F429065

General Info

Members Datasets Scaffolds Average Seq Length
381 215 762 304

Family's Representative Sequence

Representative Sequence 3300048910|Ga0496107_0022036|Ga0496107_0022036_660_1601
Length 313
Sequence MMADMGTLAIDHEITRDQHVWAFGPSMEPVLEVDPGAVIRLELNDCFTGQVTKESDLFTSLDLERVNSATGPIAVRGAEPGDSLVVELLEINPGPRGAAMIIPGFGQLISKVQSPVTRIFRVEDGTIHMNDRVSFPIRPMVGVIGCATDGEECINFLAGKHGGNLDNHLHGPGSTVYLPVRQPGGMLAIGDMHACMGDGEVSGTGVEIDGEVVIRVGVHKGAQGIWPVTELDDCWVTHGTTLGDLGGAIELACEEAARLLVDHWGFTIEDAFIFLSVACDVGIAQACQPSPASAIARVKVPKLSACPLPFWPA

Samples

Sample ID Description Type Environment
1 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
2 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
3 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
6 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
7 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
8 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
9 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
10 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
11 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
12 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
13 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
14 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
15 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
20 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
21 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
28 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
33 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
34 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
35 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
36 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
41 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
42 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
43 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
44 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
45 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
46 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
47 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
48 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
49 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
50 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
51 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
52 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
53 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
54 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
55 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
56 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
57 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
58 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
59 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
60 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
61 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
62 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
65 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
66 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
67 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
68 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
70 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
107 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
108 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
109 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
110 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
111 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
112 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
113 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
114 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
115 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
116 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
117 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
118 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
119 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
120 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
121 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
122 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
123 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
124 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
125 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
126 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
127 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
128 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
129 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
130 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
131 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
132 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
133 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
134 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
135 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
136 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
137 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
138 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
139 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
140 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
141 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
142 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
143 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
144 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
145 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
146 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
147 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
148 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
149 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
150 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
151 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
152 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
153 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
154 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
155 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
156 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
157 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
158 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
163 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
164 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
165 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
166 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
167 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
168 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
171 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
172 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
173 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
174 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
175 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
176 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
177 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
180 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
181 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
182 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
183 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
184 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
185 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
186 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
187 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
188 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
189 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
190 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
191 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
192 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
193 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
194 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
195 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
196 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
198 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
199 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
200 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
201 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
202 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
203 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
208 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
209 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
210 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
213 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
214 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 1.05
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 15.75
Rhizosphere 82.68
Stem 0
Stem Tuber 0
Unclassified 5.51

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496107_0022036 3300048910 Bacteria 4500
2 Ga0070680_100152263 3300005336 Bacteria 1942
3 Ga0070682_100026978 3300005337 Bacteria 3443
4 Ga0068868_100255935 3300005338 Bacteria 1475
5 Ga0070691_10015725 3300005341 Bacteria 3477
6 Ga0070687_100029884 3300005343 Bacteria 2658
7 Ga0070661_100020009 3300005344 Bacteria 4770
8 Ga0070692_10022080 3300005345 Bacteria 3105
9 Ga0070659_100024618 3300005366 Bacteria 4615
10 Ga0070659_100082947 3300005366 Bacteria 2561
11 Ga0070709_10029010 3300005434 Bacteria 3305
12 Ga0070714_100014208 3300005435 Bacteria 6394
13 Ga0070713_100013452 3300005436 Bacteria 6043
14 Ga0070710_10022528 3300005437 Bacteria 3296
15 Ga0070710_10079365 3300005437 Bacteria 1912
16 Ga0070701_10071434 3300005438 Bacteria 1857
17 Ga0070705_100010218 3300005440 Bacteria 4691
18 Ga0070663_100050326 3300005455 Bacteria 2963
19 Ga0070678_100056252 3300005456 Bacteria 2876
20 Ga0070681_10023064 3300005458 Bacteria 6258
21 Ga0070681_10088761 3300005458 Bacteria 3043
22 Ga0070681_10165150 3300005458 Bacteria 2137
23 Ga0068867_100223235 3300005459 Bacteria 1519
24 Ga0070707_100000839 3300005468 Bacteria 30414
25 Ga0070699_100103605 3300005518 Unclassified 2495
26 Ga0070699_100575780 3300005518 Bacteria 1026
27 Ga0070679_100006253 3300005530 Bacteria 11093
28 Ga0070679_100030878 3300005530 Bacteria 5293
29 Ga0070679_100035400 3300005530 Bacteria 4954
30 Ga0070679_100055514 3300005530 Bacteria 3944
31 Ga0070679_100115819 3300005530 Bacteria 2665
32 Ga0070679_100399415 3300005530 Bacteria 1320
33 Ga0070684_100005293 3300005535 Bacteria 9875
34 Ga0070684_100051965 3300005535 Bacteria 3562
35 Ga0070672_100081005 3300005543 Bacteria 2602
36 Ga0070686_100024526 3300005544 Bacteria 3616
37 Ga0070686_100158795 3300005544 Bacteria 1590
38 Ga0070695_100041289 3300005545 Bacteria 2923
39 Ga0070695_100351915 3300005545 Bacteria 1104
40 Ga0070696_100200530 3300005546 Unclassified 1489
41 Ga0070696_100276575 3300005546 Bacteria 1278
42 Ga0070693_100001481 3300005547 Bacteria 10570
43 Ga0070693_100060165 3300005547 Bacteria 2204
44 Ga0068855_100107302 3300005563 Bacteria 3208
45 Ga0068855_100622098 3300005563 Bacteria 1162
46 Ga0070664_100268039 3300005564 Bacteria 1538
47 Ga0068854_100243265 3300005578 Bacteria 1434
48 Ga0068856_100059744 3300005614 Bacteria 3765
49 Ga0070702_100020847 3300005615 Bacteria 3440
50 Ga0068852_100049450 3300005616 Bacteria 3597
51 Ga0068861_100030783 3300005719 Bacteria 3935
52 Ga0068862_100233095 3300005844 Bacteria 1671
53 Ga0068862_100272421 3300005844 Bacteria 1549
54 Ga0081455_10012583 3300005937 Bacteria 8435
55 Ga0081455_10040349 3300005937 Bacteria 4117
56 Ga0081455_10078390 3300005937 Bacteria 2715
57 Ga0081540_1000970 3300005983 Bacteria 25866
58 Ga0081540_1002114 3300005983 Bacteria 16550
59 Ga0081539_10004710 3300005985 Bacteria 14785
60 Ga0081539_10035780 3300005985 Bacteria 2979
61 Ga0070717_10048919 3300006028 Bacteria 3470
62 Ga0075432_10004793 3300006058 Bacteria 4602
63 Ga0075432_10008288 3300006058 Bacteria 3543
64 Ga0070715_10009908 3300006163 Bacteria 3377
65 Ga0070715_10037658 3300006163 Unclassified 2003
66 Ga0070716_100011144 3300006173 Bacteria 4525
67 Ga0097621_100057488 3300006237 Bacteria 3181
68 Ga0068871_100014093 3300006358 Bacteria 5945
69 Ga0075431_100528150 3300006847 Bacteria 1169
70 Ga0075433_10003025 3300006852 Bacteria 12918
71 Ga0075434_100076445 3300006871 Bacteria 3343
72 Ga0075435_100008079 3300007076 Bacteria 7533
73 Ga0105240_10033515 3300009093 Bacteria 6635
74 Ga0105240_10135727 3300009093 Bacteria 2947
75 Ga0105245_10025009 3300009098 Bacteria 5249
76 Ga0105245_10028189 3300009098 Bacteria 4952
77 Ga0105245_10031134 3300009098 Bacteria 4720
78 Ga0105245_10058392 3300009098 Bacteria 3473
79 Ga0105245_10771370 3300009098 Unclassified 998
80 Ga0114129_10014074 3300009147 Bacteria 11397
81 Ga0114129_10024503 3300009147 Bacteria 8550
82 Ga0114129_10544953 3300009147 Bacteria 1509
83 Ga0105243_10117639 3300009148 Bacteria 2235
84 Ga0105243_10306155 3300009148 Bacteria 1442
85 Ga0105243_10365807 3300009148 Unclassified 1329
86 Ga0105241_10023992 3300009174 Bacteria 4528
87 Ga0105241_10034226 3300009174 Bacteria 3815
88 Ga0105242_10106616 3300009176 Bacteria 2381
89 Ga0105248_10208672 3300009177 Bacteria 2201
90 Ga0105248_10236322 3300009177 Bacteria 2057
91 Ga0105248_10238064 3300009177 Bacteria 2049
92 Ga0157371_10149894 3300013102 Bacteria 1663
93 Ga0157370_10506020 3300013104 Bacteria 1109
94 Ga0157369_10007645 3300013105 Bacteria 12431
95 Ga0157369_10035732 3300013105 Bacteria 5447
96 Ga0157369_10046241 3300013105 Bacteria 4731
97 Ga0157378_10063611 3300013297 Bacteria 3297
98 Ga0163162_10058816 3300013306 Bacteria 3874
99 Ga0163162_10100959 3300013306 Bacteria 2977
100 Ga0163162_10193050 3300013306 Bacteria 2164
101 Ga0157372_10222154 3300013307 Bacteria 2189
102 Ga0157375_10005187 3300013308 Bacteria 11304
103 Ga0157375_10121806 3300013308 Bacteria 2718
104 Ga0157376_10054694 3300014969 Bacteria 3329
105 Ga0163161_10056176 3300017792 Bacteria 2859
106 Ga0197907_10041481 3300020069 Bacteria 3209
107 Ga0206354_10887674 3300020081 Bacteria 2798
108 Ga0206353_10552488 3300020082 Bacteria 6068
109 Ga0206353_11962381 3300020082 Bacteria 3099
110 Ga0213871_10018802 3300021441 Bacteria 1694
111 Ga0207692_10020770 3300025898 Bacteria 2993
112 Ga0207692_10052224 3300025898 Bacteria 2076
113 Ga0207642_10027545 3300025899 Bacteria 2327
114 Ga0207642_10172646 3300025899 Bacteria 1171
115 Ga0207688_10055291 3300025901 Bacteria 2228
116 Ga0207680_10174688 3300025903 Bacteria 1449
117 Ga0207699_10036591 3300025906 Bacteria 2799
118 Ga0207705_10094592 3300025909 Bacteria 2192
119 Ga0207684_10020039 3300025910 Bacteria 5715
120 Ga0207707_10075947 3300025912 Bacteria 2932
121 Ga0207707_10153209 3300025912 Bacteria 2015
122 Ga0207695_10050122 3300025913 Bacteria 4395
123 Ga0207693_10002681 3300025915 Bacteria 15453
124 Ga0207693_10003543 3300025915 Bacteria 13334
125 Ga0207693_10016990 3300025915 Bacteria 5810
126 Ga0207663_10000508 3300025916 Bacteria 17037
127 Ga0207660_10038385 3300025917 Bacteria 3343
128 Ga0207662_10021906 3300025918 Bacteria 3658
129 Ga0207657_10001687 3300025919 Bacteria 23810
130 Ga0207657_10047822 3300025919 Bacteria 3737
131 Ga0207649_10026513 3300025920 Bacteria 3391
132 Ga0207652_10086827 3300025921 Bacteria 2743
133 Ga0207652_10158968 3300025921 Bacteria 2025
134 Ga0207652_10333148 3300025921 Bacteria 1370
135 Ga0207646_10002452 3300025922 Bacteria 21902
136 Ga0207687_10063386 3300025927 Bacteria 2617
137 Ga0207687_10156344 3300025927 Bacteria 1745
138 Ga0207687_10215943 3300025927 Bacteria 1507
139 Ga0207700_10444192 3300025928 Bacteria 1142
140 Ga0207664_10003682 3300025929 Bacteria 10275
141 Ga0207664_10029502 3300025929 Bacteria 4179
142 Ga0207664_10096881 3300025929 Bacteria 2429
143 Ga0207690_10221672 3300025932 Bacteria 1447
144 Ga0207709_10064598 3300025935 Bacteria 2299
145 Ga0207709_10079601 3300025935 Bacteria 2107
146 Ga0207709_10120117 3300025935 Bacteria 1773
147 Ga0207665_10000735 3300025939 Bacteria 22043
148 Ga0207711_10139011 3300025941 Bacteria 2184
149 Ga0207711_10166681 3300025941 Bacteria 1997
150 Ga0207689_10230988 3300025942 Bacteria 1529
151 Ga0207661_10153385 3300025944 Bacteria 1993
152 Ga0207679_10094276 3300025945 Bacteria 2324
153 Ga0207667_10045359 3300025949 Bacteria 4656
154 Ga0207667_10046816 3300025949 Bacteria 4581
155 Ga0207667_10552738 3300025949 Bacteria 1164
156 Ga0207677_10315856 3300026023 Bacteria 1296
157 Ga0207708_10048095 3300026075 Bacteria 3247
158 Ga0207702_10023195 3300026078 Bacteria 5146
159 Ga0207702_10023868 3300026078 Bacteria 5073
160 Ga0207702_10068686 3300026078 Bacteria 3045
161 Ga0207648_10017967 3300026089 Bacteria 6414
162 Ga0207675_100001420 3300026118 Bacteria 23988
163 Ga0207675_100016925 3300026118 Bacteria 6813
164 Ga0207683_10004937 3300026121 Bacteria 11474
165 Ga0207683_10133949 3300026121 Bacteria 2230
166 Ga0207698_10605892 3300026142 Bacteria 1080
167 Ga0268264_10153112 3300028381 Bacteria 2069
168 Ga0265338_10002825 3300028800 Bacteria 25357
169 Ga0265338_10027980 3300028800 Bacteria 5638
170 Ga0265327_10015984 3300031251 Bacteria 4802
171 Ga0265316_10276225 3300031344 Unclassified 1228
172 Ga0265314_10012972 3300031711 Bacteria 6766
173 Ga0373930_0014473 3300034816 Bacteria 1470
174 Ga0373948_0003854 3300034817 Bacteria 2338
175 Ga0373958_0023247 3300034819 Bacteria 1165
176 Ga0373959_0005370 3300034820 Bacteria 2099
177 Ga0373926_0018906 3300035083 Bacteria 2374
178 Ga0373944_0009375 3300035089 Bacteria 2653
179 Ga0373944_0015679 3300035089 Bacteria 2130
180 Ga0373945_0009915 3300035116 Unclassified 3127
181 Ga0373943_0032313 3300035170 Bacteria 2487
182 Ga0373943_0076185 3300035170 Bacteria 1710
183 Ga0373946_0023892 3300035171 Bacteria 2391
184 Ga0373955_0054516 3300035172 Bacteria 2187
185 Ga0373961_0008292 3300035241 Bacteria 2527
186 Ga0373961_0052190 3300035241 Bacteria 1217
187 Ga0373924_0052199 3300035410 Bacteria 1697
188 Ga0373931_0034765 3300035691 Bacteria 2617
189 Ga0373931_0134224 3300035691 Bacteria 1428
190 Ga0373935_0307635 3300035692 Bacteria 1122
191 Ga0373933_0132028 3300035724 Bacteria 1571
192 Ga0373947_0008854 3300035725 Bacteria 5790
193 Ga0373947_0038529 3300035725 Bacteria 2840
194 Ga0395899_0004753 3300037312 Bacteria 10590
195 Ga0395899_0011394 3300037312 Bacteria 6809
196 Ga0395899_0246721 3300037312 Unclassified 1227
197 Ga0395900_0005118 3300037418 Bacteria 13767
198 Ga0395900_0011512 3300037418 Bacteria 9055
199 Ga0395900_0152050 3300037418 Bacteria 2364
200 Ga0395900_0204924 3300037418 Bacteria 1994
201 Ga0395900_0335001 3300037418 Bacteria 1490
202 Ga0395898_0004889 3300037466 Bacteria 14549
203 Ga0395898_0006299 3300037466 Bacteria 12685
204 Ga0395898_0081136 3300037466 Bacteria 3128
205 Ga0395898_0440689 3300037466 Unclassified 1241
206 Ga0395905_0009985 3300037471 Bacteria 9252
207 Ga0395905_0044929 3300037471 Bacteria 4144
208 Ga0395905_0118488 3300037471 Bacteria 2488
209 Ga0395905_0136939 3300037471 Bacteria 2304
210 Ga0395905_0144799 3300037471 Archaea 2236
211 Ga0395905_0235486 3300037471 Bacteria 1711
212 Ga0436364_0462118 3300037853 Bacteria 1498
213 Ga0395901_0005645 3300038443 Bacteria 12663
214 Ga0395901_0008378 3300038443 Bacteria 10454
215 Ga0395901_0010985 3300038443 Bacteria 9175
216 Ga0395901_0027778 3300038443 Bacteria 5818
217 Ga0395901_0031784 3300038443 Bacteria 5443
218 Ga0395901_0371951 3300038443 Bacteria 1472
219 Ga0395901_0677945 3300038443 Bacteria 1031
220 Ga0436365_0962624 3300039437 Bacteria 5824
221 Ga0436362_0833361 3300039453 Bacteria 1141
222 Ga0451800_1633976 3300041459 Bacteria 1635
223 Ga0451835_0854935 3300041492 Bacteria 1586
224 Ga0451847_0428179 3300041503 Bacteria 2768
225 Ga0451849_0892306 3300041505 Bacteria 1947
226 Ga0439455_0018184 3300042012 Bacteria 1646
227 Ga0466965_0039494 3300044683 Bacteria 2320
228 Ga0466966_0134282 3300044684 Bacteria 1514
229 Ga0466961_0047351 3300044693 Bacteria 2749
230 Ga0466963_0000936 3300044694 Bacteria 14914
231 Ga0466963_0000941 3300044694 Bacteria 14889
232 Ga0466963_0026942 3300044694 Bacteria 3676
233 Ga0466963_0079069 3300044694 Unclassified 2225
234 Ga0466971_0004637 3300044719 Bacteria 5939
235 Ga0466968_0006953 3300044735 Bacteria 4287
236 Ga0466970_0086828 3300044765 Bacteria 1696
237 Ga0466959_0017612 3300045049 Bacteria 5238
238 Ga0466959_0076574 3300045049 Bacteria 2415
239 Ga0466959_0118911 3300045049 Bacteria 1880
240 Ga0466958_0002214 3300045836 Bacteria 9690
241 Ga0466958_0036928 3300045836 Bacteria 2926
242 Ga0466958_0055896 3300045836 Bacteria 2396
243 Ga0466967_0009506 3300045976 Bacteria 7218
244 Ga0495603_0000100 3300046455 Bacteria 40133
245 Ga0495603_0134126 3300046455 Bacteria 1441
246 Ga0495629_0020242 3300046459 Bacteria 4751
247 Ga0495641_0000408 3300046461 Bacteria 35717
248 Ga0495641_0004462 3300046461 Bacteria 9874
249 Ga0495651_0027196 3300046462 Bacteria 4456
250 Ga0495653_0061046 3300046463 Bacteria 2853
251 Ga0495582_0004489 3300046473 Bacteria 7845
252 Ga0495582_0059144 3300046473 Bacteria 2114
253 Ga0495639_0021162 3300046475 Bacteria 2845
254 Ga0495662_0013158 3300046476 Unclassified 4029
255 Ga0495584_0101116 3300046491 Unclassified 1457
256 Ga0495594_0000700 3300046499 Bacteria 17239
257 Ga0495594_0036717 3300046499 Unclassified 2673
258 Ga0495608_0003415 3300046511 Bacteria 11374
259 Ga0495628_0082198 3300046516 Bacteria 2502
260 Ga0495630_0086961 3300046517 Bacteria 2360
261 Ga0495666_0046823 3300046526 Bacteria 2084
262 Ga0495642_0119968 3300046528 Bacteria 1128
263 Ga0495665_0001870 3300046531 Bacteria 11375
264 Ga0495665_0117527 3300046531 Unclassified 1393
265 Ga0495640_0026288 3300046533 Bacteria 4208
266 Ga0495640_0046460 3300046533 Unclassified 3008
267 Ga0495645_0116679 3300046543 Bacteria 1884
268 Ga0495667_0006531 3300046559 Bacteria 7916
269 Ga0495667_0034902 3300046559 Bacteria 3363
270 Ga0495667_0054170 3300046559 Bacteria 2640
271 Ga0495667_0105281 3300046559 Bacteria 1823
272 Ga0495634_0045077 3300046642 Unclassified 2983
273 Ga0495635_0025236 3300046663 Unclassified 4139
274 Ga0495635_0039693 3300046663 Bacteria 3255
275 Ga0495635_0228512 3300046663 Bacteria 1257
276 Ga0495588_0002196 3300046674 Bacteria 8356
277 Ga0495647_0001087 3300046681 Bacteria 8284
278 Ga0495658_0045442 3300046683 Bacteria 2464
279 Ga0495613_0003752 3300046689 Bacteria 11385
280 Ga0495624_0005103 3300046690 Bacteria 9493
281 Ga0495624_0138098 3300046690 Unclassified 1494
282 Ga0495600_0010098 3300046809 Bacteria 5851
283 Ga0495600_0208853 3300046809 Bacteria 1252
284 Ga0495581_0001589 3300047315 Bacteria 12677
285 Ga0495581_0004317 3300047315 Bacteria 8203
286 Ga0495674_0015835 3300047319 Bacteria 7039
287 Ga0495674_0181548 3300047319 Bacteria 1752
288 Ga0495676_0002049 3300047321 Bacteria 17745
289 Ga0495676_0014600 3300047321 Bacteria 7024
290 Ga0495676_0015483 3300047321 Bacteria 6789
291 Ga0495680_0002336 3300047322 Bacteria 19447
292 Ga0495680_0030143 3300047322 Bacteria 4433
293 Ga0495680_0041091 3300047322 Bacteria 3678
294 Ga0495684_0002176 3300047471 Bacteria 15691
295 Ga0495684_0006233 3300047471 Bacteria 9267
296 Ga0495684_0065405 3300047471 Bacteria 2764
297 Ga0495614_0022923 3300048089 Bacteria 2692
298 Ga0496100_0022961 3300048903 Bacteria 3782
299 Ga0496100_0045805 3300048903 Bacteria 2808
300 Ga0496100_0453002 3300048903 Bacteria 984
301 Ga0496101_0023709 3300048904 Bacteria 4242
302 Ga0496101_0046886 3300048904 Bacteria 3100
303 Ga0496101_0281892 3300048904 Bacteria 1299
304 Ga0496101_0284013 3300048904 Bacteria 1294
305 Ga0496102_0204905 3300048905 Bacteria 1859
306 Ga0496102_0386135 3300048905 Bacteria 1317
307 Ga0496102_0487683 3300048905 Bacteria 1154
308 Ga0496103_0002119 3300048906 Bacteria 12620
309 Ga0496103_0044523 3300048906 Unclassified 2735
310 Ga0496104_0012428 3300048907 Bacteria 7655
311 Ga0496104_0021504 3300048907 Bacteria 5924
312 Ga0496104_0027022 3300048907 Bacteria 5306
313 Ga0496104_0034683 3300048907 Bacteria 4708
314 Ga0496104_0061550 3300048907 Bacteria 3559
315 Ga0496105_0046047 3300048908 Bacteria 3600
316 Ga0496105_0052344 3300048908 Bacteria 3372
317 Ga0496105_0101715 3300048908 Bacteria 2373
318 Ga0496105_0114157 3300048908 Bacteria 2228
319 Ga0496105_0185948 3300048908 Bacteria 1700
320 Ga0496107_0054965 3300048910 Bacteria 2874
321 Ga0496107_0203026 3300048910 Bacteria 1473
322 Ga0496108_0007244 3300048911 Bacteria 8993
323 Ga0496108_0044388 3300048911 Bacteria 3711
324 Ga0496108_0096852 3300048911 Bacteria 2514
325 Ga0496108_0151325 3300048911 Bacteria 2002
326 Ga0496109_0001573 3300048912 Bacteria 19040
327 Ga0496109_0006193 3300048912 Bacteria 10055
328 Ga0496109_0008842 3300048912 Bacteria 8575
329 Ga0496109_0036855 3300048912 Bacteria 4416
330 Ga0496109_0179648 3300048912 Bacteria 1987
331 Ga0496109_0373848 3300048912 Bacteria 1346
332 Ga0496109_0457961 3300048912 Bacteria 1205
333 Ga0496110_0008386 3300048913 Bacteria 8314
334 Ga0496110_0056909 3300048913 Bacteria 3441
335 Ga0496110_0111473 3300048913 Bacteria 2459
336 Ga0496110_0201064 3300048913 Bacteria 1810
337 Ga0496111_0004918 3300048914 Bacteria 8486
338 Ga0496112_0007214 3300048915 Bacteria 9852
339 Ga0496112_0017038 3300048915 Bacteria 6822
340 Ga0496112_0052568 3300048915 Bacteria 3998
341 Ga0496112_0074424 3300048915 Bacteria 3358
342 Ga0496112_0129919 3300048915 Bacteria 2490
343 Ga0496112_0201546 3300048915 Bacteria 1949
344 Ga0496112_0210451 3300048915 Bacteria 1902
345 Ga0496112_0256766 3300048915 Bacteria 1698
346 Ga0496113_0071325 3300048916 Bacteria 2642
347 Ga0496113_0271754 3300048916 Bacteria 1355
348 Ga0496114_0001098 3300048917 Bacteria 20419
349 Ga0496114_0052929 3300048917 Bacteria 3383
350 Ga0496114_0091930 3300048917 Bacteria 2577
351 Ga0496114_0112216 3300048917 Bacteria 2337
352 Ga0496114_0137322 3300048917 Bacteria 2115
353 Ga0496114_0144593 3300048917 Bacteria 2061
354 Ga0496114_0167583 3300048917 Bacteria 1913
355 Ga0496115_0009124 3300048918 Bacteria 7362
356 Ga0501034_0237933 3300049571 Bacteria 1768
357 Ga0501042_0042680 3300049578 Bacteria 3229
358 Ga0501047_0245282 3300049581 Bacteria 1641
359 Ga0501067_0032604 3300049583 Bacteria 2892
360 Ga0501069_0094553 3300049585 Bacteria 1692
361 Ga0501072_0063578 3300049588 Bacteria 2911
362 Ga0501075_0035953 3300049591 Bacteria 3695
363 Ga0501076_0364375 3300049592 Bacteria 1187
364 Ga0501035_0130234 3300049822 Bacteria 2194
365 nmdc:mga03n38_132598_c1 3300050490 Unclassified 1236
366 nmdc:mga05p37_7957_c1 3300050507 Bacteria 12512
367 nmdc:mga06r32_287037_c1 3300050510 Bacteria 1632
368 nmdc:mga0n895_217707_c1 3300050512 Bacteria 1939
369 nmdc:mga0n895_35631_c1 3300050512 Bacteria 4800
370 nmdc:mga0rr50_126439_c1 3300050513 Bacteria 2042
371 nmdc:mga0rr50_1472_c1 3300050513 Bacteria 12948
372 nmdc:mga08x19_8789_c1 3300050514 Bacteria 6027
373 nmdc:mga0a205_23913_c1 3300050515 Bacteria 5800
374 Ga0495601_0021372 3300053077 Unclassified 3963
375 Ga0495595_0001368 3300053084 Bacteria 9464
376 Ga0495595_0007348 3300053084 Bacteria 4510
377 Ga0495619_0002590 3300053085 Bacteria 11818
378 Ga0495619_0012014 3300053085 Bacteria 5456
379 Ga0495619_0059653 3300053085 Bacteria 2535
380 Ga0495619_0175751 3300053085 Bacteria 1481
381 Ga0466962_0001315 3300061719 Bacteria 11457
382 Ga0496107_0022036
383 Ga0070680_100152263
384 Ga0070682_100026978
385 Ga0068868_100255935
386 Ga0070691_10015725
387 Ga0070687_100029884
388 Ga0070661_100020009
389 Ga0070692_10022080
390 Ga0070659_100024618
391 Ga0070659_100082947
392 Ga0070709_10029010
393 Ga0070714_100014208
394 Ga0070713_100013452
395 Ga0070710_10022528
396 Ga0070710_10079365
397 Ga0070701_10071434
398 Ga0070705_100010218
399 Ga0070663_100050326
400 Ga0070678_100056252
401 Ga0070681_10023064
402 Ga0070681_10088761
403 Ga0070681_10165150
404 Ga0068867_100223235
405 Ga0070707_100000839
406 Ga0070699_100103605
407 Ga0070699_100575780
408 Ga0070679_100006253
409 Ga0070679_100030878
410 Ga0070679_100035400
411 Ga0070679_100055514
412 Ga0070679_100115819
413 Ga0070679_100399415
414 Ga0070684_100005293
415 Ga0070684_100051965
416 Ga0070672_100081005
417 Ga0070686_100024526
418 Ga0070686_100158795
419 Ga0070695_100041289
420 Ga0070695_100351915
421 Ga0070696_100200530
422 Ga0070696_100276575
423 Ga0070693_100001481
424 Ga0070693_100060165
425 Ga0068855_100107302
426 Ga0068855_100622098
427 Ga0070664_100268039
428 Ga0068854_100243265
429 Ga0068856_100059744
430 Ga0070702_100020847
431 Ga0068852_100049450
432 Ga0068861_100030783
433 Ga0068862_100233095
434 Ga0068862_100272421
435 Ga0081455_10012583
436 Ga0081455_10040349
437 Ga0081455_10078390
438 Ga0081540_1000970
439 Ga0081540_1002114
440 Ga0081539_10004710
441 Ga0081539_10035780
442 Ga0070717_10048919
443 Ga0075432_10004793
444 Ga0075432_10008288
445 Ga0070715_10009908
446 Ga0070715_10037658
447 Ga0070716_100011144
448 Ga0097621_100057488
449 Ga0068871_100014093
450 Ga0075431_100528150
451 Ga0075433_10003025
452 Ga0075434_100076445
453 Ga0075435_100008079
454 Ga0105240_10033515
455 Ga0105240_10135727
456 Ga0105245_10025009
457 Ga0105245_10028189
458 Ga0105245_10031134
459 Ga0105245_10058392
460 Ga0105245_10771370
461 Ga0114129_10014074
462 Ga0114129_10024503
463 Ga0114129_10544953
464 Ga0105243_10117639
465 Ga0105243_10306155
466 Ga0105243_10365807
467 Ga0105241_10023992
468 Ga0105241_10034226
469 Ga0105242_10106616
470 Ga0105248_10208672
471 Ga0105248_10236322
472 Ga0105248_10238064
473 Ga0157371_10149894
474 Ga0157370_10506020
475 Ga0157369_10007645
476 Ga0157369_10035732
477 Ga0157369_10046241
478 Ga0157378_10063611
479 Ga0163162_10058816
480 Ga0163162_10100959
481 Ga0163162_10193050
482 Ga0157372_10222154
483 Ga0157375_10005187
484 Ga0157375_10121806
485 Ga0157376_10054694
486 Ga0163161_10056176
487 Ga0197907_10041481
488 Ga0206354_10887674
489 Ga0206353_10552488
490 Ga0206353_11962381
491 Ga0213871_10018802
492 Ga0207692_10020770
493 Ga0207692_10052224
494 Ga0207642_10027545
495 Ga0207642_10172646
496 Ga0207688_10055291
497 Ga0207680_10174688
498 Ga0207699_10036591
499 Ga0207705_10094592
500 Ga0207684_10020039
501 Ga0207707_10075947
502 Ga0207707_10153209
503 Ga0207695_10050122
504 Ga0207693_10002681
505 Ga0207693_10003543
506 Ga0207693_10016990
507 Ga0207663_10000508
508 Ga0207660_10038385
509 Ga0207662_10021906
510 Ga0207657_10001687
511 Ga0207657_10047822
512 Ga0207649_10026513
513 Ga0207652_10086827
514 Ga0207652_10158968
515 Ga0207652_10333148
516 Ga0207646_10002452
517 Ga0207687_10063386
518 Ga0207687_10156344
519 Ga0207687_10215943
520 Ga0207700_10444192
521 Ga0207664_10003682
522 Ga0207664_10029502
523 Ga0207664_10096881
524 Ga0207690_10221672
525 Ga0207709_10064598
526 Ga0207709_10079601
527 Ga0207709_10120117
528 Ga0207665_10000735
529 Ga0207711_10139011
530 Ga0207711_10166681
531 Ga0207689_10230988
532 Ga0207661_10153385
533 Ga0207679_10094276
534 Ga0207667_10045359
535 Ga0207667_10046816
536 Ga0207667_10552738
537 Ga0207677_10315856
538 Ga0207708_10048095
539 Ga0207702_10023195
540 Ga0207702_10023868
541 Ga0207702_10068686
542 Ga0207648_10017967
543 Ga0207675_100001420
544 Ga0207675_100016925
545 Ga0207683_10004937
546 Ga0207683_10133949
547 Ga0207698_10605892
548 Ga0268264_10153112
549 Ga0265338_10002825
550 Ga0265338_10027980
551 Ga0265327_10015984
552 Ga0265316_10276225
553 Ga0265314_10012972
554 Ga0373930_0014473
555 Ga0373948_0003854
556 Ga0373958_0023247
557 Ga0373959_0005370
558 Ga0373926_0018906
559 Ga0373944_0009375
560 Ga0373944_0015679
561 Ga0373945_0009915
562 Ga0373943_0032313
563 Ga0373943_0076185
564 Ga0373946_0023892
565 Ga0373955_0054516
566 Ga0373961_0008292
567 Ga0373961_0052190
568 Ga0373924_0052199
569 Ga0373931_0034765
570 Ga0373931_0134224
571 Ga0373935_0307635
572 Ga0373933_0132028
573 Ga0373947_0008854
574 Ga0373947_0038529
575 Ga0395899_0004753
576 Ga0395899_0011394
577 Ga0395899_0246721
578 Ga0395900_0005118
579 Ga0395900_0011512
580 Ga0395900_0152050
581 Ga0395900_0204924
582 Ga0395900_0335001
583 Ga0395898_0004889
584 Ga0395898_0006299
585 Ga0395898_0081136
586 Ga0395898_0440689
587 Ga0395905_0009985
588 Ga0395905_0044929
589 Ga0395905_0118488
590 Ga0395905_0136939
591 Ga0395905_0144799
592 Ga0395905_0235486
593 Ga0436364_0462118
594 Ga0395901_0005645
595 Ga0395901_0008378
596 Ga0395901_0010985
597 Ga0395901_0027778
598 Ga0395901_0031784
599 Ga0395901_0371951
600 Ga0395901_0677945
601 Ga0436365_0962624
602 Ga0436362_0833361
603 Ga0451800_1633976
604 Ga0451835_0854935
605 Ga0451847_0428179
606 Ga0451849_0892306
607 Ga0439455_0018184
608 Ga0466965_0039494
609 Ga0466966_0134282
610 Ga0466961_0047351
611 Ga0466963_0000936
612 Ga0466963_0000941
613 Ga0466963_0026942
614 Ga0466963_0079069
615 Ga0466971_0004637
616 Ga0466968_0006953
617 Ga0466970_0086828
618 Ga0466959_0017612
619 Ga0466959_0076574
620 Ga0466959_0118911
621 Ga0466958_0002214
622 Ga0466958_0036928
623 Ga0466958_0055896
624 Ga0466967_0009506
625 Ga0495603_0000100
626 Ga0495603_0134126
627 Ga0495629_0020242
628 Ga0495641_0000408
629 Ga0495641_0004462
630 Ga0495651_0027196
631 Ga0495653_0061046
632 Ga0495582_0004489
633 Ga0495582_0059144
634 Ga0495639_0021162
635 Ga0495662_0013158
636 Ga0495584_0101116
637 Ga0495594_0000700
638 Ga0495594_0036717
639 Ga0495608_0003415
640 Ga0495628_0082198
641 Ga0495630_0086961
642 Ga0495666_0046823
643 Ga0495642_0119968
644 Ga0495665_0001870
645 Ga0495665_0117527
646 Ga0495640_0026288
647 Ga0495640_0046460
648 Ga0495645_0116679
649 Ga0495667_0006531
650 Ga0495667_0034902
651 Ga0495667_0054170
652 Ga0495667_0105281
653 Ga0495634_0045077
654 Ga0495635_0025236
655 Ga0495635_0039693
656 Ga0495635_0228512
657 Ga0495588_0002196
658 Ga0495647_0001087
659 Ga0495658_0045442
660 Ga0495613_0003752
661 Ga0495624_0005103
662 Ga0495624_0138098
663 Ga0495600_0010098
664 Ga0495600_0208853
665 Ga0495581_0001589
666 Ga0495581_0004317
667 Ga0495674_0015835
668 Ga0495674_0181548
669 Ga0495676_0002049
670 Ga0495676_0014600
671 Ga0495676_0015483
672 Ga0495680_0002336
673 Ga0495680_0030143
674 Ga0495680_0041091
675 Ga0495684_0002176
676 Ga0495684_0006233
677 Ga0495684_0065405
678 Ga0495614_0022923
679 Ga0496100_0022961
680 Ga0496100_0045805
681 Ga0496100_0453002
682 Ga0496101_0023709
683 Ga0496101_0046886
684 Ga0496101_0281892
685 Ga0496101_0284013
686 Ga0496102_0204905
687 Ga0496102_0386135
688 Ga0496102_0487683
689 Ga0496103_0002119
690 Ga0496103_0044523
691 Ga0496104_0012428
692 Ga0496104_0021504
693 Ga0496104_0027022
694 Ga0496104_0034683
695 Ga0496104_0061550
696 Ga0496105_0046047
697 Ga0496105_0052344
698 Ga0496105_0101715
699 Ga0496105_0114157
700 Ga0496105_0185948
701 Ga0496107_0054965
702 Ga0496107_0203026
703 Ga0496108_0007244
704 Ga0496108_0044388
705 Ga0496108_0096852
706 Ga0496108_0151325
707 Ga0496109_0001573
708 Ga0496109_0006193
709 Ga0496109_0008842
710 Ga0496109_0036855
711 Ga0496109_0179648
712 Ga0496109_0373848
713 Ga0496109_0457961
714 Ga0496110_0008386
715 Ga0496110_0056909
716 Ga0496110_0111473
717 Ga0496110_0201064
718 Ga0496111_0004918
719 Ga0496112_0007214
720 Ga0496112_0017038
721 Ga0496112_0052568
722 Ga0496112_0074424
723 Ga0496112_0129919
724 Ga0496112_0201546
725 Ga0496112_0210451
726 Ga0496112_0256766
727 Ga0496113_0071325
728 Ga0496113_0271754
729 Ga0496114_0001098
730 Ga0496114_0052929
731 Ga0496114_0091930
732 Ga0496114_0112216
733 Ga0496114_0137322
734 Ga0496114_0144593
735 Ga0496114_0167583
736 Ga0496115_0009124
737 Ga0501034_0237933
738 Ga0501042_0042680
739 Ga0501047_0245282
740 Ga0501067_0032604
741 Ga0501069_0094553
742 Ga0501072_0063578
743 Ga0501075_0035953
744 Ga0501076_0364375
745 Ga0501035_0130234
746 nmdc:mga03n38_132598_c1
747 nmdc:mga05p37_7957_c1
748 nmdc:mga06r32_287037_c1
749 nmdc:mga0n895_217707_c1
750 nmdc:mga0n895_35631_c1
751 nmdc:mga0rr50_126439_c1
752 nmdc:mga0rr50_1472_c1
753 nmdc:mga08x19_8789_c1
754 nmdc:mga0a205_23913_c1
755 Ga0495601_0021372
756 Ga0495595_0001368
757 Ga0495595_0007348
758 Ga0495619_0002590
759 Ga0495619_0012014
760 Ga0495619_0059653
761 Ga0495619_0175751
762 Ga0466962_0001315

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03069

FmdA_AmdA

Acetamidase/Formamidase family

11

155

0.88

PF03069

FmdA_AmdA

Acetamidase/Formamidase family

150

302

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
2ii1-assembly2.cif.gz_B crystal structure of acetamidase (10172637) from bacillus halodurans at 1.95 a resolution 0.9764 8 296
3tkk-assembly2.cif.gz_D crystal structure analysis of a recombinant predicted acetamidase/ formamidase from the thermophile thermoanaerobacter tengcongensis 0.974 7 296
2f4l-assembly2.cif.gz_C crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.9678 7 297
2f4l-assembly1.cif.gz_B crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.9674 7 297
2f4l-assembly1.cif.gz_A crystal structure of a putative acetamidase (tm0119) from thermotoga maritima msb8 at 2.50 a resolution 0.9649 7 297
ID Description Score Start End Superfamily
1sd5A02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9659 240 272 1.10.10.10
2f4lB01 Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains 0.9631 7 215 2.60.120.580
2f4lB01 Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains 0.9436 7 215 2.60.120.580
af_Q5AJF2_20_284_2.60.120.580 Mainly Beta;Sandwich;Jelly Rolls;Acetamidase/Formamidase-like domains 0.919 11 212 2.60.120.580
2f4lD03 Alpha Beta;Roll;Endonuclease I-creI;Acetamidase/Formamidase-like domains 0.9186 221 297 3.10.28.20
ID Description Score Start End GO Terms
AF-A0A538IJD0-F1-model_v4 Acetamidase 0.9952 7 307 GO:0016811
AF-A0A538L8G9-F1-model_v4 Acetamidase 0.9937 7 308 GO:0016811
AF-S5ZIQ0-F1-model_v4 Formamidase 0.9876 8 225 GO:0016811
AF-A0A538IJD0-F1-model_v4 Acetamidase 0.9854 7 307 GO:0016811
AF-A0A3C0FE07-F1-model_v4 Acetamidase 0.9841 8 271 GO:0016811

Map