F429125

General Info

Members Datasets Scaffolds Average Seq Length
381 252 763 221

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|3006425503|3006427311
Length 243
Sequence SVLLSAVLVVVALVVQVSVLARLQLPGAVPDLTLLVVLGLALVYGHVGGALVGFSAGLLADLAPPADHAVGRYALVLCVVGYLTGLAKPESGRLRSATAPLAAVVLAAVGTTLLYAGVGALVGDTSARQVGLPGLLLTAALYDLLLAPFVVPGVMALARRTEKDPLAEAAGGGTAGAEGSVYGGWLSSGAGQRLRGSTGKLGGGRLGGTGRLGGRIGGQRGGLLTGGRSSRVKTGRIKGVKRL

Samples

Sample ID Description Type Environment
1 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
2 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
3 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
4 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
5 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
6 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
7 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
8 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
9 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
10 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
11 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
12 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
13 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
14 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
15 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
16 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
17 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
18 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
19 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
20 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
21 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
22 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
23 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
24 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
25 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
26 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
27 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
28 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
29 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
30 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
31 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
32 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
33 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
34 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
35 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
36 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
37 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
38 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
39 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
40 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
41 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
42 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
43 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
44 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
45 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
46 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
47 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
48 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
49 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
50 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
51 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
52 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
53 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
54 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
55 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
56 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
57 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
58 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
59 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
60 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
61 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
62 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
63 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
64 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
65 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
66 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
67 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
68 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
69 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
70 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
71 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
72 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
73 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
74 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
75 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
76 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
77 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
78 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
79 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
80 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
81 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
82 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
83 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
84 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
85 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
86 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
87 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
88 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
89 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
90 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
91 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
92 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
93 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
94 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
95 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
96 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
97 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
98 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
99 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
100 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
101 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
102 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
103 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
104 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
105 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
106 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
107 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
108 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
109 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
110 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
111 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
112 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
113 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
114 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
115 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
116 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
117 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
118 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
119 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
120 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
121 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
122 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
123 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
124 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
125 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
126 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
127 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
128 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
129 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
130 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
131 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
132 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
133 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
134 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
135 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
136 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
137 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
138 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
139 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
140 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
141 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
142 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
143 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
144 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
145 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
146 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
147 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
148 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
152 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
153 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
154 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
155 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
157 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
158 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
159 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
160 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
161 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
162 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
163 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
164 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
165 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
166 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
167 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
168 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
169 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
170 2582581312 Streptomyces atratus OK008 Isolate Rhizosphere
171 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
172 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
173 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
174 2616644941 Streptomyces atratus OK807 Isolate Rhizosphere
175 2643221548 Streptomyces sp. Root55 Isolate Unclassified
176 2643221578 Streptomyces sp. Root63 Isolate Unclassified
177 2643221587 Streptomyces sp. Root66D1 Isolate Unclassified
178 2643221631 Kitasatospora sp. Root107 Isolate Unclassified
179 2643221647 Streptomyces sp. Root369 Isolate Unclassified
180 2643221670 Streptomyces sp. Root431 Isolate Unclassified
181 2643221673 Streptomyces sp. Root1295 Isolate Unclassified
182 2643221677 Streptomyces sp. Root1304 Isolate Unclassified
183 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
184 2643221682 Streptomyces sp. Root1319 Isolate Unclassified
185 2643221714 Streptomyces sp. Root264 Isolate Unclassified
186 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
187 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
188 2784746768 Streptomyces griseorubiginosus SAI-142 Isolate Unclassified
189 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
190 2791355406 Streptomyces rhizosphaericus NRRL B-24304 Isolate Unclassified
191 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
192 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
193 2808606448 Streptomyces sp. 193411 Isolate Unclassified
194 2808606982 Streptomyces sp. SLBN-118 Isolate Unclassified
195 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
196 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
197 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
198 2818991472 Kitasatospora viridis DSM 44826 Isolate Rhizosphere
199 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
200 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
201 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
202 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
203 2862574272 Streptomyces sp. AcE210 Isolate Nodule
204 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
205 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
206 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
207 2867369537 Streptomyces sp. Z26 Isolate Unclassified
208 2867428634 Streptomyces sp. RP5T Isolate Unclassified
209 2875391855 Streptomyces cavourensis 1AS2a Isolate Rhizosphere
210 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
211 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
212 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
213 2918501144 Streptomyces sp. PvR006 Isolate Rhizosphere
214 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
215 2946045630 Streptomyces sp. W4I9-2 Isolate Rhizosphere
216 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
217 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
218 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
219 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
220 2954380949 Streptomyces ciscaucasicus W1I15 Isolate Rhizosphere
221 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
222 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
223 2954691527 Streptomyces sp. SAI-127 Isolate Rhizosphere
224 2954701450 Streptomyces sp. SAI-144 Isolate Rhizosphere
225 2954711539 Streptomyces sp. SAI-090 Isolate Rhizosphere
226 2954721474 Streptomyces sp. SAI-117 Isolate Rhizosphere
227 2954731030 Streptomyces sp. SAI-133 Isolate Rhizosphere
228 2954740390 Streptomyces sp. SAI-041 Isolate Rhizosphere
229 2954749733 Streptomyces sp. SAI-135 Isolate Rhizosphere
230 2954759201 Streptomyces sp. SAI-208 Isolate Rhizosphere
231 2966598605 Kitasatospora papulosa SLBN-177 Isolate Rhizosphere
232 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
233 2990059506 Streptomyces sp. CAP261 Isolate Unclassified
234 2995463766 Streptacidiphilus fuscans NEAU-YB345 Isolate Unclassified
235 2997451912 Streptomyces piniterrae jys28 Isolate Rhizosphere
236 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
237 3006393351 Streptomyces sp. SID4985 Isolate Unclassified
238 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
239 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
240 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
241 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
242 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
243 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
244 8025413630 Streptomyces sp. CAI-17 Isolate Rhizosphere
245 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
246 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
247 8047893842 Streptomyces cangkringensis DSM 41769 Isolate Rhizosphere
248 8048356638 Streptomyces rhizosphaericus DSM 41760 Isolate Rhizosphere
249 8048369669 Streptomyces indonesiensis DSM 41759 Isolate Rhizoplane
250 8048379754 Streptomyces asiaticus DSM 41761 Isolate Rhizosphere
251 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
252 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 76.64
Metatranscriptomes 1.05
Isolates 22.31

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.72
Nodule 0.79
Rhizoplane 1.05
Rhizosphere 74.28
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10008017 3300003316 Bacteria 2016
2 rootH1_10051847 3300003316 Bacteria 3165
3 rootH2_10006696 3300003320 Bacteria 3391
4 rootH1_10013039 3300003316 Bacteria 1982
5 rootH1_10013039 3300003323 Bacteria 3203
6 rootH1_10013040 3300003323 Bacteria 2214
7 JGI25160J50197_1029152 3300003354 Bacteria 1466
8 Ga0006562J51391_1093117 3300003578 Bacteria 2380
9 Ga0006562J51391_1093120 3300003578 Bacteria 1410
10 Ga0006562J51391_1185377 3300003578 Bacteria 1670
11 Ga0006562J51391_1185378 3300003578 Bacteria 1600
12 Ga0070698_100434934 3300005471 Bacteria 1247
13 Ga0068852_100259487 3300005616 Bacteria 1668
14 Ga0075368_10034915 3300006042 Bacteria 1961
15 Ga0075363_100267021 3300006048 Bacteria 988
16 Ga0075367_10000161 3300006178 Bacteria 21029
17 Ga0075370_10060902 3300006353 Bacteria 2151
18 Ga0105245_10850768 3300009098 Bacteria 952
19 Ga0105243_10669196 3300009148 Bacteria 1008
20 Ga0105248_10082204 3300009177 Bacteria 3621
21 Ga0105246_10526476 3300011119 Bacteria 1008
22 Ga0157369_10257901 3300013105 Bacteria 1819
23 Ga0157375_10044553 3300013308 Bacteria 4312
24 Ga0182008_10002208 3300014497 Bacteria 12349
25 Ga0182007_10001114 3300015262 Bacteria 14564
26 Ga0183367_1006 3300015688 Bacteria 648044
27 Ga0207426_1007331 3300025302 Bacteria 4631
28 Ga0207426_1010426 3300025302 Bacteria 3604
29 Ga0207647_10008338 3300025904 Bacteria 7431
30 Ga0207691_10327715 3300025940 Bacteria 1312
31 Ga0207698_10804517 3300026142 Bacteria 942
32 Ga0209371_1021867 3300027312 Bacteria 1541
33 Ga0209813_10021721 3300027866 Bacteria 1808
34 Ga0307517_10022864 3300028786 Bacteria 7809
35 Ga0307515_10002026 3300028794 Bacteria 44830
36 Ga0307515_10097571 3300028794 Bacteria 3590
37 Ga0268256_1024628 3300030500 Bacteria 1541
38 Ga0307511_10011670 3300030521 Bacteria 8649
39 Ga0307511_10094112 3300030521 Bacteria 2010
40 Ga0307512_10028024 3300030522 Bacteria 4945
41 Ga0307512_10203959 3300030522 Bacteria 1065
42 Ga0307513_10003236 3300031456 Bacteria 22206
43 Ga0307513_10111438 3300031456 Bacteria 2729
44 Ga0307513_10262765 3300031456 Bacteria 1514
45 Ga0307509_10169114 3300031507 Bacteria 2068
46 Ga0307508_10004836 3300031616 Bacteria 12982
47 Ga0307508_10005742 3300031616 Bacteria 11746
48 Ga0307508_10075032 3300031616 Bacteria 2959
49 Ga0307508_10104529 3300031616 Bacteria 2429
50 Ga0307516_10025256 3300031730 Bacteria 6051
51 Ga0307516_10442946 3300031730 Bacteria 956
52 Ga0307413_10252761 3300031824 Bacteria 1309
53 Ga0307518_10161596 3300031838 Bacteria 1538
54 Ga0307518_10192399 3300031838 Bacteria 1365
55 Ga0307416_100007396 3300032002 Bacteria 6980
56 Ga0307507_10031900 3300033179 Bacteria 5516
57 Ga0307507_10071132 3300033179 Bacteria 3148
58 Ga0307510_10052909 3300033180 Bacteria 4273
59 Ga0307510_10113676 3300033180 Bacteria 2439
60 Ga0395900_0250448 3300037418 Bacteria 1773
61 Ga0395898_0004019 3300037466 Bacteria 16164
62 Ga0395898_0004910 3300037466 Bacteria 14516
63 Ga0395898_0066824 3300037466 Bacteria 3482
64 Ga0395901_0048352 3300038443 Bacteria 4417
65 Ga0439436_0062447 3300041404 Bacteria 1042
66 Ga0439466_0032059 3300041411 Bacteria 1794
67 Ga0451802_0172145 3300041460 Bacteria 2035
68 Ga0451853_0146293 3300041512 Bacteria 3814
69 Ga0451853_0590716 3300041512 Bacteria 3081
70 Ga0439442_003614 3300042002 Bacteria 3061
71 Ga0439449_0001809 3300042007 Bacteria 8412
72 Ga0439449_0042637 3300042007 Bacteria 1685
73 Ga0439449_0065920 3300042007 Bacteria 1335
74 Ga0439454_035447 3300042011 Bacteria 799
75 Ga0439455_0000884 3300042012 Bacteria 4621
76 Ga0439457_000074 3300042014 Bacteria 22043
77 Ga0439457_000457 3300042014 Bacteria 11754
78 Ga0439462_0002506 3300042015 Bacteria 4274
79 Ga0450894_000102 3300042131 Bacteria 14302
80 Ga0450899_001589 3300042135 Bacteria 2512
81 Ga0450903_000064 3300042138 Bacteria 21230
82 Ga0450903_027669 3300042138 Bacteria 862
83 Ga0450906_003759 3300042145 Bacteria 3230
84 Ga0466969_0001526 3300044656 Bacteria 12466
85 Ga0466969_0051280 3300044656 Bacteria 2031
86 Ga0466969_0065847 3300044656 Bacteria 1751
87 Ga0466972_0003118 3300044658 Bacteria 8227
88 Ga0466972_0004350 3300044658 Bacteria 7079
89 Ga0466965_0019079 3300044683 Bacteria 3292
90 Ga0466965_0048521 3300044683 Bacteria 2104
91 Ga0466966_0002974 3300044684 Bacteria 11158
92 Ga0466966_0003602 3300044684 Bacteria 10217
93 Ga0466966_0006216 3300044684 Bacteria 7894
94 Ga0466966_0114086 3300044684 Bacteria 1664
95 Ga0466966_0334340 3300044684 Bacteria 910
96 Ga0466961_0001173 3300044693 Bacteria 16122
97 Ga0466961_0012672 3300044693 Bacteria 5401
98 Ga0466963_0021090 3300044694 Bacteria 4105
99 Ga0466963_0057971 3300044694 Bacteria 2580
100 Ga0466964_0071364 3300044706 Bacteria 1469
101 Ga0466971_0000496 3300044719 Bacteria 15458
102 Ga0466968_0313360 3300044735 Bacteria 757
103 Ga0466970_0000648 3300044765 Bacteria 17136
104 Ga0466970_0005179 3300044765 Bacteria 6446
105 Ga0466970_0184469 3300044765 Bacteria 1158
106 Ga0466957_0000456 3300044842 Bacteria 20238
107 Ga0466960_0004686 3300044901 Bacteria 5364
108 Ga0466960_0092396 3300044901 Bacteria 1545
109 Ga0466960_0225150 3300044901 Bacteria 1033
110 Ga0466959_0169118 3300045049 Bacteria 1533
111 Ga0466958_0000159 3300045836 Bacteria 23828
112 Ga0466967_0007231 3300045976 Bacteria 7980
113 Ga0466967_0108582 3300045976 Bacteria 2546
114 Ga0466967_0538846 3300045976 Bacteria 1148
115 Ga0495592_0012206 3300046454 Bacteria 6519
116 Ga0495603_0002324 3300046455 Bacteria 11163
117 Ga0495603_0004981 3300046455 Bacteria 7949
118 Ga0495603_0005266 3300046455 Bacteria 7717
119 Ga0495603_0017941 3300046455 Bacteria 4282
120 Ga0495603_0132596 3300046455 Bacteria 1450
121 Ga0495590_0193690 3300046457 Bacteria 745
122 Ga0495629_0000761 3300046459 Bacteria 25940
123 Ga0495629_0001256 3300046459 Bacteria 19914
124 Ga0495629_0009699 3300046459 Bacteria 7032
125 Ga0495629_0027021 3300046459 Bacteria 4076
126 Ga0495629_0032122 3300046459 Bacteria 3717
127 Ga0495629_0059374 3300046459 Bacteria 2674
128 Ga0495638_0079115 3300046460 Bacteria 2000
129 Ga0495638_0144836 3300046460 Bacteria 1383
130 Ga0495651_0016217 3300046462 Bacteria 5771
131 Ga0495605_0198906 3300046474 Bacteria 874
132 Ga0495639_0148870 3300046475 Bacteria 1128
133 Ga0495662_0033995 3300046476 Bacteria 2462
134 Ga0495662_0056948 3300046476 Bacteria 1887
135 Ga0495664_0112152 3300046477 Bacteria 1646
136 Ga0495664_0146953 3300046477 Bacteria 1430
137 Ga0495584_0165138 3300046491 Bacteria 1125
138 Ga0495594_0005563 3300046499 Bacteria 6471
139 Ga0495594_0008505 3300046499 Bacteria 5290
140 Ga0495596_0046477 3300046500 Bacteria 1705
141 Ga0495607_0090838 3300046501 Bacteria 1654
142 Ga0495606_0001850 3300046507 Bacteria 26642
143 Ga0495610_0014723 3300046512 Bacteria 4581
144 Ga0495616_0024469 3300046513 Bacteria 3239
145 Ga0495618_0040693 3300046514 Bacteria 2926
146 Ga0495620_0026355 3300046515 Bacteria 2734
147 Ga0495630_0036561 3300046517 Bacteria 3671
148 Ga0495630_0087797 3300046517 Bacteria 2349
149 Ga0495631_0012407 3300046518 Bacteria 4161
150 Ga0495637_0013972 3300046520 Bacteria 3798
151 Ga0495648_0112525 3300046524 Bacteria 1478
152 Ga0495666_0072986 3300046526 Bacteria 1629
153 Ga0495642_0019377 3300046528 Bacteria 2667
154 Ga0495642_0045707 3300046528 Bacteria 1790
155 Ga0495654_0018942 3300046530 Bacteria 3601
156 Ga0495640_0069256 3300046533 Bacteria 2373
157 Ga0495586_0151196 3300046535 Bacteria 1306
158 Ga0495587_0000928 3300046536 Bacteria 19291
159 Ga0495609_0014710 3300046538 Bacteria 3674
160 Ga0495597_0055373 3300046542 Bacteria 1739
161 Ga0495645_0015908 3300046543 Bacteria 5360
162 Ga0495645_0036830 3300046543 Bacteria 3566
163 Ga0495622_0002187 3300046557 Bacteria 9539
164 Ga0495622_0015364 3300046557 Bacteria 3558
165 Ga0495622_0074638 3300046557 Bacteria 1564
166 Ga0495633_0022597 3300046558 Bacteria 3126
167 Ga0495668_0078880 3300046616 Bacteria 1807
168 Ga0495634_0002582 3300046642 Bacteria 14935
169 Ga0495625_0017925 3300046660 Bacteria 5534
170 Ga0495625_0019889 3300046660 Bacteria 5195
171 Ga0495625_0141597 3300046660 Bacteria 1622
172 Ga0495635_0035674 3300046663 Bacteria 3447
173 Ga0495661_0063955 3300046665 Bacteria 2173
174 Ga0495588_0005435 3300046674 Bacteria 5670
175 Ga0495588_0018383 3300046674 Bacteria 3407
176 Ga0495588_0038245 3300046674 Bacteria 2440
177 Ga0495588_0063045 3300046674 Bacteria 1921
178 Ga0495657_0011786 3300046675 Bacteria 6517
179 Ga0495657_0019729 3300046675 Bacteria 4859
180 Ga0495646_0009464 3300046680 Bacteria 6184
181 Ga0495613_0000533 3300046689 Bacteria 31681
182 Ga0495613_0014792 3300046689 Bacteria 5791
183 Ga0495613_0061434 3300046689 Bacteria 2751
184 Ga0495613_0067692 3300046689 Bacteria 2606
185 Ga0495670_0040618 3300046691 Bacteria 2320
186 Ga0495670_0065294 3300046691 Bacteria 1834
187 Ga0495671_0017329 3300046692 Bacteria 3835
188 Ga0495649_0015681 3300046694 Bacteria 4308
189 Ga0495589_0023254 3300046794 Bacteria 3160
190 Ga0495589_0025224 3300046794 Bacteria 3018
191 Ga0495589_0036020 3300046794 Bacteria 2480
192 Ga0495660_0178300 3300046810 Bacteria 1029
193 Ga0495581_0022432 3300047315 Bacteria 3658
194 Ga0495581_0048367 3300047315 Bacteria 2456
195 Ga0495581_0085599 3300047315 Bacteria 1827
196 Ga0495604_0009379 3300047317 Bacteria 7741
197 Ga0495636_0002429 3300047318 Bacteria 7140
198 Ga0495636_0017494 3300047318 Bacteria 2870
199 Ga0495676_0000524 3300047321 Bacteria 31468
200 Ga0495676_0016168 3300047321 Bacteria 6628
201 Ga0495676_0074614 3300047321 Bacteria 2596
202 Ga0495676_0088870 3300047321 Bacteria 2315
203 Ga0495676_0189457 3300047321 Bacteria 1435
204 Ga0495683_0175144 3300047323 Bacteria 983
205 Ga0495687_003257 3300047443 Bacteria 11978
206 Ga0495687_052488 3300047443 Bacteria 1723
207 Ga0495687_094473 3300047443 Bacteria 1136
208 Ga0495675_0002803 3300047444 Bacteria 10459
209 Ga0495675_0257831 3300047444 Bacteria 1045
210 Ga0495679_098523 3300047446 Bacteria 814
211 Ga0495685_000950 3300047447 Bacteria 8765
212 Ga0495685_034931 3300047447 Bacteria 1727
213 Ga0495685_056858 3300047447 Bacteria 1322
214 Ga0495673_0029112 3300047469 Bacteria 2610
215 Ga0495681_0004919 3300047470 Bacteria 9023
216 Ga0495686_0037402 3300047472 Bacteria 3109
217 Ga0495686_0068330 3300047472 Bacteria 2192
218 Ga0495686_0074028 3300047472 Bacteria 2091
219 Ga0495593_0004563 3300047673 Bacteria 8230
220 Ga0495614_0002815 3300048089 Bacteria 7740
221 Ga0495614_0016471 3300048089 Bacteria 3216
222 Ga0495614_0037417 3300048089 Bacteria 2081
223 Ga0495614_0040160 3300048089 Bacteria 2008
224 Ga0495614_0063423 3300048089 Bacteria 1588
225 Ga0495626_0006904 3300048091 Bacteria 6395
226 Ga0496106_0109120 3300048909 Bacteria 2153
227 Ga0496110_0234392 3300048913 Bacteria 1670
228 Ga0495678_033181 3300049459 Bacteria 2133
229 Ga0501031_0259164 3300049568 Bacteria 1130
230 Ga0501032_0007696 3300049569 Bacteria 7854
231 Ga0501032_0049668 3300049569 Bacteria 2830
232 Ga0501032_0061832 3300049569 Bacteria 2510
233 Ga0501033_0017095 3300049570 Bacteria 5482
234 Ga0501033_0044008 3300049570 Bacteria 3323
235 Ga0501033_0051748 3300049570 Bacteria 3044
236 Ga0501033_0079925 3300049570 Bacteria 2399
237 Ga0501033_0141065 3300049570 Bacteria 1742
238 Ga0501034_0001747 3300049571 Bacteria 27891
239 Ga0501034_0025210 3300049571 Bacteria 6052
240 Ga0501034_0162119 3300049571 Bacteria 2206
241 Ga0501034_0265551 3300049571 Bacteria 1658
242 Ga0501034_0325828 3300049571 Bacteria 1468
243 Ga0501034_0441236 3300049571 Bacteria 1220
244 Ga0501036_0000809 3300049572 Bacteria 23223
245 Ga0501036_0047288 3300049572 Bacteria 3644
246 Ga0501036_0188132 3300049572 Bacteria 1737
247 Ga0501036_0263864 3300049572 Bacteria 1442
248 Ga0501037_0011503 3300049573 Bacteria 6514
249 Ga0501037_0034436 3300049573 Bacteria 3737
250 Ga0501037_0055841 3300049573 Bacteria 2886
251 Ga0501038_0067978 3300049574 Bacteria 3030
252 Ga0501038_0072530 3300049574 Bacteria 2917
253 Ga0501038_0145151 3300049574 Bacteria 1938
254 Ga0501038_0156896 3300049574 Bacteria 1852
255 Ga0501039_0065662 3300049575 Bacteria 2815
256 Ga0501039_0068967 3300049575 Bacteria 2745
257 Ga0501039_0170134 3300049575 Bacteria 1713
258 Ga0501039_0211090 3300049575 Bacteria 1527
259 Ga0501043_0066878 3300049579 Bacteria 2822
260 Ga0501043_0085067 3300049579 Bacteria 2485
261 Ga0501043_0416343 3300049579 Bacteria 1013
262 Ga0501046_0014208 3300049580 Bacteria 6724
263 Ga0501047_0005629 3300049581 Bacteria 11803
264 Ga0501047_0083740 3300049581 Bacteria 3065
265 Ga0501047_0132466 3300049581 Bacteria 2373
266 Ga0501047_0228593 3300049581 Bacteria 1714
267 Ga0501047_0580822 3300049581 Bacteria 943
268 Ga0501048_0015630 3300049582 Bacteria 5601
269 Ga0501068_0100889 3300049584 Bacteria 1789
270 Ga0501070_0015323 3300049586 Bacteria 6450
271 Ga0501070_0363759 3300049586 Bacteria 1173
272 Ga0501073_0689783 3300049589 Bacteria 705
273 Ga0501080_0130583 3300049742 Bacteria 2326
274 Ga0501035_0006265 3300049822 Bacteria 11187
275 Ga0501035_0025128 3300049822 Bacteria 5461
276 Ga0501035_0064664 3300049822 Bacteria 3250
277 Ga0501035_0076456 3300049822 Bacteria 2961
278 Ga0501035_0184966 3300049822 Bacteria 1793
279 Ga0501044_0025765 3300049823 Bacteria 6234
280 Ga0501044_0068514 3300049823 Bacteria 3614
281 Ga0501044_0093032 3300049823 Bacteria 3040
282 Ga0501044_0124386 3300049823 Bacteria 2577
283 Ga0501044_0178503 3300049823 Bacteria 2091
284 Ga0501044_0361634 3300049823 Bacteria 1369
285 Ga0501045_0143918 3300049824 Bacteria 1773
286 nmdc:mga0yw44_135218_c1 3300050492 Bacteria 1599
287 nmdc:mga06z11_2921_c1 3300050494 Bacteria 6578
288 nmdc:mga06z11_403156_c1 3300050494 Bacteria 823
289 nmdc:mga04h51_11194_c1 3300050495 Bacteria 2484
290 nmdc:mga07m45_394523_c1 3300050496 Bacteria 803
291 Ga0500578_0224092 3300053086 Bacteria 1142
292 Ga0500644_0036035 3300053088 Bacteria 1607
293 Ga0500651_0379980 3300053093 Bacteria 797
294 Ga0500600_0075293 3300053149 Bacteria 1840
295 Ga0500634_0104286 3300053161 Bacteria 1413
296 Ga0466962_0011749 3300061719 Bacteria 4217
297 Ga0466962_0094540 3300061719 Bacteria 1433
298 3006427311 3006425503 Bacteria 6491253
299 2547406842 2547132111 Bacteria 8013147
300 2585301909 2582581312 Bacteria 7308206
301 2585304831 2582581313 Bacteria 10042643
302 2585319455 2582581314 Bacteria 11452267
303 2616700737 2616644814 Bacteria 11555299
304 2616899887 2616644941 Bacteria 8510691
305 2643759760 2643221548 Bacteria 8053412
306 2643897885 2643221578 Bacteria 9213798
307 2643944679 2643221587 Bacteria 7586415
308 2644179826 2643221631 Bacteria 8168043
309 2644269260 2643221647 Bacteria 10741251
310 2644385394 2643221670 Bacteria 6497041
311 2644409030 2643221673 Bacteria 9196637
312 2644431577 2643221677 Bacteria 7584031
313 2644436388 2643221678 Bacteria 9540101
314 2644462821 2643221682 Bacteria 6743283
315 2644625760 2643221714 Bacteria 9015452
316 2784587868 2784132148 Bacteria 8627943
317 2785344277 2784746763 Bacteria 9783172
318 2785368592 2784746768 Bacteria 10036182
319 2786669696 2786546132 Bacteria 10419719
320 2793976146 2791355406 Bacteria 11364898
321 2808841276 2808606359 Bacteria 9866990
322 2808919784 2808606375 Bacteria 9466072
323 2809231455 2808606448 Bacteria 8656184
324 2811848279 2808606982 Bacteria 7791042
325 2812358982 2811994879 Bacteria 9313447
326 2812481229 2811994917 Bacteria 7761064
327 2819693670 2818991463 Bacteria 7948711
328 2819742847 2818991472 Bacteria 10089953
329 2852642222 2852635781 Bacteria 8251373
330 2862288145 2862281513 Bacteria 9621493
331 2862392574 2862382967 Bacteria 10317375
332 2862509492 2862507626 Bacteria 9425308
333 2862579999 2862574272 Bacteria 10567477
334 2862711020 2862705112 Bacteria 6563286
335 2863405530 2863404153 Bacteria 9672205
336 2867348137 2867346516 Bacteria 7608576
337 2867371098 2867369537 Bacteria 6501581
338 2867431091 2867428634 Bacteria 9590268
339 2875393796 2875391855 Bacteria 7600475
340 2877681936 2877676314 Bacteria 9512378
341 2912720904 2912715099 Bacteria 9460473
342 2912759931 2912757875 Bacteria 7940295
343 2918503825 2918501144 Bacteria 8668083
344 2919468676 2919468124 Bacteria 9133025
345 2946050857 2946045630 Bacteria 8527308
346 2946066895 2946064051 Bacteria 8957905
347 2946075223 2946072368 Bacteria 8999607
348 2947230339 2947224130 Bacteria 9938529
349 2954003651 2954002825 Bacteria 9173742
350 2954387059 2954380949 Bacteria 10050426
351 2954676104 2954673503 Bacteria 9685905
352 2954688063 2954682443 Bacteria 9862841
353 2954697895 2954691527 Bacteria 10720516
354 2954704321 2954701450 Bacteria 10834262
355 2954717006 2954711539 Bacteria 10867210
356 2954726957 2954721474 Bacteria 10456478
357 2954734840 2954731030 Bacteria 10243860
358 2954745878 2954740390 Bacteria 10229294
359 2954753712 2954749733 Bacteria 10366972
360 2954764851 2954759201 Bacteria 9358192
361 2966603282 2966598605 Bacteria 7676064
362 2990046510 2990044586 Bacteria 6603797
363 2990061892 2990059506 Bacteria 9321252
364 2995471119 2995463766 Bacteria 8577691
365 2997456551 2997451912 Bacteria 8492419
366 3006321826 3006321560 Bacteria 8247479
367 3006399644 3006393351 Bacteria 6615579
368 3006488645 3006486233 Bacteria 8157040
369 3006501775 3006493962 Bacteria 8825450
370 8008488832 8008485437 Bacteria 7198341
371 8008559543 8008558824 Bacteria 10610750
372 8008579609 8008574985 Bacteria 7815457
373 8023629274 8023623736 Bacteria 8593882
374 8025419322 8025413630 Bacteria 7014048
375 8025528315 8025524527 Bacteria 7197316
376 8025536994 8025530807 Bacteria 8495698
377 8047898947 8047893842 Bacteria 11723082
378 8048359972 8048356638 Bacteria 11044339
379 8048375905 8048369669 Bacteria 11666822
380 8048382302 8048379754 Bacteria 11877923
381 8048408388 8048406513 Bacteria 8936924
382 8056833908 8056829672 Bacteria 9045328
383 rootH1_10008017
384 rootH1_10051847
385 rootH2_10006696
386 rootH1_10013039
387 rootH1_10013040
388 JGI25160J50197_1029152
389 Ga0006562J51391_1093117
390 Ga0006562J51391_1093120
391 Ga0006562J51391_1185377
392 Ga0006562J51391_1185378
393 Ga0070698_100434934
394 Ga0068852_100259487
395 Ga0075368_10034915
396 Ga0075363_100267021
397 Ga0075367_10000161
398 Ga0075370_10060902
399 Ga0105245_10850768
400 Ga0105243_10669196
401 Ga0105248_10082204
402 Ga0105246_10526476
403 Ga0157369_10257901
404 Ga0157375_10044553
405 Ga0182008_10002208
406 Ga0182007_10001114
407 Ga0183367_1006
408 Ga0207426_1007331
409 Ga0207426_1010426
410 Ga0207647_10008338
411 Ga0207691_10327715
412 Ga0207698_10804517
413 Ga0209371_1021867
414 Ga0209813_10021721
415 Ga0307517_10022864
416 Ga0307515_10002026
417 Ga0307515_10097571
418 Ga0268256_1024628
419 Ga0307511_10011670
420 Ga0307511_10094112
421 Ga0307512_10028024
422 Ga0307512_10203959
423 Ga0307513_10003236
424 Ga0307513_10111438
425 Ga0307513_10262765
426 Ga0307509_10169114
427 Ga0307508_10004836
428 Ga0307508_10005742
429 Ga0307508_10075032
430 Ga0307508_10104529
431 Ga0307516_10025256
432 Ga0307516_10442946
433 Ga0307413_10252761
434 Ga0307518_10161596
435 Ga0307518_10192399
436 Ga0307416_100007396
437 Ga0307507_10031900
438 Ga0307507_10071132
439 Ga0307510_10052909
440 Ga0307510_10113676
441 Ga0395900_0250448
442 Ga0395898_0004019
443 Ga0395898_0004910
444 Ga0395898_0066824
445 Ga0395901_0048352
446 Ga0439436_0062447
447 Ga0439466_0032059
448 Ga0451802_0172145
449 Ga0451853_0146293
450 Ga0451853_0590716
451 Ga0439442_003614
452 Ga0439449_0001809
453 Ga0439449_0042637
454 Ga0439449_0065920
455 Ga0439454_035447
456 Ga0439455_0000884
457 Ga0439457_000074
458 Ga0439457_000457
459 Ga0439462_0002506
460 Ga0450894_000102
461 Ga0450899_001589
462 Ga0450903_000064
463 Ga0450903_027669
464 Ga0450906_003759
465 Ga0466969_0001526
466 Ga0466969_0051280
467 Ga0466969_0065847
468 Ga0466972_0003118
469 Ga0466972_0004350
470 Ga0466965_0019079
471 Ga0466965_0048521
472 Ga0466966_0002974
473 Ga0466966_0003602
474 Ga0466966_0006216
475 Ga0466966_0114086
476 Ga0466966_0334340
477 Ga0466961_0001173
478 Ga0466961_0012672
479 Ga0466963_0021090
480 Ga0466963_0057971
481 Ga0466964_0071364
482 Ga0466971_0000496
483 Ga0466968_0313360
484 Ga0466970_0000648
485 Ga0466970_0005179
486 Ga0466970_0184469
487 Ga0466957_0000456
488 Ga0466960_0004686
489 Ga0466960_0092396
490 Ga0466960_0225150
491 Ga0466959_0169118
492 Ga0466958_0000159
493 Ga0466967_0007231
494 Ga0466967_0108582
495 Ga0466967_0538846
496 Ga0495592_0012206
497 Ga0495603_0002324
498 Ga0495603_0004981
499 Ga0495603_0005266
500 Ga0495603_0017941
501 Ga0495603_0132596
502 Ga0495590_0193690
503 Ga0495629_0000761
504 Ga0495629_0001256
505 Ga0495629_0009699
506 Ga0495629_0027021
507 Ga0495629_0032122
508 Ga0495629_0059374
509 Ga0495638_0079115
510 Ga0495638_0144836
511 Ga0495651_0016217
512 Ga0495605_0198906
513 Ga0495639_0148870
514 Ga0495662_0033995
515 Ga0495662_0056948
516 Ga0495664_0112152
517 Ga0495664_0146953
518 Ga0495584_0165138
519 Ga0495594_0005563
520 Ga0495594_0008505
521 Ga0495596_0046477
522 Ga0495607_0090838
523 Ga0495606_0001850
524 Ga0495610_0014723
525 Ga0495616_0024469
526 Ga0495618_0040693
527 Ga0495620_0026355
528 Ga0495630_0036561
529 Ga0495630_0087797
530 Ga0495631_0012407
531 Ga0495637_0013972
532 Ga0495648_0112525
533 Ga0495666_0072986
534 Ga0495642_0019377
535 Ga0495642_0045707
536 Ga0495654_0018942
537 Ga0495640_0069256
538 Ga0495586_0151196
539 Ga0495587_0000928
540 Ga0495609_0014710
541 Ga0495597_0055373
542 Ga0495645_0015908
543 Ga0495645_0036830
544 Ga0495622_0002187
545 Ga0495622_0015364
546 Ga0495622_0074638
547 Ga0495633_0022597
548 Ga0495668_0078880
549 Ga0495634_0002582
550 Ga0495625_0017925
551 Ga0495625_0019889
552 Ga0495625_0141597
553 Ga0495635_0035674
554 Ga0495661_0063955
555 Ga0495588_0005435
556 Ga0495588_0018383
557 Ga0495588_0038245
558 Ga0495588_0063045
559 Ga0495657_0011786
560 Ga0495657_0019729
561 Ga0495646_0009464
562 Ga0495613_0000533
563 Ga0495613_0014792
564 Ga0495613_0061434
565 Ga0495613_0067692
566 Ga0495670_0040618
567 Ga0495670_0065294
568 Ga0495671_0017329
569 Ga0495649_0015681
570 Ga0495589_0023254
571 Ga0495589_0025224
572 Ga0495589_0036020
573 Ga0495660_0178300
574 Ga0495581_0022432
575 Ga0495581_0048367
576 Ga0495581_0085599
577 Ga0495604_0009379
578 Ga0495636_0002429
579 Ga0495636_0017494
580 Ga0495676_0000524
581 Ga0495676_0016168
582 Ga0495676_0074614
583 Ga0495676_0088870
584 Ga0495676_0189457
585 Ga0495683_0175144
586 Ga0495687_003257
587 Ga0495687_052488
588 Ga0495687_094473
589 Ga0495675_0002803
590 Ga0495675_0257831
591 Ga0495679_098523
592 Ga0495685_000950
593 Ga0495685_034931
594 Ga0495685_056858
595 Ga0495673_0029112
596 Ga0495681_0004919
597 Ga0495686_0037402
598 Ga0495686_0068330
599 Ga0495686_0074028
600 Ga0495593_0004563
601 Ga0495614_0002815
602 Ga0495614_0016471
603 Ga0495614_0037417
604 Ga0495614_0040160
605 Ga0495614_0063423
606 Ga0495626_0006904
607 Ga0496106_0109120
608 Ga0496110_0234392
609 Ga0495678_033181
610 Ga0501031_0259164
611 Ga0501032_0007696
612 Ga0501032_0049668
613 Ga0501032_0061832
614 Ga0501033_0017095
615 Ga0501033_0044008
616 Ga0501033_0051748
617 Ga0501033_0079925
618 Ga0501033_0141065
619 Ga0501034_0001747
620 Ga0501034_0025210
621 Ga0501034_0162119
622 Ga0501034_0265551
623 Ga0501034_0325828
624 Ga0501034_0441236
625 Ga0501036_0000809
626 Ga0501036_0047288
627 Ga0501036_0188132
628 Ga0501036_0263864
629 Ga0501037_0011503
630 Ga0501037_0034436
631 Ga0501037_0055841
632 Ga0501038_0067978
633 Ga0501038_0072530
634 Ga0501038_0145151
635 Ga0501038_0156896
636 Ga0501039_0065662
637 Ga0501039_0068967
638 Ga0501039_0170134
639 Ga0501039_0211090
640 Ga0501043_0066878
641 Ga0501043_0085067
642 Ga0501043_0416343
643 Ga0501046_0014208
644 Ga0501047_0005629
645 Ga0501047_0083740
646 Ga0501047_0132466
647 Ga0501047_0228593
648 Ga0501047_0580822
649 Ga0501048_0015630
650 Ga0501068_0100889
651 Ga0501070_0015323
652 Ga0501070_0363759
653 Ga0501073_0689783
654 Ga0501080_0130583
655 Ga0501035_0006265
656 Ga0501035_0025128
657 Ga0501035_0064664
658 Ga0501035_0076456
659 Ga0501035_0184966
660 Ga0501044_0025765
661 Ga0501044_0068514
662 Ga0501044_0093032
663 Ga0501044_0124386
664 Ga0501044_0178503
665 Ga0501044_0361634
666 Ga0501045_0143918
667 nmdc:mga0yw44_135218_c1
668 nmdc:mga06z11_2921_c1
669 nmdc:mga06z11_403156_c1
670 nmdc:mga04h51_11194_c1
671 nmdc:mga07m45_394523_c1
672 Ga0500578_0224092
673 Ga0500644_0036035
674 Ga0500651_0379980
675 Ga0500600_0075293
676 Ga0500634_0104286
677 Ga0466962_0011749
678 Ga0466962_0094540
679 3006427311
680 2547406842
681 2585301909
682 2585304831
683 2585319455
684 2616700737
685 2616899887
686 2643759760
687 2643897885
688 2643944679
689 2644179826
690 2644269260
691 2644385394
692 2644409030
693 2644431577
694 2644436388
695 2644462821
696 2644625760
697 2784587868
698 2785344277
699 2785368592
700 2786669696
701 2793976146
702 2808841276
703 2808919784
704 2809231455
705 2811848279
706 2812358982
707 2812481229
708 2819693670
709 2819742847
710 2852642222
711 2862288145
712 2862392574
713 2862509492
714 2862579999
715 2862711020
716 2863405530
717 2867348137
718 2867371098
719 2867431091
720 2875393796
721 2877681936
722 2912720904
723 2912759931
724 2918503825
725 2919468676
726 2946050857
727 2946066895
728 2946075223
729 2947230339
730 2954003651
731 2954387059
732 2954676104
733 2954688063
734 2954697895
735 2954704321
736 2954717006
737 2954726957
738 2954734840
739 2954745878
740 2954753712
741 2954764851
742 2966603282
743 2990046510
744 2990061892
745 2995471119
746 2997456551
747 3006321826
748 3006399644
749 3006488645
750 3006501775
751 8008488832
752 8008559543
753 8008579609
754 8023629274
755 8025419322
756 8025528315
757 8025536994
758 8047898947
759 8048359972
760 8048375905
761 8048382302
762 8048408388
763 8056833908

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mhw-assembly1.cif.gz_A crystal structure of thit with small molecule bat-25 0.6691 1 161
4hzu-assembly1.cif.gz_S structure of a bacterial energy-coupling factor transporter 0.6145 1 156
4mhw-assembly1.cif.gz_A crystal structure of thit with small molecule bat-25 0.6142 1 161
4z7f-assembly3.cif.gz_E crystal structure of folt bound with folic acid 0.5885 6 153
6qc4-assembly1.cif.gz_AK ovine respiratory supercomplex i+iii2 open class 3 0.5879 50 161
ID Description Score Start End Superfamily
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7105 1 164 1.10.1760.20
af_Q2FXS7_1_165_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.7031 1 164 1.10.1760.20
af_Q2FUT1_1_180_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6807 1 162 1.10.1760.20
4mhwA00 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6691 1 161 1.10.1760.20
af_Q2FUT1_1_180_1.10.1760.20 Mainly Alpha;Orthogonal Bundle;Arp2/3 complex 21 kDa subunit ARPC3; 0.6222 1 162 1.10.1760.20
ID Description Score Start End GO Terms
AF-A0A524BG64-F1-model_v4 Rod shape-determining protein MreD 0.949 1 168 GO:0005886
GO:0008360
AF-A0A7K0P6E0-F1-model_v4 Rod shape-determining protein MreD 0.9455 4 168 GO:0005886
GO:0008360
AF-A0A6I2Y2K1-F1-model_v4 Rod shape-determining protein MreD 0.9454 4 168 GO:0005886
GO:0008360
GO:0022857
AF-A0A6J7IV33-F1-model_v4 Unannotated protein 0.9438 1 168 GO:0005886
GO:0008360
AF-A0A6I2ZA65-F1-model_v4 deleted 0.9421 1 164

Map