F429042

General Info

Members Datasets Scaffolds Average Seq Length
381 114 306 948

Family's Representative Sequence

Representative Sequence 3300046492|Ga0495585_0001142|Ga0495585_0001142_914_3961
Length 1015
Sequence VFTILSNSHGPAAVAELVDPIATQCFTLIDKTAGHEPADHKKDGEFMQQRTKIALAVAVAIQSLGAYAQTQDAAPQRVEITGSRIRQVDLETAQPVQVMTQEQIQKSGLVTVGDIIANLSSTGTPAFSKGSTLTSNREQGGQYADMRGLGSQRLLVLVNGKRWSQTVAGYTDMSTIPSALIDRVEILKDGASSIYGSDAIAGVLNIILKKTMQGGQASIYTGQNEMGDGKTKDYSVSYGAGDEKSSLIFALTRSEQAPVWAKDRAITATSYGPDHLNAGFGTGPWGRIAPLTASGAANTGASGFNKYLNHTGSYNGDGTGSDARNKANYHDYAGADADTFNSTNQMMLLSPTALTSIFTKGSIALPMDMRFTTTAMYAQRDSSRQIAGYPLSSTAQSKYPVYIDKDNYYNPYGNQAPGVAAGQGQDLFFYRRTIEVPRVTDNQNRTLHIDATLEGEFAVAGKPWNWSAGYNHSAVSGSVLSTGNLNLLNLKKSLGPSFKNASGVVQCGTPGAPISLAECVPWDILGGPSASTKAALDYNMSVGQATYGSTXXXXTADLTGELFTLPAGALAAAAGLEHRTVRGYDRPGQFEQSGFSTDLAGNPTIGKYTVKEAYLELNIPLLKNVPLAELLSVDLATRHSEYSNFGKTNNSKASFMWKPVKDLLTRGTYAQGFRAPTVGDTFGGGQQSFDSYLDACDSAWGDAAKTPTTAARCAAGGVPAGFRQKNQAGTPVPAGGAQTPTPFNTGAGNADLTPETAVTRTLGVVFSPAWLNGFSASIDAFDISVRNRITGVSAGYEIDQCYVFGVQSFCDKIKRDPVTGQIVNLSRGNANLGELRTKGFDLTVGYRLPRTAFGQFNVRSESTYVSSFSIKSTATSDWFNYAGEYGNNRVKSNLGIDWNMGNWSATLGTRYYSPVKTRCWSNTATSVVECSNPAEKTSWGTGYNREAAEIYNDLSVAYATPWNGKIMVGANNVFDKKPKVIYNAASGFGGASSSSAVNPVYPIDRFFYVRYNQSF

Samples

Sample ID Description Type Environment
1 2643221556 Massilia sp. Root1485 Isolate Unclassified
2 2643221684 Massilia sp. Root133 Isolate Unclassified
3 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
4 2885080285 Janthinobacterium sp. AD80 Isolate Rhizosphere
5 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
6 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
7 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
8 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
9 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
10 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
11 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
12 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
13 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
14 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
15 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
16 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
17 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
18 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
19 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
20 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
21 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
22 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
23 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
24 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
25 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
26 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
27 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
28 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
29 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
30 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
31 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
32 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
33 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
34 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
35 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
36 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
37 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
38 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
39 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
40 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
41 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
42 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
43 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
44 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
45 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
46 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
47 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
48 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
49 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
50 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
51 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
52 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
53 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
54 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
55 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
56 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
57 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
58 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
59 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
60 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
61 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
62 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
63 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
64 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
65 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
66 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
67 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
68 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
69 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
70 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
71 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
72 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
73 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
74 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
75 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
76 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
77 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
78 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
79 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
80 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
81 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
82 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
83 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
84 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
85 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
86 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
87 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
88 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
89 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
90 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
91 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
92 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
93 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
94 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
95 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
96 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
97 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
98 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
99 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
100 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
101 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
102 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
103 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
104 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
105 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
106 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
107 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
108 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
109 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
110 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
111 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
112 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
113 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
114 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.9
Metatranscriptomes 0.52
Isolates 1.57

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.31
Nodule 0
Rhizoplane 1.31
Rhizosphere 95.8
Stem 0
Stem Tuber 0
Unclassified 1.57

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootL2_10038209 3300003322 Bacteria 3903
2 rootL2_10038210 3300003322 Bacteria 10588
3 Ga0065165_1000001 3300005262 Bacteria 494087
4 Ga0065165_1000643 3300005262 Bacteria 50544
5 Ga0068855_100061778 3300005563 Bacteria 4376
6 Ga0105243_10006646 3300009148 Bacteria 8926
7 Ga0157371_10000010 3300013102 Bacteria 384921
8 Ga0182008_10002934 3300014497 Bacteria 10512
9 Ga0209148_1000818 3300025254 Bacteria 22432
10 Ga0395899_0007470 3300037312 Bacteria 8443
11 Ga0395899_0021435 3300037312 Bacteria 4901
12 Ga0395900_0002832 3300037418 Bacteria 18932
13 Ga0395900_0003010 3300037418 Bacteria 18329
14 Ga0395900_0009781 3300037418 Bacteria 9826
15 Ga0395900_0027725 3300037418 Bacteria 5802
16 Ga0395900_0034874 3300037418 Bacteria 5183
17 Ga0395900_0043648 3300037418 Bacteria 4621
18 Ga0395898_0032939 3300037466 Bacteria 5172
19 Ga0395905_0025119 3300037471 Bacteria 5619
20 Ga0395905_0038092 3300037471 Bacteria 4511
21 Ga0395905_0040027 3300037471 Bacteria 4397
22 Ga0395905_0051407 3300037471 Bacteria 3860
23 Ga0395901_0000633 3300038443 Bacteria 40828
24 Ga0395901_0007405 3300038443 Bacteria 11074
25 Ga0439448_0003527 3300042005 Bacteria 4340
26 Ga0439450_002937 3300042008 Bacteria 2755
27 Ga0439455_0001130 3300042012 Bacteria 4288
28 Ga0450904_000335 3300042139 Bacteria 9940
29 Ga0466965_0002729 3300044683 Bacteria 7560
30 Ga0466965_0014118 3300044683 Bacteria 3778
31 Ga0466966_0012016 3300044684 Bacteria 5738
32 Ga0466961_0000877 3300044693 Bacteria 18689
33 Ga0466961_0026305 3300044693 Bacteria 3741
34 Ga0466964_0001979 3300044706 Bacteria 7190
35 Ga0453684_0029062 3300044712 Bacteria 7865
36 Ga0466971_0007132 3300044719 Bacteria 4863
37 Ga0466968_0000696 3300044735 Bacteria 11611
38 Ga0466957_0003742 3300044842 Bacteria 8406
39 Ga0466957_0007754 3300044842 Bacteria 6075
40 Ga0466967_0009203 3300045976 Bacteria 7312
41 Ga0466967_0054735 3300045976 Bacteria 3513
42 Ga0495617_000014 3300046452 Bacteria 286979
43 Ga0495617_000276 3300046452 Bacteria 29626
44 Ga0495627_000355 3300046453 Bacteria 43041
45 Ga0495627_003894 3300046453 Bacteria 6389
46 Ga0495627_005549 3300046453 Bacteria 5060
47 Ga0495603_0008896 3300046455 Bacteria 6072
48 Ga0495603_0012698 3300046455 Bacteria 5096
49 Ga0495590_0000063 3300046457 Bacteria 81777
50 Ga0495590_0000943 3300046457 Bacteria 12875
51 Ga0495591_000391 3300046458 Bacteria 36958
52 Ga0495629_0007847 3300046459 Bacteria 7852
53 Ga0495638_0003247 3300046460 Bacteria 12842
54 Ga0495653_0026152 3300046463 Bacteria 4683
55 Ga0495653_0034864 3300046463 Bacteria 3974
56 Ga0495650_0000260 3300046471 Bacteria 101837
57 Ga0495650_0000441 3300046471 Bacteria 66713
58 Ga0495580_0018804 3300046472 Bacteria 5141
59 Ga0495582_0000953 3300046473 Bacteria 16129
60 Ga0495582_0014531 3300046473 Bacteria 4326
61 Ga0495582_0030018 3300046473 Bacteria 2983
62 Ga0495605_0000265 3300046474 Bacteria 59855
63 Ga0495605_0000329 3300046474 Bacteria 47910
64 Ga0495605_0004097 3300046474 Bacteria 8600
65 Ga0495605_0016433 3300046474 Bacteria 4006
66 Ga0495605_0017851 3300046474 Bacteria 3812
67 Ga0495605_0024436 3300046474 Bacteria 3162
68 Ga0495584_0000015 3300046491 Bacteria 169335
69 Ga0495584_0001093 3300046491 Bacteria 16829
70 Ga0495584_0001140 3300046491 Bacteria 16440
71 Ga0495584_0001200 3300046491 Bacteria 15935
72 Ga0495584_0003190 3300046491 Bacteria 9116
73 Ga0495584_0003479 3300046491 Bacteria 8657
74 Ga0495584_0007254 3300046491 Bacteria 5784
75 Ga0495584_0024501 3300046491 Bacteria 3061
76 Ga0495585_0000334 3300046492 Bacteria 45951
77 Ga0495585_0001142 3300046492 Bacteria 21690
78 Ga0495585_0002243 3300046492 Bacteria 13987
79 Ga0495585_0002642 3300046492 Bacteria 12614
80 Ga0495585_0003095 3300046492 Bacteria 11431
81 Ga0495585_0003891 3300046492 Bacteria 9910
82 Ga0495585_0006573 3300046492 Bacteria 7188
83 Ga0495585_0007822 3300046492 Bacteria 6504
84 Ga0495594_0002512 3300046499 Bacteria 9560
85 Ga0495594_0003130 3300046499 Bacteria 8551
86 Ga0495594_0004356 3300046499 Bacteria 7284
87 Ga0495596_0000131 3300046500 Bacteria 51880
88 Ga0495596_0005249 3300046500 Bacteria 6153
89 Ga0495596_0005933 3300046500 Bacteria 5697
90 Ga0495596_0011863 3300046500 Bacteria 3742
91 Ga0495596_0013066 3300046500 Bacteria 3535
92 Ga0495596_0015913 3300046500 Bacteria 3133
93 Ga0495607_0003107 3300046501 Bacteria 12892
94 Ga0495607_0008474 3300046501 Bacteria 7024
95 Ga0495607_0009282 3300046501 Bacteria 6673
96 Ga0495607_0012980 3300046501 Bacteria 5477
97 Ga0495583_0000064 3300046506 Bacteria 192380
98 Ga0495583_0001002 3300046506 Bacteria 32330
99 Ga0495583_0001204 3300046506 Bacteria 27741
100 Ga0495583_0001232 3300046506 Bacteria 27204
101 Ga0495583_0012400 3300046506 Bacteria 4826
102 Ga0495583_0015274 3300046506 Bacteria 4182
103 Ga0495606_0011121 3300046507 Bacteria 7377
104 Ga0495606_0011452 3300046507 Bacteria 7234
105 Ga0495606_0014985 3300046507 Bacteria 6010
106 Ga0495606_0020708 3300046507 Bacteria 4839
107 Ga0495606_0030171 3300046507 Bacteria 3791
108 Ga0495606_0032069 3300046507 Bacteria 3644
109 Ga0495610_0003648 3300046512 Bacteria 11856
110 Ga0495616_0000263 3300046513 Bacteria 42364
111 Ga0495616_0001295 3300046513 Bacteria 17558
112 Ga0495616_0002287 3300046513 Bacteria 12814
113 Ga0495616_0003409 3300046513 Bacteria 10190
114 Ga0495616_0014510 3300046513 Bacteria 4407
115 Ga0495616_0015507 3300046513 Bacteria 4237
116 Ga0495616_0021491 3300046513 Bacteria 3495
117 Ga0495616_0022755 3300046513 Bacteria 3380
118 Ga0495620_0006453 3300046515 Bacteria 6444
119 Ga0495630_0047524 3300046517 Bacteria 3210
120 Ga0495631_0001430 3300046518 Bacteria 14500
121 Ga0495631_0004352 3300046518 Bacteria 7551
122 Ga0495631_0004967 3300046518 Bacteria 7008
123 Ga0495631_0008228 3300046518 Bacteria 5258
124 Ga0495631_0010101 3300046518 Bacteria 4688
125 Ga0495631_0013153 3300046518 Bacteria 4023
126 Ga0495632_0002792 3300046519 Bacteria 12941
127 Ga0495632_0004814 3300046519 Bacteria 9074
128 Ga0495632_0018457 3300046519 Bacteria 3828
129 Ga0495632_0028656 3300046519 Bacteria 2905
130 Ga0495637_0000011 3300046520 Bacteria 337279
131 Ga0495643_0000714 3300046522 Bacteria 38054
132 Ga0495643_0002225 3300046522 Bacteria 15763
133 Ga0495643_0002941 3300046522 Bacteria 12904
134 Ga0495643_0006343 3300046522 Bacteria 7809
135 Ga0495643_0019306 3300046522 Bacteria 3946
136 Ga0495644_0003771 3300046523 Bacteria 5968
137 Ga0495644_0006339 3300046523 Bacteria 4590
138 Ga0495644_0014903 3300046523 Bacteria 2977
139 Ga0495648_0001524 3300046524 Bacteria 22660
140 Ga0495648_0002769 3300046524 Bacteria 15813
141 Ga0495648_0007778 3300046524 Bacteria 8528
142 Ga0495648_0009296 3300046524 Bacteria 7638
143 Ga0495648_0027545 3300046524 Bacteria 3802
144 Ga0495663_0001753 3300046525 Bacteria 6727
145 Ga0495663_0008524 3300046525 Bacteria 2842
146 Ga0495666_0002814 3300046526 Bacteria 8709
147 Ga0495666_0007904 3300046526 Bacteria 5327
148 Ga0495642_0000445 3300046528 Bacteria 21822
149 Ga0495642_0000560 3300046528 Bacteria 18799
150 Ga0495642_0001469 3300046528 Bacteria 10538
151 Ga0495642_0001743 3300046528 Bacteria 9374
152 Ga0495642_0004265 3300046528 Bacteria 5559
153 Ga0495642_0005391 3300046528 Bacteria 4908
154 Ga0495642_0007882 3300046528 Bacteria 4079
155 Ga0495642_0013321 3300046528 Bacteria 3179
156 Ga0495652_0017068 3300046529 Bacteria 6483
157 Ga0495665_0001362 3300046531 Bacteria 13071
158 Ga0495665_0007293 3300046531 Bacteria 5971
159 Ga0495665_0010503 3300046531 Bacteria 5011
160 Ga0495665_0014892 3300046531 Bacteria 4188
161 Ga0495665_0016197 3300046531 Bacteria 4017
162 Ga0495586_0007134 3300046535 Bacteria 5954
163 Ga0495587_0014965 3300046536 Bacteria 4851
164 Ga0495609_0000963 3300046538 Bacteria 20671
165 Ga0495609_0002729 3300046538 Bacteria 10647
166 Ga0495609_0008412 3300046538 Bacteria 5056
167 Ga0495597_0000585 3300046542 Bacteria 30148
168 Ga0495597_0000600 3300046542 Bacteria 29579
169 Ga0495597_0000906 3300046542 Bacteria 22991
170 Ga0495597_0002958 3300046542 Bacteria 10298
171 Ga0495597_0008191 3300046542 Bacteria 5253
172 Ga0495622_0000138 3300046557 Bacteria 62442
173 Ga0495622_0001370 3300046557 Bacteria 12433
174 Ga0495622_0008341 3300046557 Bacteria 4799
175 Ga0495622_0017178 3300046557 Bacteria 3368
176 Ga0495633_0001290 3300046558 Bacteria 19829
177 Ga0495633_0003532 3300046558 Bacteria 10351
178 Ga0495633_0003918 3300046558 Bacteria 9706
179 Ga0495633_0005512 3300046558 Bacteria 7702
180 Ga0495656_0000790 3300046615 Bacteria 10212
181 Ga0495668_0004128 3300046616 Bacteria 10505
182 Ga0495668_0005038 3300046616 Bacteria 9101
183 Ga0495668_0008631 3300046616 Bacteria 6336
184 Ga0495668_0013184 3300046616 Bacteria 4886
185 Ga0495668_0020432 3300046616 Bacteria 3809
186 Ga0495668_0026246 3300046616 Bacteria 3306
187 Ga0495668_0033419 3300046616 Bacteria 2890
188 Ga0495634_0004631 3300046642 Bacteria 10731
189 Ga0495611_0000502 3300046648 Bacteria 23257
190 Ga0495611_0004942 3300046648 Bacteria 5715
191 Ga0495611_0007631 3300046648 Bacteria 4591
192 Ga0495611_0010417 3300046648 Bacteria 3933
193 Ga0495625_0007118 3300046660 Bacteria 9827
194 Ga0495625_0009716 3300046660 Bacteria 8006
195 Ga0495625_0043953 3300046660 Bacteria 3236
196 Ga0495661_0000109 3300046665 Bacteria 97921
197 Ga0495661_0003390 3300046665 Bacteria 11792
198 Ga0495661_0005049 3300046665 Bacteria 9418
199 Ga0495661_0007300 3300046665 Bacteria 7704
200 Ga0495661_0007380 3300046665 Bacteria 7660
201 Ga0495661_0008669 3300046665 Bacteria 7027
202 Ga0495661_0010550 3300046665 Bacteria 6300
203 Ga0495661_0022563 3300046665 Bacteria 4094
204 Ga0495661_0028155 3300046665 Bacteria 3600
205 Ga0495588_0000190 3300046674 Bacteria 66733
206 Ga0495588_0000714 3300046674 Bacteria 15229
207 Ga0495588_0012645 3300046674 Bacteria 3995
208 Ga0495588_0013545 3300046674 Bacteria 3886
209 Ga0495623_0028939 3300046679 Bacteria 3565
210 Ga0495669_0002960 3300046684 Bacteria 6981
211 Ga0495624_0004744 3300046690 Bacteria 9894
212 Ga0495670_0000646 3300046691 Bacteria 16637
213 Ga0495670_0001634 3300046691 Bacteria 10975
214 Ga0495670_0002174 3300046691 Bacteria 9698
215 Ga0495670_0017976 3300046691 Bacteria 3482
216 Ga0495670_0027776 3300046691 Bacteria 2805
217 Ga0495671_0000317 3300046692 Bacteria 40863
218 Ga0495649_0000308 3300046694 Bacteria 42949
219 Ga0495649_0011162 3300046694 Bacteria 5283
220 Ga0495649_0012147 3300046694 Bacteria 5025
221 Ga0495589_0000268 3300046794 Bacteria 42231
222 Ga0495589_0001500 3300046794 Bacteria 13429
223 Ga0495589_0002878 3300046794 Bacteria 9527
224 Ga0495589_0006994 3300046794 Bacteria 5918
225 Ga0495589_0011702 3300046794 Bacteria 4554
226 Ga0495589_0012597 3300046794 Bacteria 4375
227 Ga0495589_0013686 3300046794 Bacteria 4183
228 Ga0495600_0025725 3300046809 Bacteria 3793
229 Ga0495660_0000849 3300046810 Bacteria 22546
230 Ga0495660_0005002 3300046810 Bacteria 7976
231 Ga0495660_0006624 3300046810 Bacteria 6845
232 Ga0495581_0000962 3300047315 Bacteria 15471
233 Ga0495581_0005133 3300047315 Bacteria 7576
234 Ga0495604_0006817 3300047317 Bacteria 9052
235 Ga0495604_0015059 3300047317 Bacteria 6169
236 Ga0495636_0000320 3300047318 Bacteria 18356
237 Ga0495674_0066434 3300047319 Bacteria 3128
238 Ga0495672_0000021 3300047320 Bacteria 422795
239 Ga0495672_0000307 3300047320 Bacteria 65630
240 Ga0495672_0000618 3300047320 Bacteria 39664
241 Ga0495672_0001397 3300047320 Bacteria 23769
242 Ga0495672_0009891 3300047320 Bacteria 6854
243 Ga0495676_0000245 3300047321 Bacteria 43865
244 Ga0495676_0010955 3300047321 Bacteria 8198
245 Ga0495683_0000463 3300047323 Bacteria 31770
246 Ga0495683_0000970 3300047323 Bacteria 20052
247 Ga0495683_0001841 3300047323 Bacteria 13318
248 Ga0495683_0002482 3300047323 Bacteria 11123
249 Ga0495683_0007418 3300047323 Bacteria 5935
250 Ga0495683_0022795 3300047323 Bacteria 3219
251 Ga0495683_0024553 3300047323 Bacteria 3093
252 Ga0495683_0029829 3300047323 Bacteria 2786
253 Ga0495687_000501 3300047443 Bacteria 47229
254 Ga0495687_000553 3300047443 Bacteria 44387
255 Ga0495687_000681 3300047443 Bacteria 38613
256 Ga0495687_002713 3300047443 Bacteria 13744
257 Ga0495675_0015427 3300047444 Bacteria 4831
258 Ga0495677_0000518 3300047445 Bacteria 16151
259 Ga0495677_0000608 3300047445 Bacteria 14624
260 Ga0495677_0000709 3300047445 Bacteria 13478
261 Ga0495677_0000802 3300047445 Bacteria 12706
262 Ga0495677_0000936 3300047445 Bacteria 11751
263 Ga0495677_0002142 3300047445 Bacteria 7815
264 Ga0495677_0002508 3300047445 Bacteria 7183
265 Ga0495677_0003558 3300047445 Bacteria 6043
266 Ga0495679_005367 3300047446 Bacteria 5686
267 Ga0495679_006045 3300047446 Bacteria 5289
268 Ga0495681_0003511 3300047470 Bacteria 10889
269 Ga0495681_0018230 3300047470 Bacteria 3872
270 Ga0495681_0023046 3300047470 Bacteria 3317
271 Ga0495686_0000553 3300047472 Bacteria 53519
272 Ga0495686_0001018 3300047472 Bacteria 33917
273 Ga0495686_0015357 3300047472 Bacteria 5232
274 Ga0495593_0003195 3300047673 Bacteria 9835
275 Ga0495602_0015735 3300048088 Bacteria 7622
276 Ga0495602_0041949 3300048088 Bacteria 4173
277 Ga0495602_0043246 3300048088 Bacteria 4098
278 Ga0495626_0000050 3300048091 Bacteria 160905
279 Ga0495626_0000418 3300048091 Bacteria 43563
280 Ga0495626_0000986 3300048091 Bacteria 24509
281 Ga0495626_0002937 3300048091 Bacteria 11347
282 Ga0495626_0003376 3300048091 Bacteria 10275
283 Ga0495626_0003950 3300048091 Bacteria 9272
284 Ga0495626_0005458 3300048091 Bacteria 7434
285 Ga0495626_0005623 3300048091 Bacteria 7267
286 Ga0495626_0009731 3300048091 Bacteria 5180
287 Ga0495626_0015375 3300048091 Bacteria 3920
288 Ga0495626_0015833 3300048091 Bacteria 3848
289 Ga0496102_0000280 3300048905 Bacteria 65060
290 Ga0496106_0013175 3300048909 Bacteria 6101
291 Ga0496110_0000035 3300048913 Bacteria 64945
292 Ga0496115_0009401 3300048918 Bacteria 7262
293 Ga0496123_0002533 3300048926 Bacteria 22405
294 Ga0496124_0018262 3300048927 Bacteria 6574
295 Ga0501310_000643 3300049130 Bacteria 3072
296 Ga0501304_000133 3300049160 Bacteria 2985
297 Ga0495678_000472 3300049459 Bacteria 40059
298 Ga0495678_001427 3300049459 Bacteria 18833
299 Ga0495678_002004 3300049459 Bacteria 14622
300 Ga0495678_004895 3300049459 Bacteria 7566
301 Ga0495682_0001036 3300049460 Bacteria 16374
302 Ga0495682_0004991 3300049460 Bacteria 5578
303 Ga0495682_0007074 3300049460 Bacteria 4490
304 Ga0495682_0009697 3300049460 Bacteria 3752
305 Ga0501035_0002587 3300049822 Bacteria 17672
306 Ga0466962_0001278 3300061719 Bacteria 11614

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046525 Ga0495663_0008524 Ga0495663_0008524_14_2494 804
2 3300047323 Ga0495683_0029829 Ga0495683_0029829_274_2775 813
3 3300046691 Ga0495670_0027776 Ga0495670_0027776_275_2773 816
4 3300046518 Ga0495631_0010101 Ga0495631_0010101_10_2529 817
5 3300042008 Ga0439450_002937 Ga0439450_002937_49_2742 864
6 3300046794 Ga0495589_0012597 Ga0495589_0012597_19_2682 872
7 3300048918 Ga0496115_0009401 Ga0496115_0009401_2713_5565 876
8 3300005262 Ga0065165_1000001 Ga0065165_1000001382 886
9 3300046690 Ga0495624_0004744 Ga0495624_0004744_28_2754 891
10 3300044842 Ga0466957_0003742 Ga0466957_0003742_4384_7248 894
11 3300046500 Ga0495596_0011863 Ga0495596_0011863_781_3525 894
12 3300049460 Ga0495682_0007074 Ga0495682_0007074_1716_4466 896
13 3300046507 Ga0495606_0011452 Ga0495606_0011452_595_3504 897
14 3300046519 Ga0495632_0028656 Ga0495632_0028656_69_2888 897
15 3300046523 Ga0495644_0014903 Ga0495644_0014903_29_2848 897
16 3300046794 Ga0495589_0001500 Ga0495589_0001500_8030_10903 898
17 3300046616 Ga0495668_0033419 Ga0495668_0033419_96_2855 900
18 3300042139 Ga0450904_000335 Ga0450904_000335_653_3433 901
19 3300046452 Ga0495617_000276 Ga0495617_000276_24604_27486 901
20 3300046474 Ga0495605_0017851 Ga0495605_0017851_51_2789 901
21 3300046492 Ga0495585_0000334 Ga0495585_0000334_11794_14676 901
22 3300046513 Ga0495616_0001295 Ga0495616_0001295_7708_10590 901
23 3300046524 Ga0495648_0001524 Ga0495648_0001524_11794_14676 901
24 3300047323 Ga0495683_0007418 Ga0495683_0007418_2581_5463 901
25 3300047445 Ga0495677_0003558 Ga0495677_0003558_893_3844 902
26 3300044693 Ga0466961_0000877 Ga0466961_0000877_6140_8992 903
27 3300044719 Ga0466971_0007132 Ga0466971_0007132_1340_4192 903
28 3300044842 Ga0466957_0007754 Ga0466957_0007754_607_3459 903
29 3300046694 Ga0495649_0000308 Ga0495649_0000308_24513_27350 903
30 3300049460 Ga0495682_0009697 Ga0495682_0009697_897_3734 903
31 3300061719 Ga0466962_0001278 Ga0466962_0001278_963_3815 903
32 3300046491 Ga0495584_0024501 Ga0495584_0024501_177_3041 905
33 3300046457 Ga0495590_0000063 Ga0495590_0000063_30010_32874 906
34 3300046458 Ga0495591_000391 Ga0495591_000391_4054_6918 906
35 3300046460 Ga0495638_0003247 Ga0495638_0003247_443_3304 906
36 3300046512 Ga0495610_0003648 Ga0495610_0003648_1164_4028 906
37 3300046520 Ga0495637_0000011 Ga0495637_0000011_248274_251138 906
38 3300046522 Ga0495643_0006343 Ga0495643_0006343_4810_7674 906
39 3300046542 Ga0495597_0000600 Ga0495597_0000600_15717_18614 906
40 3300046542 Ga0495597_0008191 Ga0495597_0008191_1483_4344 906
41 3300046616 Ga0495668_0013184 Ga0495668_0013184_911_3772 906
42 3300046660 Ga0495625_0043953 Ga0495625_0043953_129_2990 906
43 3300046665 Ga0495661_0028155 Ga0495661_0028155_523_3384 906
44 3300046674 Ga0495588_0000190 Ga0495588_0000190_47956_50823 906
45 3300046684 Ga0495669_0002960 Ga0495669_0002960_3190_6051 906
46 3300046794 Ga0495589_0011702 Ga0495589_0011702_435_3296 906
47 3300047320 Ga0495672_0000307 Ga0495672_0000307_16756_19620 906
48 3300047445 Ga0495677_0002142 Ga0495677_0002142_2093_4954 906
49 3300049160 Ga0501304_000133 Ga0501304_000133_104_2971 906
50 3300046473 Ga0495582_0030018 Ga0495582_0030018_147_2951 907
51 3300046542 Ga0495597_0002958 Ga0495597_0002958_6225_9119 907
52 3300048091 Ga0495626_0000986 Ga0495626_0000986_14508_17402 907
53 3300046501 Ga0495607_0012980 Ga0495607_0012980_1127_3997 908
54 3300046506 Ga0495583_0001204 Ga0495583_0001204_19940_22876 908
55 3300046518 Ga0495631_0013153 Ga0495631_0013153_298_3234 908
56 3300046519 Ga0495632_0018457 Ga0495632_0018457_1034_3796 908
57 3300046528 Ga0495642_0000560 Ga0495642_0000560_541_3393 908
58 3300046528 Ga0495642_0001469 Ga0495642_0001469_6710_9517 908
59 3300046810 Ga0495660_0005002 Ga0495660_0005002_1470_4406 908
60 3300047445 Ga0495677_0000802 Ga0495677_0000802_8441_11311 908
61 3300047446 Ga0495679_006045 Ga0495679_006045_1505_4441 908
62 3300046542 Ga0495597_0000906 Ga0495597_0000906_7458_10319 909
63 3300046453 Ga0495627_003894 Ga0495627_003894_2802_5615 910
64 3300046518 Ga0495631_0004352 Ga0495631_0004352_761_3574 910
65 3300046525 Ga0495663_0001753 Ga0495663_0001753_3460_6273 910
66 3300046528 Ga0495642_0013321 Ga0495642_0013321_72_2885 910
67 3300046542 Ga0495597_0000585 Ga0495597_0000585_6584_9397 910
68 3300046615 Ga0495656_0000790 Ga0495656_0000790_365_3178 910
69 3300046648 Ga0495611_0010417 Ga0495611_0010417_184_2997 910
70 3300046691 Ga0495670_0017976 Ga0495670_0017976_629_3442 910
71 3300046794 Ga0495589_0013686 Ga0495589_0013686_246_3059 910
72 3300047445 Ga0495677_0000608 Ga0495677_0000608_6273_9086 910
73 3300046522 Ga0495643_0002225 Ga0495643_0002225_1001_3841 911
74 3300046694 Ga0495649_0011162 Ga0495649_0011162_891_3731 911
75 3300048088 Ga0495602_0043246 Ga0495602_0043246_1262_4072 911
76 3300048091 Ga0495626_0009731 Ga0495626_0009731_677_3517 911
77 3300037312 Ga0395899_0021435 Ga0395899_0021435_824_3655 912
78 3300037418 Ga0395900_0003010 Ga0395900_0003010_3193_6024 912
79 3300046455 Ga0495603_0008896 Ga0495603_0008896_1971_4907 912
80 3300046499 Ga0495594_0004356 Ga0495594_0004356_1028_3964 912
81 3300047321 Ga0495676_0010955 Ga0495676_0010955_1452_4388 912
82 3300047323 Ga0495683_0002482 Ga0495683_0002482_4584_7496 912
83 3300046557 Ga0495622_0008341 Ga0495622_0008341_443_3280 913
84 3300047321 Ga0495676_0010955 Ga0495676_0010955_4719_7556 913
85 3300047472 Ga0495686_0001018 Ga0495686_0001018_26249_29092 913
86 3300048091 Ga0495626_0005458 Ga0495626_0005458_1231_4065 913
87 3300046491 Ga0495584_0001093 Ga0495584_0001093_4512_7400 914
88 3300046491 Ga0495584_0003479 Ga0495584_0003479_3455_6292 914
89 3300046492 Ga0495585_0002243 Ga0495585_0002243_3793_6630 914
90 3300046506 Ga0495583_0001232 Ga0495583_0001232_19976_22864 914
91 3300046518 Ga0495631_0001430 Ga0495631_0001430_3843_6731 914
92 3300046519 Ga0495632_0004814 Ga0495632_0004814_160_3000 914
93 3300046523 Ga0495644_0006339 Ga0495644_0006339_257_3145 914
94 3300046648 Ga0495611_0000502 Ga0495611_0000502_4245_7133 914
95 3300046648 Ga0495611_0004942 Ga0495611_0004942_2282_5119 914
96 3300046665 Ga0495661_0008669 Ga0495661_0008669_3348_6188 914
97 3300046691 Ga0495670_0002174 Ga0495670_0002174_725_3562 914
98 3300046810 Ga0495660_0006624 Ga0495660_0006624_2501_5389 914
99 3300047318 Ga0495636_0000320 Ga0495636_0000320_1898_4735 914
100 3300047445 Ga0495677_0000518 Ga0495677_0000518_4738_7626 914
101 3300048091 Ga0495626_0003376 Ga0495626_0003376_3556_6444 914
102 3300049459 Ga0495678_000472 Ga0495678_000472_4878_7766 914
103 3300013102 Ga0157371_10000010 Ga0157371_1000001081 915
104 3300046499 Ga0495594_0002512 Ga0495594_0002512_946_3849 915
105 3300048091 Ga0495626_0000986 Ga0495626_0000986_11283_14162 915
106 3300046557 Ga0495622_0000138 Ga0495622_0000138_13424_16333 916
107 3300047320 Ga0495672_0000618 Ga0495672_0000618_24047_26944 917
108 3300047323 Ga0495683_0001841 Ga0495683_0001841_7568_10465 917
109 3300049459 Ga0495678_002004 Ga0495678_002004_6847_9699 917
110 3300005262 Ga0065165_1000643 Ga0065165_10006436 918
111 3300042005 Ga0439448_0003527 Ga0439448_0003527_1216_4110 918
112 3300046459 Ga0495629_0007847 Ga0495629_0007847_3861_6683 918
113 3300046491 Ga0495584_0007254 Ga0495584_0007254_1019_3883 918
114 3300046492 Ga0495585_0003891 Ga0495585_0003891_3689_6538 918
115 3300046492 Ga0495585_0006573 Ga0495585_0006573_236_3097 918
116 3300046513 Ga0495616_0015507 Ga0495616_0015507_1347_4211 918
117 3300046523 Ga0495644_0003771 Ga0495644_0003771_1676_4540 918
118 3300046558 Ga0495633_0001290 Ga0495633_0001290_6753_9602 918
119 3300046665 Ga0495661_0003390 Ga0495661_0003390_686_3535 918
120 3300046691 Ga0495670_0001634 Ga0495670_0001634_1745_4594 918
121 3300046794 Ga0495589_0006994 Ga0495589_0006994_287_3151 918
122 3300047319 Ga0495674_0066434 Ga0495674_0066434_101_2923 918
123 3300047472 Ga0495686_0000553 Ga0495686_0000553_38773_41637 918
124 3300025254 Ga0209148_1000818 Ga0209148_10008183 919
125 3300037312 Ga0395899_0007470 Ga0395899_0007470_3635_6502 919
126 3300037418 Ga0395900_0009781 Ga0395900_0009781_3267_6134 919
127 3300037418 Ga0395900_0043648 Ga0395900_0043648_1108_3951 919
128 3300044683 Ga0466965_0014118 Ga0466965_0014118_624_3491 919
129 3300044706 Ga0466964_0001979 Ga0466964_0001979_1390_4257 919
130 3300044735 Ga0466968_0000696 Ga0466968_0000696_7247_10114 919
131 3300046474 Ga0495605_0000265 Ga0495605_0000265_36264_39125 919
132 3300046491 Ga0495584_0001200 Ga0495584_0001200_12057_14924 919
133 3300046491 Ga0495584_0003190 Ga0495584_0003190_79_2922 919
134 3300046492 Ga0495585_0002642 Ga0495585_0002642_7022_9874 919
135 3300046492 Ga0495585_0006573 Ga0495585_0006573_3694_6618 919
136 3300046492 Ga0495585_0007822 Ga0495585_0007822_522_3365 919
137 3300046499 Ga0495594_0003130 Ga0495594_0003130_1141_3984 919
138 3300046500 Ga0495596_0005933 Ga0495596_0005933_182_3025 919
139 3300046507 Ga0495606_0032069 Ga0495606_0032069_37_2907 919
140 3300046522 Ga0495643_0019306 Ga0495643_0019306_59_2902 919
141 3300046524 Ga0495648_0007778 Ga0495648_0007778_1694_4591 919
142 3300046528 Ga0495642_0005391 Ga0495642_0005391_445_3312 919
143 3300046538 Ga0495609_0008412 Ga0495609_0008412_61_2904 919
144 3300046648 Ga0495611_0007631 Ga0495611_0007631_1600_4443 919
145 3300046665 Ga0495661_0007300 Ga0495661_0007300_4465_7308 919
146 3300046665 Ga0495661_0010550 Ga0495661_0010550_150_2993 919
147 3300046694 Ga0495649_0012147 Ga0495649_0012147_1319_4180 919
148 3300046794 Ga0495589_0000268 Ga0495589_0000268_2786_5647 919
149 3300046810 Ga0495660_0000849 Ga0495660_0000849_1515_4376 919
150 3300047320 Ga0495672_0001397 Ga0495672_0001397_19812_22673 919
151 3300047321 Ga0495676_0000245 Ga0495676_0000245_27241_30084 919
152 3300047323 Ga0495683_0022795 Ga0495683_0022795_238_3081 919
153 3300047443 Ga0495687_000681 Ga0495687_000681_34594_37464 919
154 3300047443 Ga0495687_002713 Ga0495687_002713_9753_12614 919
155 3300047445 Ga0495677_0000709 Ga0495677_0000709_9736_12597 919
156 3300048091 Ga0495626_0000050 Ga0495626_0000050_36647_39508 919
157 iso_pu_bacteria 2643221556 2643796735 919
158 iso_pu_bacteria 2643221684 2644470160 919
159 iso_pu_bacteria 8047673197 8047677002 919
160 3300046522 Ga0495643_0002225 Ga0495643_0002225_4447_7368 920
161 3300005262 Ga0065165_1000643 Ga0065165_10006438 921
162 3300046453 Ga0495627_005549 Ga0495627_005549_1618_4494 921
163 3300046463 Ga0495653_0026152 Ga0495653_0026152_1257_4172 921
164 3300046474 Ga0495605_0024436 Ga0495605_0024436_138_2975 921
165 3300046506 Ga0495583_0001002 Ga0495583_0001002_28852_31728 921
166 3300046513 Ga0495616_0002287 Ga0495616_0002287_6169_9030 921
167 3300046518 Ga0495631_0004967 Ga0495631_0004967_3053_5914 921
168 3300046526 Ga0495666_0007904 Ga0495666_0007904_2027_4942 921
169 3300046528 Ga0495642_0004265 Ga0495642_0004265_1764_4640 921
170 3300046531 Ga0495665_0014892 Ga0495665_0014892_85_3000 921
171 3300046535 Ga0495586_0007134 Ga0495586_0007134_927_3842 921
172 3300046558 Ga0495633_0005512 Ga0495633_0005512_1376_4252 921
173 3300046616 Ga0495668_0020432 Ga0495668_0020432_742_3579 921
174 3300046674 Ga0495588_0013545 Ga0495588_0013545_529_3444 921
175 3300046809 Ga0495600_0025725 Ga0495600_0025725_381_3296 921
176 3300047315 Ga0495581_0005133 Ga0495581_0005133_618_3533 921
177 3300047317 Ga0495604_0006817 Ga0495604_0006817_4844_7759 921
178 3300047323 Ga0495683_0024553 Ga0495683_0024553_26_2863 921
179 3300047470 Ga0495681_0003511 Ga0495681_0003511_1426_4302 921
180 3300047472 Ga0495686_0000553 Ga0495686_0000553_42146_45019 921
181 3300047673 Ga0495593_0003195 Ga0495593_0003195_1128_4043 921
182 3300048927 Ga0496124_0018262 Ga0496124_0018262_1476_4373 921
183 3300049459 Ga0495678_001427 Ga0495678_001427_3234_6095 921
184 3300049460 Ga0495682_0001036 Ga0495682_0001036_10572_13433 921
185 3300049460 Ga0495682_0004991 Ga0495682_0004991_1256_4129 921
186 3300046471 Ga0495650_0000441 Ga0495650_0000441_30460_33381 922
187 3300046500 Ga0495596_0000131 Ga0495596_0000131_11915_14836 922
188 3300046513 Ga0495616_0000263 Ga0495616_0000263_3627_6503 922
189 3300046526 Ga0495666_0002814 Ga0495666_0002814_600_3512 922
190 3300046531 Ga0495665_0001362 Ga0495665_0001362_9950_12862 922
191 3300046531 Ga0495665_0010503 Ga0495665_0010503_1901_4747 922
192 3300046538 Ga0495609_0000963 Ga0495609_0000963_9374_12295 922
193 3300046557 Ga0495622_0001370 Ga0495622_0001370_556_3402 922
194 3300046660 Ga0495625_0009716 Ga0495625_0009716_3057_5900 922
195 3300046665 Ga0495661_0000109 Ga0495661_0000109_53774_56662 922
196 3300046674 Ga0495588_0012645 Ga0495588_0012645_758_3604 922
197 3300046690 Ga0495624_0004744 Ga0495624_0004744_3101_6013 922
198 3300047315 Ga0495581_0000962 Ga0495581_0000962_10630_13542 922
199 3300047317 Ga0495604_0015059 Ga0495604_0015059_3266_6112 922
200 3300047443 Ga0495687_000501 Ga0495687_000501_36204_39101 922
201 3300047472 Ga0495686_0015357 Ga0495686_0015357_774_3647 922
202 3300048091 Ga0495626_0002937 Ga0495626_0002937_405_3278 922
203 3300048091 Ga0495626_0003950 Ga0495626_0003950_3434_6331 922
204 3300048913 Ga0496110_0000035 Ga0496110_0000035_35223_38132 922
205 3300046472 Ga0495580_0018804 Ga0495580_0018804_1271_4168 923
206 3300046473 Ga0495582_0000953 Ga0495582_0000953_9151_12048 923
207 3300046491 Ga0495584_0000015 Ga0495584_0000015_56810_59677 923
208 3300046507 Ga0495606_0014985 Ga0495606_0014985_2595_5462 923
209 3300046522 Ga0495643_0000714 Ga0495643_0000714_25675_28533 923
210 3300046529 Ga0495652_0017068 Ga0495652_0017068_536_3433 923
211 3300046531 Ga0495665_0007293 Ga0495665_0007293_2190_5087 923
212 3300046642 Ga0495634_0004631 Ga0495634_0004631_3007_5904 923
213 3300044842 Ga0466957_0003742 Ga0466957_0003742_1036_3918 924
214 3300046471 Ga0495650_0000260 Ga0495650_0000260_46142_49042 924
215 iso_pu_bacteria 2885080285 2885080654 924
216 3300046455 Ga0495603_0012698 Ga0495603_0012698_847_3702 925
217 3300046471 Ga0495650_0000260 Ga0495650_0000260_36307_39234 925
218 3300046513 Ga0495616_0021491 Ga0495616_0021491_530_3409 925
219 3300048091 Ga0495626_0005623 Ga0495626_0005623_3848_6772 925
220 3300046457 Ga0495590_0000063 Ga0495590_0000063_33379_36246 926
221 3300046458 Ga0495591_000391 Ga0495591_000391_682_3549 926
222 3300046474 Ga0495605_0004097 Ga0495605_0004097_1455_4322 926
223 3300046491 Ga0495584_0001093 Ga0495584_0001093_1140_4007 926
224 3300046491 Ga0495584_0001140 Ga0495584_0001140_3122_5974 926
225 3300046492 Ga0495585_0003095 Ga0495585_0003095_2460_5312 926
226 3300046500 Ga0495596_0015913 Ga0495596_0015913_158_3010 926
227 3300046501 Ga0495607_0003107 Ga0495607_0003107_3126_5993 926
228 3300046506 Ga0495583_0000064 Ga0495583_0000064_9398_12253 926
229 3300046506 Ga0495583_0001232 Ga0495583_0001232_23369_26236 926
230 3300046512 Ga0495610_0003648 Ga0495610_0003648_4533_7400 926
231 3300046515 Ga0495620_0006453 Ga0495620_0006453_2518_5409 926
232 3300046518 Ga0495631_0001430 Ga0495631_0001430_471_3338 926
233 3300046520 Ga0495637_0000011 Ga0495637_0000011_251643_254510 926
234 3300046522 Ga0495643_0006343 Ga0495643_0006343_1438_4305 926
235 3300046524 Ga0495648_0007778 Ga0495648_0007778_5290_8160 926
236 3300046528 Ga0495642_0000560 Ga0495642_0000560_3783_6674 926
237 3300046558 Ga0495633_0003532 Ga0495633_0003532_3158_6025 926
238 3300046558 Ga0495633_0003918 Ga0495633_0003918_4180_7032 926
239 3300046616 Ga0495668_0008631 Ga0495668_0008631_1344_4196 926
240 3300046648 Ga0495611_0000502 Ga0495611_0000502_873_3740 926
241 3300046674 Ga0495588_0000714 Ga0495588_0000714_3406_6279 926
242 3300046691 Ga0495670_0000646 Ga0495670_0000646_6338_9193 926
243 3300046694 Ga0495649_0000308 Ga0495649_0000308_21141_24008 926
244 3300046794 Ga0495589_0002878 Ga0495589_0002878_4122_6989 926
245 3300047320 Ga0495672_0000307 Ga0495672_0000307_13384_16251 926
246 3300047323 Ga0495683_0000463 Ga0495683_0000463_2460_5312 926
247 3300047323 Ga0495683_0000970 Ga0495683_0000970_16493_19360 926
248 3300047445 Ga0495677_0000518 Ga0495677_0000518_1366_4233 926
249 3300047446 Ga0495679_005367 Ga0495679_005367_218_3085 926
250 3300047470 Ga0495681_0018230 Ga0495681_0018230_280_3147 926
251 3300048091 Ga0495626_0003376 Ga0495626_0003376_184_3051 926
252 3300048909 Ga0496106_0013175 Ga0496106_0013175_2765_5647 926
253 3300049459 Ga0495678_000472 Ga0495678_000472_1506_4373 926
254 3300014497 Ga0182008_10002934 Ga0182008_100029345 927
255 3300046616 Ga0495668_0005038 Ga0495668_0005038_4510_7422 927
256 3300048091 Ga0495626_0015833 Ga0495626_0015833_673_3549 927
257 3300049130 Ga0501310_000643 Ga0501310_000643_141_3023 927
258 3300025254 Ga0209148_1000818 Ga0209148_10008184 928
259 3300037471 Ga0395905_0025119 Ga0395905_0025119_2112_5009 928
260 3300046457 Ga0495590_0000943 Ga0495590_0000943_2913_5813 928
261 3300046471 Ga0495650_0000441 Ga0495650_0000441_26886_29762 928
262 3300046473 Ga0495582_0000953 Ga0495582_0000953_12555_15458 928
263 3300046491 Ga0495584_0001200 Ga0495584_0001200_8790_11615 928
264 3300046491 Ga0495584_0003479 Ga0495584_0003479_237_3128 928
265 3300046492 Ga0495585_0002243 Ga0495585_0002243_6957_9848 928
266 3300046500 Ga0495596_0000131 Ga0495596_0000131_8340_11216 928
267 3300046501 Ga0495607_0009282 Ga0495607_0009282_3158_5971 928
268 3300046506 Ga0495583_0015274 Ga0495583_0015274_116_3013 928
269 3300046507 Ga0495606_0011121 Ga0495606_0011121_4206_7031 928
270 3300046507 Ga0495606_0020708 Ga0495606_0020708_484_3387 928
271 3300046524 Ga0495648_0009296 Ga0495648_0009296_1029_3842 928
272 3300046531 Ga0495665_0016197 Ga0495665_0016197_18_2915 928
273 3300046538 Ga0495609_0000963 Ga0495609_0000963_12994_15870 928
274 3300046642 Ga0495634_0004631 Ga0495634_0004631_6411_9314 928
275 3300046665 Ga0495661_0007380 Ga0495661_0007380_1333_4146 928
276 3300046679 Ga0495623_0028939 Ga0495623_0028939_414_3317 928
277 3300047318 Ga0495636_0000320 Ga0495636_0000320_5062_7953 928
278 3300047320 Ga0495672_0000618 Ga0495672_0000618_20472_23348 928
279 3300047323 Ga0495683_0001841 Ga0495683_0001841_3993_6869 928
280 3300047443 Ga0495687_000681 Ga0495687_000681_31327_34152 928
281 3300047444 Ga0495675_0015427 Ga0495675_0015427_1885_4782 928
282 3300048088 Ga0495602_0041949 Ga0495602_0041949_389_3292 928
283 3300048091 Ga0495626_0015375 Ga0495626_0015375_195_3092 928
284 3300003322 rootL2_10038210 rootL2_100382104 929
285 3300047320 Ga0495672_0000021 Ga0495672_0000021_216612_219512 929
286 3300048913 Ga0496110_0000035 Ga0496110_0000035_38638_41538 929
287 3300042012 Ga0439455_0001130 Ga0439455_0001130_832_3699 930
288 3300046557 Ga0495622_0017178 Ga0495622_0017178_459_3353 930
289 3300046674 Ga0495588_0000714 Ga0495588_0000714_163_3066 930
290 3300037418 Ga0395900_0034874 Ga0395900_0034874_448_3354 931
291 3300037471 Ga0395905_0040027 Ga0395905_0040027_449_3355 931
292 3300037418 Ga0395900_0027725 Ga0395900_0027725_2479_5346 932
293 3300044683 Ga0466965_0002729 Ga0466965_0002729_3617_6472 932
294 3300044684 Ga0466966_0012016 Ga0466966_0012016_295_3150 932
295 3300044712 Ga0453684_0029062 Ga0453684_0029062_602_3496 932
296 3300046491 Ga0495584_0001140 Ga0495584_0001140_6509_9397 932
297 3300046492 Ga0495585_0003095 Ga0495585_0003095_5847_8735 932
298 3300046500 Ga0495596_0013066 Ga0495596_0013066_404_3292 932
299 3300046506 Ga0495583_0000064 Ga0495583_0000064_12789_15677 932
300 3300046513 Ga0495616_0003409 Ga0495616_0003409_6995_9883 932
301 3300046524 Ga0495648_0027545 Ga0495648_0027545_10_2925 932
302 3300046528 Ga0495642_0007882 Ga0495642_0007882_658_3546 932
303 3300046691 Ga0495670_0000646 Ga0495670_0000646_2916_5804 932
304 3300047323 Ga0495683_0000463 Ga0495683_0000463_5847_8735 932
305 3300046463 Ga0495653_0034864 Ga0495653_0034864_18_2915 933
306 3300046473 Ga0495582_0014531 Ga0495582_0014531_535_3432 933
307 3300046517 Ga0495630_0047524 Ga0495630_0047524_211_3108 933
308 3300046536 Ga0495587_0014965 Ga0495587_0014965_549_3446 933
309 3300047315 Ga0495581_0005133 Ga0495581_0005133_3877_6774 933
310 3300047317 Ga0495604_0006817 Ga0495604_0006817_1602_4499 933
311 3300047443 Ga0495687_000553 Ga0495687_000553_8116_11085 933
312 3300047673 Ga0495593_0003195 Ga0495593_0003195_4387_7284 933
313 3300048088 Ga0495602_0015735 Ga0495602_0015735_1066_3963 933
314 3300048091 Ga0495626_0000418 Ga0495626_0000418_31320_34205 933
315 3300048926 Ga0496123_0002533 Ga0496123_0002533_2527_5382 933
316 iso_pu_bacteria 2808606418 2809141914 933
317 3300037418 Ga0395900_0002832 Ga0395900_0002832_6429_9308 934
318 3300037418 Ga0395900_0009781 Ga0395900_0009781_6622_9501 934
319 3300038443 Ga0395901_0000633 Ga0395901_0000633_16072_18951 934
320 3300046513 Ga0495616_0000263 Ga0495616_0000263_6881_9844 934
321 3300049822 Ga0501035_0002587 Ga0501035_0002587_14711_17596 934
322 iso_pu_bacteria 8047673197 8047677003 934
323 3300005563 Ga0068855_100061778 Ga0068855_1000617781 935
324 3300009148 Ga0105243_10006646 Ga0105243_100066464 935
325 3300037418 Ga0395900_0003010 Ga0395900_0003010_6543_9425 935
326 3300037466 Ga0395898_0032939 Ga0395898_0032939_1035_3917 935
327 3300037471 Ga0395905_0038092 Ga0395905_0038092_702_3584 935
328 3300037471 Ga0395905_0051407 Ga0395905_0051407_680_3562 935
329 3300038443 Ga0395901_0007405 Ga0395901_0007405_6446_9328 935
330 3300044693 Ga0466961_0026305 Ga0466961_0026305_561_3443 935
331 3300045976 Ga0466967_0054735 Ga0466967_0054735_42_2924 935
332 3300046452 Ga0495617_000014 Ga0495617_000014_36377_39262 935
333 3300046453 Ga0495627_000355 Ga0495627_000355_9514_12399 935
334 3300046474 Ga0495605_0000329 Ga0495605_0000329_4908_7793 935
335 3300046474 Ga0495605_0016433 Ga0495605_0016433_531_3428 935
336 3300046500 Ga0495596_0005249 Ga0495596_0005249_393_3278 935
337 3300046507 Ga0495606_0030171 Ga0495606_0030171_267_3167 935
338 3300046513 Ga0495616_0002287 Ga0495616_0002287_2729_5629 935
339 3300046513 Ga0495616_0022755 Ga0495616_0022755_29_2926 935
340 3300046524 Ga0495648_0002769 Ga0495648_0002769_3768_6653 935
341 3300046528 Ga0495642_0000445 Ga0495642_0000445_6677_9562 935
342 3300046616 Ga0495668_0026246 Ga0495668_0026246_381_3278 935
343 3300046660 Ga0495625_0007118 Ga0495625_0007118_2454_5351 935
344 3300046665 Ga0495661_0005049 Ga0495661_0005049_2293_5178 935
345 3300046665 Ga0495661_0022563 Ga0495661_0022563_579_3476 935
346 3300046692 Ga0495671_0000317 Ga0495671_0000317_31379_34264 935
347 3300047445 Ga0495677_0000936 Ga0495677_0000936_5734_8619 935
348 3300049459 Ga0495678_001427 Ga0495678_001427_6635_9535 935
349 3300049460 Ga0495682_0001036 Ga0495682_0001036_7132_10032 935
350 3300046471 Ga0495650_0000260 Ga0495650_0000260_39575_42457 936
351 3300046491 Ga0495584_0003190 Ga0495584_0003190_3427_6330 936
352 3300046519 Ga0495632_0002792 Ga0495632_0002792_7061_9964 936
353 3300046616 Ga0495668_0004128 Ga0495668_0004128_1396_4299 936
354 3300048905 Ga0496102_0000280 Ga0496102_0000280_31798_34683 936
355 3300049459 Ga0495678_002004 Ga0495678_002004_10018_12918 936
356 3300049459 Ga0495678_004895 Ga0495678_004895_2021_4924 936
357 3300046491 Ga0495584_0000015 Ga0495584_0000015_60222_63161 937
358 3300046492 Ga0495585_0000334 Ga0495585_0000334_8240_11200 937
359 3300046492 Ga0495585_0001142 Ga0495585_0001142_914_3961 937
360 3300046513 Ga0495616_0001295 Ga0495616_0001295_11184_14144 937
361 3300046524 Ga0495648_0001524 Ga0495648_0001524_8240_11200 937
362 3300046528 Ga0495642_0000560 Ga0495642_0000560_7047_9956 937
363 3300046528 Ga0495642_0001743 Ga0495642_0001743_442_3309 937
364 3300047470 Ga0495681_0023046 Ga0495681_0023046_259_3168 937
365 3300003322 rootL2_10038209 rootL2_100382092 938
366 3300045976 Ga0466967_0009203 Ga0466967_0009203_1706_4600 938
367 3300046474 Ga0495605_0000265 Ga0495605_0000265_32970_35825 938
368 3300046501 Ga0495607_0008474 Ga0495607_0008474_3478_6333 938
369 3300046506 Ga0495583_0012400 Ga0495583_0012400_1252_4161 938
370 3300046513 Ga0495616_0014510 Ga0495616_0014510_1115_4024 938
371 3300046518 Ga0495631_0008228 Ga0495631_0008228_407_3316 938
372 3300046522 Ga0495643_0002941 Ga0495643_0002941_2172_5027 938
373 3300046538 Ga0495609_0002729 Ga0495609_0002729_5898_8807 938
374 3300046674 Ga0495588_0000190 Ga0495588_0000190_44658_47513 938
375 3300046794 Ga0495589_0000268 Ga0495589_0000268_6086_8941 938
376 3300047320 Ga0495672_0001397 Ga0495672_0001397_16518_19373 938
377 3300047320 Ga0495672_0009891 Ga0495672_0009891_1636_4545 938
378 3300047443 Ga0495687_002713 Ga0495687_002713_6459_9314 938
379 3300047445 Ga0495677_0000709 Ga0495677_0000709_6442_9297 938
380 3300047445 Ga0495677_0002508 Ga0495677_0002508_322_3231 938
381 3300048091 Ga0495626_0000050 Ga0495626_0000050_39947_42802 938

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07715

Plug

TonB-dependent Receptor Plug Domain

88

203

0.97

PF00593

TonB_dep_Rec_b-barrel

TonB dependent receptor-like, beta-barrel

404

973

0.69

Structural Annotation

Top 5 Hits

ID Description Score Start End
5fp2-assembly2.cif.gz_B crystal structure of the siderophore receptor pira from pseudomonas aeruginosa 0.7847 41 938
5fp2-assembly1.cif.gz_A crystal structure of the siderophore receptor pira from pseudomonas aeruginosa 0.7818 41 938
1nqe-assembly1.cif.gz_A outer membrane cobalamin transporter (btub) from e. coli 0.779 32 938
3rgm-assembly1.cif.gz_A crystal structure of spin-labeled btub t156r1 0.7778 41 938
5fp2-assembly2.cif.gz_B crystal structure of the siderophore receptor pira from pseudomonas aeruginosa 0.774 41 938
ID Description Score Start End Superfamily
2hdiA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.7464 159 938 2.40.170.20
2hdiA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.7406 159 938 2.40.170.20
3rgnA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.7389 153 938 2.40.170.20
3rgnA02 Mainly Beta;Beta Barrel;Maltoporin; Chain A;TonB-dependent receptor, beta-barrel domain 0.7357 153 938 2.40.170.20
3cslA01 Mainly Beta;Beta Complex;Ferric Hydroxamate Uptake Protein; Chain A, domain 1;TonB-dependent receptor, plug domain 0.6778 41 154 2.170.130.10
ID Description Score Start End GO Terms
AF-A0A7U1E9A3-F1-model_v4 deleted 0.889 368 612
AF-A0A509E266-F1-model_v4 deleted 0.8727 13 938
AF-A0A354Z1F9-F1-model_v4 TonB-dependent receptor 0.8716 136 938 GO:0009279
AF-A0A354Z1F9-F1-model_v4 TonB-dependent receptor 0.8695 136 938 GO:0009279
AF-A0A3C0X997-F1-model_v4 deleted 0.8532 5 705

Feature Viewer

pLDDT pTM Quality
86.64 0.85 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map