmdc:mga0rr50_481201_c1 3300050513 Unclassified 1054
359 nmdc:mga08x19_11104_c1 3300050514 Bacteria 5422
360 nmdc:mga0a205_39727_c1 3300050515 Bacteria 4528
361 Ga0495601_0004320 3300053077 Bacteria 8209
362 Ga0495612_0193447 3300053078 Unclassified 896
363 Ga0495595_0042117 3300053084 Bacteria 2092
364 Ga0495619_0007683 3300053085 Bacteria 6826
365 Ga0495619_0032610 3300053085 Bacteria 3381
366 Ga0500555_000866 3300053103 Bacteria 10784
367 Ga0500568_0006605 3300053139 Bacteria 5800
368 Ga0500645_000579 3300053730 Bacteria 23617
369 Ga0501084_0082129 3300054114 Bacteria 2704
370 Ga0501084_0097491 3300054114 Bacteria 2468
371 Ga0590075_014341 3300059424 Bacteria 1937
372 Ga0501082_0017427 3300060353 Bacteria 6187
373 Ga0501082_0036700 3300060353 Bacteria 4222
374 Ga0501082_0038259 3300060353 Bacteria 4138
375 Ga0501082_0046288 3300060353 Bacteria 3750
376 Ga0501082_0442758 3300060353 Unclassified 1135
377 Ga0501082_0615631 3300060353 Bacteria 950
378 Ga0501082_1235793 3300060353 Bacteria 653
379 Ga0530510_0025287 3300061734 Bacteria 4244
380 Ga0530510_0086877 3300061734 Bacteria 2279
381 Ga0530510_0106242 3300061734 Unclassified 2055
382 Ga0530510_0508889 3300061734 Unclassified 913
383 Ga0070674_100127352
384 Ga0065712_10166916
385 Ga0065715_10342365
386 Ga0070683_100362067
387 Ga0070670_100001800
388 Ga0070670_100069888
389 Ga0070677_10039924
390 Ga0068868_100015622
391 Ga0070689_100039110
392 Ga0070687_100316876
393 Ga0070668_100016729
394 Ga0070669_100080462
395 Ga0070675_100007447
396 Ga0070675_100142935
397 Ga0070673_100071273
398 Ga0070688_100044370
399 Ga0070667_100184018
400 Ga0070713_100308923
401 Ga0070708_100424001
402 Ga0070663_100137931
403 Ga0070678_100077758
404 Ga0070678_100305647
405 Ga0070662_100245502
406 Ga0070681_10162609
407 Ga0070706_100004442
408 Ga0070707_100033635
409 Ga0070707_100176225
410 Ga0070699_100079965
411 Ga0070699_100749924
412 Ga0070679_100007522
413 Ga0070684_100346472
414 Ga0070672_100001788
415 Ga0070672_100037786
416 Ga0070672_100251126
417 Ga0070665_100039631
418 Ga0070704_100226111
419 Ga0068855_100072280
420 Ga0068859_100063940
421 Ga0068864_100006472
422 Ga0068864_100096473
423 Ga0068860_100308359
424 Ga0081455_10048517
425 Ga0081540_1023281
426 Ga0081539_10000084
427 Ga0070717_10022939
428 Ga0070717_10211769
429 Ga0070717_10432723
430 Ga0075365_10103925
431 Ga0075368_10018307
432 Ga0075368_10048203
433 Ga0075368_10055003
434 Ga0075368_10128635
435 Ga0075363_100014937
436 Ga0075363_100101313
437 Ga0075363_100120457
438 Ga0075364_10027171
439 Ga0075364_10174253
440 Ga0075362_10000531
441 Ga0075367_10095364
442 Ga0075367_10214706
443 Ga0075367_10262268
444 Ga0075366_10005359
445 Ga0075366_10020353
446 Ga0075370_10132454
447 Ga0068871_100170414
448 Ga0075428_100012730
449 Ga0075428_100213319
450 Ga0075428_100273268
451 Ga0075428_100670089
452 Ga0075430_100074153
453 Ga0075430_100147871
454 Ga0075431_100239016
455 Ga0075431_100460881
456 Ga0075431_100596246
457 Ga0075433_10064812
458 Ga0075434_100000988
459 Ga0075434_100231052
460 Ga0075434_100373473
461 Ga0075429_100135419
462 Ga0075436_100010066
463 Ga0097620_100063940
464 Ga0097620_100749448
465 Ga0075435_100099215
466 Ga0105240_10100416
467 Ga0111539_10064763
468 Ga0111539_10305026
469 Ga0111539_10485289
470 Ga0114129_10008737
471 Ga0114129_10010174
472 Ga0114129_10018945
473 Ga0114129_10043491
474 Ga0114129_10174939
475 Ga0114129_10403142
476 Ga0105248_10013343
477 Ga0105248_10135383
478 Ga0105249_10000059
479 Ga0157373_10034403
480 Ga0157369_10002659
481 Ga0157369_10101395
482 Ga0157374_10015172
483 Ga0157378_10136082
484 Ga0157372_10045119
485 Ga0157375_10013919
486 Ga0163163_10019121
487 Ga0163163_10426918
488 Ga0157376_10028601
489 Ga0157376_10738909
490 Ga0213875_10000001
491 Ga0213875_10087905
492 Ga0213871_10000390
493 Ga0207682_10101624
494 Ga0207688_10282226
495 Ga0207699_10376379
496 Ga0207643_10032787
497 Ga0207643_10262759
498 Ga0207684_10130252
499 Ga0207707_10001066
500 Ga0207695_10011667
501 Ga0207657_10600983
502 Ga0207652_10149150
503 Ga0207646_10065548
504 Ga0207681_10157101
505 Ga0207650_10001060
506 Ga0207650_10283627
507 Ga0207659_10077508
508 Ga0207659_10377761
509 Ga0207700_10625494
510 Ga0207664_10503492
511 Ga0207644_10055257
512 Ga0207644_10131955
513 Ga0207706_10130817
514 Ga0207704_10104109
515 Ga0207691_10010244
516 Ga0207691_10011662
517 Ga0207691_10072182
518 Ga0207711_10067590
519 Ga0207711_10293153
520 Ga0207661_10405545
521 Ga0207679_10020019
522 Ga0207667_10113534
523 Ga0207651_10190002
524 Ga0207651_10357877
525 Ga0207712_10000047
526 Ga0207668_10039601
527 Ga0207640_10232046
528 Ga0207658_10026252
529 Ga0207658_10146030
530 Ga0207658_10351429
531 Ga0207677_10060614
532 Ga0207703_10695900
533 Ga0207678_10083436
534 Ga0207641_10028306
535 Ga0207648_10101514
536 Ga0207648_10290165
537 Ga0207676_10171363
538 Ga0207675_100070922
539 Ga0207675_100368950
540 Ga0207683_10005120
541 Ga0207683_10128431
542 Ga0209813_10008283
543 Ga0209813_10026552
544 Ga0207428_10257743
545 Ga0268266_10012435
546 Ga0268266_10029086
547 Ga0265338_10041062
548 Ga0307511_10024978
549 Ga0307406_10282027
550 Ga0307412_10056245
551 Ga0307416_100303288
552 Ga0307414_10045977
553 Ga0307415_100029335
554 Ga0373934_0012463
555 Ga0373923_0035419
556 Ga0373945_0093067
557 Ga0373953_0065808
558 Ga0373953_0209477
559 Ga0373954_0014240
560 Ga0373956_0047903
561 Ga0373956_0092237
562 Ga0373956_0128762
563 Ga0373957_0018518
564 Ga0373943_0010812
565 Ga0373943_0399819
566 Ga0373946_0034683
567 Ga0373955_0009066
568 Ga0373955_0030676
569 Ga0373924_0017688
570 Ga0373924_0110149
571 Ga0373935_0009067
572 Ga0373927_0155234
573 Ga0373933_0109237
574 Ga0373947_0128205
575 Ga0373937_0191610
576 Ga0373925_0667186
577 Ga0395898_0021687
578 Ga0395898_0581876
579 Ga0436364_0061519
580 Ga0436364_0273345
581 Ga0436365_0395079
582 Ga0436360_0176752
583 Ga0436360_0587126
584 Ga0436363_0308726
585 Ga0436362_0089676
586 Ga0436362_0618708
587 Ga0439453_0015951
588 Ga0439435_0013573
589 Ga0451577_0109127
590 Ga0466959_0175900
591 Ga0466958_0378452
592 Ga0495582_0221654
593 Ga0495584_0340298
594 Ga0495608_0004212
595 Ga0495608_0115742
596 Ga0495628_0152054
597 Ga0495630_0007416
598 Ga0495652_0013760
599 Ga0495640_0076464
600 Ga0495640_0161041
601 Ga0495609_0071133
602 Ga0495645_0180327
603 Ga0495667_0006890
604 Ga0495667_0182535
605 Ga0495599_0116599
606 Ga0495658_0145513
607 Ga0495613_0000186
608 Ga0495613_0163159
609 Ga0495600_0128421
610 Ga0495581_0101727
611 Ga0495604_0109237
612 Ga0495672_0051750
613 Ga0495675_0119322
614 Ga0495684_0000099
615 Ga0495684_0067906
616 Ga0495602_0147992
617 Ga0496110_0496849
618 Ga0496113_0394987
619 Ga0496126_0017697
620 Ga0501031_0018372
621 Ga0501031_0293018
622 Ga0501032_0037609
623 Ga0501032_0053477
624 Ga0501033_0002026
625 Ga0501033_0030329
626 Ga0501033_0038987
627 Ga0501033_0052935
628 Ga0501033_0176254
629 Ga0501034_0046405
630 Ga0501034_0562761
631 Ga0501034_0712604
632 Ga0501036_0011191
633 Ga0501036_0023113
634 Ga0501036_0031390
635 Ga0501036_0075190
636 Ga0501036_0077429
637 Ga0501036_0127964
638 Ga0501037_0026832
639 Ga0501037_0563783
640 Ga0501038_0011460
641 Ga0501038_0012517
642 Ga0501038_0090807
643 Ga0501038_0357190
644 Ga0501039_0045580
645 Ga0501039_0046265
646 Ga0501039_0167734
647 Ga0501040_0041815
648 Ga0501041_0012078
649 Ga0501041_0027219
650 Ga0501042_0015863
651 Ga0501042_0042518
652 Ga0501042_0069978
653 Ga0501043_0003095
654 Ga0501043_0031380
655 Ga0501043_0305239
656 Ga0501046_0007095
657 Ga0501046_0021801
658 Ga0501047_0230758
659 Ga0501048_0011330
660 Ga0501048_0015344
661 Ga0501048_0018617
662 Ga0501048_0380863
663 Ga0501067_0001995
664 Ga0501067_0010929
665 Ga0501067_0028613
666 Ga0501068_0001550
667 Ga0501068_0037359
668 Ga0501068_0071860
669 Ga0501069_0075569
670 Ga0501070_0025286
671 Ga0501070_0313110
672 Ga0501071_0005738
673 Ga0501071_0006700
674 Ga0501071_0164033
675 Ga0501072_0128371
676 Ga0501072_0182845
677 Ga0501072_0203242
678 Ga0501072_0286682
679 Ga0501072_0336804
680 Ga0501073_0012784
681 Ga0501073_0020222
682 Ga0501073_0098909
683 Ga0501073_0654449
684 Ga0501074_0017455
685 Ga0501075_0006164
686 Ga0501075_0012693
687 Ga0501075_0050161
688 Ga0501076_0009330
689 Ga0501076_0051956
690 Ga0501076_0120899
691 Ga0501076_0271318
692 Ga0501076_0333496
693 Ga0501079_0000786
694 Ga0501079_0003240
695 Ga0501079_0033218
696 Ga0501079_0109005
697 Ga0501079_0273264
698 Ga0501079_0304593
699 Ga0501079_0466269
700 Ga0501080_0039058
701 Ga0501080_0592701
702 Ga0501081_0023405
703 Ga0501081_0053219
704 Ga0501081_0136316
705 Ga0501081_0182281
706 Ga0501081_0282334
707 Ga0501083_0000883
708 Ga0501083_0010316
709 Ga0501083_0024954
710 Ga0501083_0153221
711 Ga0501035_0015177
712 Ga0501035_0037615
713 Ga0501035_0507421
714 Ga0501044_0143661
715 Ga0501044_0603488
716 Ga0501045_0032265
717 Ga0501045_0049426
718 Ga0501045_0057650
719 Ga0501045_0076236
720 Ga0501045_0189000
721 nmdc:mga03683_18599_c1
722 nmdc:mga03683_246584_c1
723 nmdc:mga00v17_32639_c1
724 nmdc:mga00v17_44438_c1
725 nmdc:mga0yw44_74433_c1
726 nmdc:mga0k408_45511_c1
727 nmdc:mga0k408_88463_c1
728 nmdc:mga06z11_120394_c1
729 nmdc:mga06z11_253206_c1
730 nmdc:mga06z11_8623_c1
731 nmdc:mga05p37_311435_c1
732 nmdc:mga05p37_477071_c1
733 nmdc:mga05p37_580_c1
734 nmdc:mga09592_230816_c1
735 nmdc:mga0qj67_140604_c1
736 nmdc:mga0qj67_16979_c1
737 nmdc:mga06r32_43739_c1
738 nmdc:mga08y16_40843_c1
739 nmdc:mga08y16_568444_c1
740 nmdc:mga0rr50_481201_c1
741 nmdc:mga08x19_11104_c1
742 nmdc:mga0a205_39727_c1
743 Ga0495601_0004320
744 Ga0495612_0193447
745 Ga0495595_0042117
746 Ga0495619_0007683
747 Ga0495619_0032610
748 Ga0500555_000866
749 Ga0500568_0006605
750 Ga0500645_000579
751 Ga0501084_0082129
752 Ga0501084_0097491
753 Ga0590075_014341
754 Ga0501082_0017427
755 Ga0501082_0036700
756 Ga0501082_0038259
757 Ga0501082_0046288
758 Ga0501082_0442758
759 Ga0501082_0615631
760 Ga0501082_1235793
761 Ga0530510_0025287
762 Ga0530510_0086877
763 Ga0530510_0106242
764 Ga0530510_0508889

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08808

RES

RES domain

72

218

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
6fkg-assembly1.cif.gz_B crystal structure of the m.tuberculosis mbct-mbca toxin-antitoxin complex. 0.6732 89 211
1wdl-assembly1.cif.gz_C fatty acid beta-oxidation multienzyme complex from pseudomonas fragi, form ii (native4) 0.5059 166 196
8k1c-assembly1.cif.gz_C structural insight into the role of acetyl-coa acetyltransferase from fusobacterium nucleatum 0.5028 165 196
4otm-assembly1.cif.gz_B crystal structure of the c-terminal domain from yeast gcn2 0.4987 156 199
4w61-assembly3.cif.gz_K crystal structure of beta-ketoacyl thiolase b (bktb) from ralstonia eutropha 0.4935 165 197
ID Description Score Start End Superfamily
5iipB00 Alpha Beta;Roll;CBS-domain;CBS-domain 0.5197 169 197 3.10.580.10
af_O53871_3_403_3.50.30.50 Alpha Beta;3-Layer(bba) Sandwich;Glucose Oxidase; domain 1;Putative cyclase 0.4843 165 196 3.50.30.50
4dqwB02 Alpha Beta;Roll;CBS-domain;CBS-domain 0.4841 169 198 3.10.580.10
3zjxC02 Mainly Beta;Beta Complex;Proaerolysin; Chain A, domain 3;Proaerolysin, chain A, domain 3 0.4824 131 227 2.170.15.10
af_A0A1D6FCW8_19_445_3.40.47.10 Alpha Beta;3-Layer(aba) Sandwich;Peroxisomal Thiolase; Chain A, domain 1;Thiolase/Chalcone synthase 0.4823 165 197 3.40.47.10
ID Description Score Start End GO Terms
AF-A0A2V9VVA7-F1-model_v4 RES domain-containing protein 0.9684 84 209
AF-A0A1A7C0E0-F1-model_v4 RES domain-containing protein 0.9456 28 228
AF-A0A3C0Y550-F1-model_v4 RES domain-containing protein 0.9436 132 230
AF-A0A1Q7IXY4-F1-model_v4 RES domain-containing protein 0.9333 68 230
AF-A0A847DW60-F1-model_v4 RES family NAD+ phosphorylase 0.9323 1 229

Map