F429033

General Info

Members Datasets Scaffolds Average Seq Length
381 226 377 168

Family's Representative Sequence

Representative Sequence 3300045049|Ga0466959_0321277|Ga0466959_0321277_482_1036
Length 184
Sequence MAEPFLSEIRIMSFNFAPKGWALCNGQILPINQNQALFSLLGTRYGGDGRTNFALPDLRGRISLHMGSSGGGNHALGEKGGEVAHTLNISEMAAHTHLVNAIDASPAQGNAGHIPSNTRLLAQSQAIVNGNAQDVQLYVPTNPSKSFAAGSVNPSGGSQPHQNQQPFLALNFCIALQGIFPSQN

Samples

Sample ID Description Type Environment
1 2643221725 Flavobacterium sp. Root935 Isolate Unclassified
2 2802428842 Flavobacterium sp. S87F.05.LMB.W.Kidney.N Isolate Unclassified
3 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
4 2977268062 Flavobacterium sp. SORGH_AS 622 Isolate Unclassified
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
8 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
11 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
12 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
20 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
21 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
27 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
28 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
29 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
30 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
31 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
32 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
33 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
34 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
38 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
41 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
42 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
47 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
48 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
54 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
55 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
56 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
57 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
58 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
59 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
60 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
61 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
62 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
63 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
64 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
65 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
66 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
67 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
68 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
69 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
79 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
80 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
81 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
82 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
83 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
84 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
85 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
86 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
87 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
88 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
89 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
90 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
91 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
92 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
95 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
96 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
97 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
98 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
99 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
100 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
101 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
102 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
103 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
104 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
105 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
106 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
107 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
108 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
109 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
110 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
111 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
112 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
113 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
114 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
115 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
116 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
117 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
118 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
119 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
120 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
121 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
122 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
123 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
124 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
125 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
126 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
127 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
128 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
129 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
130 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
131 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
132 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
133 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
134 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
135 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
136 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
137 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
140 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
141 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
142 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
143 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
144 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
149 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
150 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
151 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
152 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
153 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
154 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
155 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
156 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
157 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
158 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
159 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
162 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
163 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
164 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
165 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
166 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
167 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
168 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
169 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
170 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
171 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
172 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
173 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
174 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
175 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
176 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
177 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
178 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
179 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
180 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
181 3300059478 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 58R_AW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
182 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
183 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
184 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
185 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
186 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
187 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
188 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
189 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
190 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
191 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
192 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
193 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
194 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
195 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
196 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
197 3300059514 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 106R_AW_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
198 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
199 3300059607 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 163R_SW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
200 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
202 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
203 3300059626 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 173R_CD_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
204 3300059627 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 154R_AW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
205 3300059629 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 186R_SW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
209 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
210 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
215 3300059646 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 42R_SW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
216 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
220 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
221 3300059654 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 148R_CW_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
222 3300059656 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 153R_AW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
223 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
224 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
225 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
226 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 56.43
Metatranscriptomes 42.52
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.71
Nodule 0
Rhizoplane 1.31
Rhizosphere 85.83
Stem 0
Stem Tuber 0
Unclassified 3.15

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25152J39213_1014280 3300002773 Bacteria 1618
2 JGI25150J39212_1000131 3300002774 Bacteria 41933
3 JGI25151J46595_10042062 3300003187 Bacteria 1651
4 JGI25153J46596_10000036 3300003215 Bacteria 182205
5 rootH2_10100040 3300003320 Bacteria 1103
6 Ga0055536_1020423 3300003781 Bacteria 2045
7 Ga0055530_10017057 3300003791 Bacteria 2288
8 Ga0055540_1004778 3300003792 Bacteria 5965
9 Ga0055531_10085024 3300003794 Bacteria 686
10 Ga0055531_10085877 3300003794 Bacteria 680
11 Ga0065712_10139759 3300005290 Bacteria 1461
12 Ga0065715_10091483 3300005293 Bacteria 5759
13 Ga0070683_101160068 3300005329 Bacteria 742
14 Ga0070670_100912032 3300005331 Bacteria 797
15 Ga0070689_101132682 3300005340 Bacteria 700
16 Ga0070691_10201866 3300005341 Bacteria 1045
17 Ga0070669_100160363 3300005353 Bacteria 1747
18 Ga0070688_100859847 3300005365 Bacteria 713
19 Ga0070709_10115568 3300005434 Bacteria 1810
20 Ga0070714_100024782 3300005435 Bacteria 4943
21 Ga0070713_100006501 3300005436 Bacteria 8109
22 Ga0070710_11061498 3300005437 Bacteria 593
23 Ga0070708_100445005 3300005445 Bacteria 1222
24 Ga0070681_10981628 3300005458 Bacteria 764
25 Ga0070707_101292336 3300005468 Unclassified 696
26 Ga0070698_100387645 3300005471 Bacteria 1330
27 Ga0070699_100708047 3300005518 Bacteria 920
28 Ga0070699_100833677 3300005518 Unclassified 844
29 Ga0070695_100000714 3300005545 Bacteria 17670
30 Ga0070695_100080665 3300005545 Bacteria 2151
31 Ga0070696_100617124 3300005546 Bacteria 876
32 Ga0070696_100710119 3300005546 Unclassified 820
33 Ga0070704_100461079 3300005549 Viruses 1096
34 Ga0081539_10002275 3300005985 Bacteria 27826
35 Ga0070717_11102691 3300006028 Bacteria 723
36 Ga0075365_10057146 3300006038 Bacteria 2596
37 Ga0075365_10057467 3300006038 Bacteria 2588
38 Ga0075363_100239336 3300006048 Bacteria 1043
39 Ga0070716_100041784 3300006173 Bacteria 2556
40 Ga0070716_100219288 3300006173 Bacteria 1277
41 Ga0070716_100805425 3300006173 Viruses 728
42 Ga0075367_10230842 3300006178 Bacteria 1159
43 Ga0097621_101144745 3300006237 Viruses 732
44 Ga0075370_10115939 3300006353 Bacteria 1557
45 Ga0068871_100395633 3300006358 Bacteria 1230
46 Ga0075428_100099848 3300006844 Bacteria 3165
47 Ga0075428_100483889 3300006844 Bacteria 1325
48 Ga0105240_10105348 3300009093 Bacteria 3424
49 Ga0105240_11632288 3300009093 Bacteria 674
50 Ga0114129_10037559 3300009147 Bacteria 6837
51 Ga0114129_10263576 3300009147 Bacteria 2308
52 Ga0114129_10264444 3300009147 Bacteria 2304
53 Ga0105237_10232910 3300009545 Bacteria 1842
54 Ga0105237_10316691 3300009545 Bacteria 1563
55 Ga0105238_10005435 3300009551 Bacteria 12587
56 Ga0099796_10112314 3300010159 Bacteria 1038
57 Ga0105239_10070661 3300010375 Unclassified 3835
58 Ga0157373_10000035 3300013100 Bacteria 123284
59 Ga0157370_10001860 3300013104 Bacteria 26021
60 Ga0157370_11479340 3300013104 Bacteria 611
61 Ga0157374_10383455 3300013296 Bacteria 1400
62 Ga0157375_10000200 3300013308 Bacteria 55945
63 Ga0163163_10002086 3300014325 Bacteria 16878
64 Ga0182008_10026412 3300014497 Bacteria 2945
65 Ga0157376_10184961 3300014969 Bacteria 1907
66 Ga0182006_1000863 3300015261 Bacteria 20367
67 Ga0163161_11488118 3300017792 Bacteria 594
68 Ga0213875_10022046 3300021388 Bacteria 3048
69 Ga0207425_1000037 3300025245 Bacteria 224645
70 Ga0209129_1000520 3300025258 Bacteria 27282
71 Ga0209673_1059689 3300025273 Bacteria 959
72 Ga0209676_1009744 3300025292 Bacteria 4103
73 Ga0209025_1000117 3300025294 Bacteria 215073
74 Ga0209758_1000103 3300025297 Bacteria 223968
75 Ga0209050_1000001 3300025298 Bacteria 3563507
76 Ga0209051_1001284 3300025303 Bacteria 22247
77 Ga0209051_1059316 3300025303 Bacteria 1214
78 Ga0209257_1000949 3300025304 Bacteria 40020
79 Ga0209257_1001068 3300025304 Bacteria 36202
80 Ga0207707_10312492 3300025912 Bacteria 1358
81 Ga0207695_10043810 3300025913 Bacteria 4764
82 Ga0207671_10169395 3300025914 Bacteria 1695
83 Ga0207660_10527430 3300025917 Bacteria 959
84 Ga0207652_10222060 3300025921 Bacteria 1703
85 Ga0207681_10148418 3300025923 Bacteria 1754
86 Ga0207700_10000002 3300025928 Bacteria 775978
87 Ga0207664_10458987 3300025929 Bacteria 1138
88 Ga0207665_10126455 3300025939 Bacteria 1810
89 Ga0207676_10034643 3300026095 Bacteria 3824
90 Ga0307408_100761448 3300031548 Bacteria 875
91 Ga0373936_0028327 3300035113 Bacteria 2202
92 Ga0373945_0043606 3300035116 Bacteria 1628
93 Ga0373954_0001190 3300035118 Bacteria 10449
94 Ga0373956_0022673 3300035119 Bacteria 2688
95 Ga0373943_0160604 3300035170 Bacteria 1223
96 Ga0373955_0039934 3300035172 Bacteria 2507
97 Ga0373924_0092038 3300035410 Bacteria 1298
98 Ga0373935_0000108 3300035692 Bacteria 37623
99 Ga0373933_0006176 3300035724 Bacteria 6522
100 Ga0373933_0375266 3300035724 Bacteria 926
101 Ga0373947_0194462 3300035725 Bacteria 1325
102 Ga0373937_0000007 3300036401 Bacteria 183537
103 Ga0316584_0214290 3300036712 Bacteria 1417
104 Ga0373925_0000011 3300037068 Bacteria 209840
105 Ga0395900_0375477 3300037418 Bacteria 1391
106 Ga0395900_0392390 3300037418 Bacteria 1354
107 Ga0395898_0098884 3300037466 Bacteria 2802
108 Ga0436364_0017402 3300037853 Bacteria 3071
109 Ga0436365_1563685 3300039437 Bacteria 582
110 Ga0436360_0873760 3300039438 Viruses 1018
111 Ga0436363_0311674 3300039450 Bacteria 1596
112 Ga0439434_0184133 3300042435 Bacteria 700
113 Ga0466972_0044171 3300044658 Bacteria 2162
114 Ga0466982_0000006 3300044672 Bacteria 333931
115 Ga0466966_0001515 3300044684 Bacteria 14894
116 Ga0466966_0184606 3300044684 Bacteria 1265
117 Ga0466961_0061676 3300044693 Bacteria 2383
118 Ga0466963_0301551 3300044694 Bacteria 1127
119 Ga0466963_0410490 3300044694 Bacteria 955
120 Ga0466964_0006076 3300044706 Bacteria 4499
121 Ga0466971_0017295 3300044719 Bacteria 3188
122 Ga0466968_0044840 3300044735 Bacteria 1874
123 Ga0466970_0139946 3300044765 Bacteria 1332
124 Ga0466957_0201023 3300044842 Bacteria 1309
125 Ga0466957_0651833 3300044842 Bacteria 740
126 Ga0466960_0073110 3300044901 Bacteria 1710
127 Ga0466959_0321277 3300045049 Bacteria 1058
128 Ga0466959_0324212 3300045049 Bacteria 1053
129 Ga0451576_1132900 3300045051 Bacteria 818
130 Ga0495592_0000390 3300046454 Bacteria 34192
131 Ga0495629_0013611 3300046459 Bacteria 5869
132 Ga0495629_0811849 3300046459 Unclassified 617
133 Ga0495638_0001170 3300046460 Bacteria 25207
134 Ga0495638_0016948 3300046460 Bacteria 4870
135 Ga0495651_0002515 3300046462 Bacteria 14197
136 Ga0495653_0000249 3300046463 Bacteria 43160
137 Ga0495650_0030696 3300046471 Bacteria 2430
138 Ga0495580_0312944 3300046472 Viruses 1068
139 Ga0495662_0024332 3300046476 Bacteria 2922
140 Ga0495664_0000024 3300046477 Bacteria 126593
141 Ga0495608_0000004 3300046511 Bacteria 355027
142 Ga0495610_0000224 3300046512 Bacteria 60910
143 Ga0495610_0049442 3300046512 Bacteria 2059
144 Ga0495616_0213130 3300046513 Bacteria 844
145 Ga0495618_0000036 3300046514 Bacteria 101535
146 Ga0495628_0000006 3300046516 Bacteria 306606
147 Ga0495630_0000601 3300046517 Bacteria 26137
148 Ga0495637_0005144 3300046520 Bacteria 6705
149 Ga0495652_0000038 3300046529 Bacteria 129311
150 Ga0495640_0000013 3300046533 Bacteria 172438
151 Ga0495640_0233680 3300046533 Bacteria 1156
152 Ga0495587_0000004 3300046536 Bacteria 358433
153 Ga0495645_0000001 3300046543 Bacteria 657910
154 Ga0495667_0000084 3300046559 Bacteria 67342
155 Ga0495668_0000034 3300046616 Bacteria 254171
156 Ga0495634_0051265 3300046642 Bacteria 2769
157 Ga0495634_0111245 3300046642 Bacteria 1761
158 Ga0495625_0012665 3300046660 Bacteria 6825
159 Ga0495635_0000003 3300046663 Bacteria 390055
160 Ga0495635_0232646 3300046663 Bacteria 1245
161 Ga0495657_0000248 3300046675 Bacteria 49080
162 Ga0495599_0000014 3300046678 Bacteria 177414
163 Ga0495623_0000015 3300046679 Bacteria 117329
164 Ga0495646_0000005 3300046680 Bacteria 266899
165 Ga0495658_0204063 3300046683 Viruses 1233
166 Ga0495613_0047066 3300046689 Bacteria 3186
167 Ga0495624_0169014 3300046690 Bacteria 1334
168 Ga0495600_0599381 3300046809 Bacteria 669
169 Ga0495581_0459833 3300047315 Bacteria 741
170 Ga0495604_0000002 3300047317 Bacteria 530904
171 Ga0495674_0000004 3300047319 Bacteria 531855
172 Ga0495674_0611255 3300047319 Bacteria 863
173 Ga0495672_0015071 3300047320 Bacteria 5261
174 Ga0495680_0000142 3300047322 Bacteria 72324
175 Ga0495680_0101952 3300047322 Bacteria 2138
176 Ga0495680_0199303 3300047322 Unclassified 1437
177 Ga0495675_0000053 3300047444 Bacteria 78760
178 Ga0495684_0000004 3300047471 Bacteria 307093
179 Ga0495686_0465802 3300047472 Bacteria 669
180 Ga0495593_0002002 3300047673 Bacteria 12149
181 Ga0495602_0000001 3300048088 Bacteria 510904
182 Ga0496102_0121121 3300048905 Bacteria 2443
183 Ga0496103_0033317 3300048906 Bacteria 3147
184 Ga0496105_0668066 3300048908 Bacteria 800
185 Ga0496106_0369333 3300048909 Bacteria 1153
186 Ga0496110_0035721 3300048913 Bacteria 4313
187 Ga0496117_0149286 3300048920 Bacteria 1386
188 Ga0496118_0127371 3300048921 Bacteria 1643
189 Ga0496124_0027969 3300048927 Bacteria 5050
190 Ga0501238_000907 3300049671 Bacteria 3381
191 Ga0501238_018489 3300049671 Bacteria 975
192 Ga0501083_0085717 3300049744 Bacteria 2084
193 nmdc:mga00v17_118500_c1 3300050491 Bacteria 1684
194 nmdc:mga0yw44_171489_c1 3300050492 Bacteria 1425
195 nmdc:mga0yw44_190530_c1 3300050492 Bacteria 1352
196 nmdc:mga0yw44_251716_c1 3300050492 Bacteria 1176
197 nmdc:mga0yw44_36217_c1 3300050492 Bacteria 2906
198 nmdc:mga0yw44_44789_c1 3300050492 Bacteria 2649
199 nmdc:mga07m45_131502_c1 3300050496 Bacteria 1448
200 nmdc:mga05p37_213749_c1 3300050507 Bacteria 2330
201 nmdc:mga05p37_80026_c1 3300050507 Bacteria 4024
202 nmdc:mga09592_265297_c1 3300050508 Bacteria 1489
203 nmdc:mga0qj67_23850_c1 3300050509 Bacteria 4711
204 Ga0495601_0000026 3300053077 Bacteria 126257
205 Ga0495601_0172362 3300053077 Bacteria 1414
206 Ga0495612_0000005 3300053078 Bacteria 286943
207 Ga0495595_0000065 3300053084 Bacteria 52635
208 Ga0495619_0000003 3300053085 Bacteria 515784
209 Ga0495619_0512287 3300053085 Bacteria 825
210 Ga0500556_0000479 3300053104 Bacteria 27876
211 Ga0500592_011413 3300053116 Bacteria 1421
212 Ga0500658_0007555 3300053134 Bacteria 4017
213 Ga0500645_001260 3300053730 Bacteria 13310
214 Ga0500645_007295 3300053730 Bacteria 3864
215 Ga0587084_003424 3300059477 Bacteria 1744
216 Ga0587084_011356 3300059477 Bacteria 1185
217 Ga0587084_018494 3300059477 Bacteria 1017
218 Ga0587084_044902 3300059477 Bacteria 764
219 Ga0587093_001140 3300059478 Bacteria 2146
220 Ga0587093_002065 3300059478 Bacteria 1812
221 Ga0587093_005134 3300059478 Bacteria 1369
222 Ga0587093_024915 3300059478 Bacteria 827
223 Ga0587093_037519 3300059478 Bacteria 723
224 Ga0587066_005566 3300059490 Bacteria 1619
225 Ga0587066_019640 3300059490 Bacteria 1101
226 Ga0587066_073182 3300059490 Bacteria 726
227 Ga0587066_096373 3300059490 Bacteria 665
228 Ga0587070_002603 3300059491 Bacteria 2069
229 Ga0587070_003060 3300059491 Bacteria 1968
230 Ga0587070_011013 3300059491 Bacteria 1344
231 Ga0587070_020273 3300059491 Bacteria 1110
232 Ga0587070_021292 3300059491 Bacteria 1094
233 Ga0587073_0006506 3300059492 Bacteria 1801
234 Ga0587073_0007805 3300059492 Bacteria 1708
235 Ga0587073_0141687 3300059492 Bacteria 671
236 Ga0587073_0144771 3300059492 Bacteria 666
237 Ga0587077_005026 3300059493 Bacteria 1781
238 Ga0587077_007018 3300059493 Bacteria 1622
239 Ga0587077_036750 3300059493 Bacteria 963
240 Ga0587077_045347 3300059493 Bacteria 899
241 Ga0587077_154113 3300059493 Bacteria 603
242 Ga0587080_005736 3300059503 Bacteria 1681
243 Ga0587082_000786 3300059504 Bacteria 2935
244 Ga0587082_004259 3300059504 Bacteria 1779
245 Ga0587082_014947 3300059504 Bacteria 1191
246 Ga0587082_061891 3300059504 Bacteria 740
247 Ga0587083_0003740 3300059505 Bacteria 2054
248 Ga0587083_0004813 3300059505 Bacteria 1907
249 Ga0587083_0018737 3300059505 Bacteria 1256
250 Ga0587085_003063 3300059506 Bacteria 1777
251 Ga0587085_003313 3300059506 Bacteria 1738
252 Ga0587085_004964 3300059506 Bacteria 1541
253 Ga0587085_014898 3300059506 Bacteria 1104
254 Ga0587086_002564 3300059507 Bacteria 1734
255 Ga0587086_006220 3300059507 Bacteria 1324
256 Ga0587086_006966 3300059507 Bacteria 1281
257 Ga0587086_011641 3300059507 Bacteria 1082
258 Ga0587086_055594 3300059507 Bacteria 648
259 Ga0587088_007754 3300059508 Bacteria 1497
260 Ga0587088_023452 3300059508 Bacteria 1050
261 Ga0587088_046943 3300059508 Bacteria 833
262 Ga0587089_005463 3300059509 Bacteria 1441
263 Ga0587090_004078 3300059510 Bacteria 1746
264 Ga0587090_005350 3300059510 Bacteria 1605
265 Ga0587090_022792 3300059510 Bacteria 992
266 Ga0587091_002911 3300059511 Bacteria 2096
267 Ga0587091_005158 3300059511 Bacteria 1761
268 Ga0587091_033819 3300059511 Bacteria 974
269 Ga0587091_094536 3300059511 Bacteria 692
270 Ga0587092_001080 3300059512 Bacteria 2533
271 Ga0587092_003474 3300059512 Bacteria 1794
272 Ga0587092_004470 3300059512 Bacteria 1670
273 Ga0587092_037885 3300059512 Bacteria 827
274 Ga0587094_003090 3300059513 Bacteria 1782
275 Ga0587094_004757 3300059513 Bacteria 1557
276 Ga0587094_041735 3300059513 Bacteria 749
277 Ga0587094_061122 3300059513 Bacteria 659
278 Ga0587095_001178 3300059514 Bacteria 1556
279 Ga0587095_001376 3300059514 Bacteria 1485
280 Ga0587095_016112 3300059514 Bacteria 683
281 Ga0587106_004519 3300059605 Bacteria 1535
282 Ga0587106_004889 3300059605 Bacteria 1500
283 Ga0587106_009245 3300059605 Bacteria 1249
284 Ga0587106_102494 3300059605 Bacteria 586
285 Ga0587125_001858 3300059607 Bacteria 1610
286 Ga0587125_004010 3300059607 Bacteria 1286
287 Ga0587125_037468 3300059607 Bacteria 643
288 Ga0587099_019591 3300059622 Bacteria 755
289 Ga0587101_003346 3300059623 Bacteria 1620
290 Ga0587101_019614 3300059623 Bacteria 960
291 Ga0587101_029914 3300059623 Bacteria 843
292 Ga0587101_058728 3300059623 Bacteria 681
293 Ga0587101_084944 3300059623 Bacteria 606
294 Ga0587109_004247 3300059624 Bacteria 1972
295 Ga0587109_008080 3300059624 Bacteria 1612
296 Ga0587109_067349 3300059624 Bacteria 767
297 Ga0587109_116411 3300059624 Bacteria 630
298 Ga0587115_004331 3300059626 Bacteria 1548
299 Ga0587115_026165 3300059626 Bacteria 842
300 Ga0587117_003666 3300059627 Bacteria 1549
301 Ga0587117_018165 3300059627 Bacteria 954
302 Ga0587117_033134 3300059627 Bacteria 789
303 Ga0587127_006431 3300059629 Bacteria 832
304 Ga0587127_014132 3300059629 Bacteria 656
305 Ga0587128_003371 3300059630 Bacteria 1768
306 Ga0587130_003790 3300059631 Bacteria 1294
307 Ga0587062_001339 3300059639 Bacteria 2094
308 Ga0587062_006396 3300059639 Bacteria 1337
309 Ga0587062_053074 3300059639 Bacteria 692
310 Ga0587067_006117 3300059640 Bacteria 1662
311 Ga0587067_011333 3300059640 Bacteria 1371
312 Ga0587067_027295 3300059640 Bacteria 1029
313 Ga0587067_036492 3300059640 Bacteria 935
314 Ga0587068_001766 3300059641 Bacteria 2505
315 Ga0587068_017545 3300059641 Bacteria 1144
316 Ga0587068_057543 3300059641 Bacteria 741
317 Ga0587069_002395 3300059642 Bacteria 1886
318 Ga0587069_003044 3300059642 Bacteria 1773
319 Ga0587069_003248 3300059642 Bacteria 1738
320 Ga0587069_003833 3300059642 Bacteria 1655
321 Ga0587072_009520 3300059643 Bacteria 1554
322 Ga0587072_010202 3300059643 Bacteria 1514
323 Ga0587072_021358 3300059643 Bacteria 1148
324 Ga0587072_092562 3300059643 Bacteria 668
325 Ga0587075_001521 3300059644 Bacteria 2265
326 Ga0587075_002413 3300059644 Bacteria 1970
327 Ga0587075_011083 3300059644 Bacteria 1204
328 Ga0587076_000503 3300059645 Bacteria 3229
329 Ga0587076_002544 3300059645 Bacteria 2056
330 Ga0587076_003537 3300059645 Bacteria 1871
331 Ga0587076_014957 3300059645 Bacteria 1202
332 Ga0587076_040447 3300059645 Bacteria 869
333 Ga0587078_001991 3300059646 Bacteria 1931
334 Ga0587078_002680 3300059646 Bacteria 1740
335 Ga0587078_003386 3300059646 Bacteria 1611
336 Ga0587078_021359 3300059646 Bacteria 820
337 Ga0587078_022066 3300059646 Viruses 811
338 Ga0587079_000900 3300059647 Bacteria 3042
339 Ga0587079_000919 3300059647 Bacteria 3017
340 Ga0587079_001898 3300059647 Bacteria 2449
341 Ga0587079_009881 3300059647 Bacteria 1497
342 Ga0587079_020212 3300059647 Bacteria 1186
343 Ga0587079_044049 3300059647 Bacteria 913
344 Ga0587100_001066 3300059648 Bacteria 1512
345 Ga0587102_001718 3300059649 Bacteria 1591
346 Ga0587102_022955 3300059649 Bacteria 717
347 Ga0587107_001746 3300059652 Bacteria 1830
348 Ga0587107_011160 3300059652 Bacteria 1095
349 Ga0587107_013544 3300059652 Bacteria 1035
350 Ga0587107_023068 3300059652 Bacteria 886
351 Ga0587107_047515 3300059652 Unclassified 716
352 Ga0587108_014919 3300059653 Bacteria 695
353 Ga0587108_015696 3300059653 Bacteria 683
354 Ga0587110_000546 3300059654 Bacteria 2294
355 Ga0587110_001031 3300059654 Bacteria 1899
356 Ga0587110_001847 3300059654 Bacteria 1604
357 Ga0587116_02535 3300059656 Bacteria 968
358 Ga0587116_05136 3300059656 Bacteria 779
359 Ga0587116_06726 3300059656 Bacteria 715
360 Ga0587119_002503 3300059658 Bacteria 1663
361 Ga0587119_002665 3300059658 Bacteria 1634
362 Ga0587071_002763 3300060344 Bacteria 2433
363 Ga0587071_006117 3300060344 Bacteria 1869
364 Ga0587071_015721 3300060344 Bacteria 1331
365 Ga0587071_037085 3300060344 Bacteria 963
366 Ga0587071_040810 3300060344 Bacteria 929
367 Ga0587071_086215 3300060344 Bacteria 707
368 Ga0587111_0001070 3300060346 Bacteria 3088
369 Ga0587111_0003362 3300060346 Bacteria 2265
370 Ga0587111_0006613 3300060346 Bacteria 1847
371 Ga0587111_0008251 3300060346 Bacteria 1721
372 Ga0587111_0021809 3300060346 Bacteria 1239
373 Ga0587111_0050892 3300060346 Bacteria 914
374 Ga0587111_0095982 3300060346 Bacteria 731
375 Ga0587111_0168363 3300060346 Bacteria 601
376 Ga0587111_0215060 3300060346 Unclassified 552
377 Ga0466962_0001003 3300061719 Bacteria 12911

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046460 Ga0495638_0001170 Ga0495638_0001170_7392_7931 146
2 3300046512 Ga0495610_0000224 Ga0495610_0000224_17432_17977 146
3 3300046660 Ga0495625_0012665 Ga0495625_0012665_2039_2584 146
4 3300049671 Ga0501238_000907 Ga0501238_000907_998_1543 146
5 3300049671 Ga0501238_018489 Ga0501238_018489_102_647 146
6 3300053134 Ga0500658_0007555 Ga0500658_0007555_2763_3308 146
7 3300005340 Ga0070689_101132682 Ga0070689_1011326821 147
8 3300009093 Ga0105240_10105348 Ga0105240_101053482 147
9 3300009545 Ga0105237_10232910 Ga0105237_102329102 147
10 3300013104 Ga0157370_11479340 Ga0157370_114793402 147
11 3300025912 Ga0207707_10312492 Ga0207707_103124922 147
12 3300025913 Ga0207695_10043810 Ga0207695_100438106 147
13 3300025917 Ga0207660_10527430 Ga0207660_105274302 147
14 3300025921 Ga0207652_10222060 Ga0207652_102220603 147
15 3300035725 Ga0373947_0194462 Ga0373947_0194462_801_1295 147
16 3300046690 Ga0495624_0169014 Ga0495624_0169014_817_1311 147
17 3300048905 Ga0496102_0121121 Ga0496102_0121121_370_882 147
18 3300048906 Ga0496103_0033317 Ga0496103_0033317_1654_2166 147
19 3300048909 Ga0496106_0369333 Ga0496106_0369333_35_547 147
20 3300059605 Ga0587106_102494 Ga0587106_102494_27_545 147
21 3300005985 Ga0081539_10002275 Ga0081539_1000227516 148
22 3300047320 Ga0495672_0015071 Ga0495672_0015071_1050_1595 148
23 3300053730 Ga0500645_007295 Ga0500645_007295_1098_1643 148
24 3300006844 Ga0075428_100483889 Ga0075428_1004838892 149
25 3300009147 Ga0114129_10263576 Ga0114129_102635764 149
26 3300005341 Ga0070691_10201866 Ga0070691_102018662 152
27 3300005545 Ga0070695_100000714 Ga0070695_10000071410 152
28 3300009093 Ga0105240_11632288 Ga0105240_116322881 152
29 3300009545 Ga0105237_10316691 Ga0105237_103166911 152
30 3300025914 Ga0207671_10169395 Ga0207671_101693951 152
31 3300046471 Ga0495650_0030696 Ga0495650_0030696_747_1292 154
32 3300050492 nmdc:mga0yw44_36217_c1 nmdc:mga0yw44_36217_c1_2368_2865 156
33 3300009147 Ga0114129_10264444 Ga0114129_102644442 158
34 3300050507 nmdc:mga05p37_213749_c1 nmdc:mga05p37_213749_c1_824_1321 158
35 3300050492 nmdc:mga0yw44_171489_c1 nmdc:mga0yw44_171489_c1_876_1358 160
36 3300050492 nmdc:mga0yw44_251716_c1 nmdc:mga0yw44_251716_c1_93_575 160
37 3300053085 Ga0495619_0512287 Ga0495619_0512287_61_543 160
38 3300037853 Ga0436364_0017402 Ga0436364_0017402_2409_2930 161
39 3300005365 Ga0070688_100859847 Ga0070688_1008598472 162
40 3300005436 Ga0070713_100006501 Ga0070713_10000650111 162
41 3300005437 Ga0070710_11061498 Ga0070710_110614981 162
42 3300006173 Ga0070716_100219288 Ga0070716_1002192883 162
43 3300006173 Ga0070716_100805425 Ga0070716_1008054252 162
44 3300014497 Ga0182008_10026412 Ga0182008_100264122 162
45 3300025928 Ga0207700_10000002 Ga0207700_10000002242 162
46 3300039438 Ga0436360_0873760 Ga0436360_0873760_20_517 162
47 3300044684 Ga0466966_0184606 Ga0466966_0184606_300_797 162
48 3300044693 Ga0466961_0061676 Ga0466961_0061676_640_1137 162
49 3300044842 Ga0466957_0201023 Ga0466957_0201023_528_1022 162
50 3300046533 Ga0495640_0233680 Ga0495640_0233680_372_866 162
51 3300046642 Ga0495634_0111245 Ga0495634_0111245_347_841 162
52 3300047319 Ga0495674_0611255 Ga0495674_0611255_268_762 162
53 3300047322 Ga0495680_0101952 Ga0495680_0101952_1424_1918 162
54 3300048913 Ga0496110_0035721 Ga0496110_0035721_511_1011 162
55 3300053077 Ga0495601_0172362 Ga0495601_0172362_307_804 162
56 3300059477 Ga0587084_044902 Ga0587084_044902_145_645 162
57 3300059478 Ga0587093_001140 Ga0587093_001140_575_1075 162
58 3300059478 Ga0587093_005134 Ga0587093_005134_316_816 162
59 3300059490 Ga0587066_019640 Ga0587066_019640_397_897 162
60 3300059490 Ga0587066_073182 Ga0587066_073182_190_690 162
61 3300059490 Ga0587066_096373 Ga0587066_096373_109_609 162
62 3300059491 Ga0587070_002603 Ga0587070_002603_395_895 162
63 3300059491 Ga0587070_011013 Ga0587070_011013_680_1180 162
64 3300059492 Ga0587073_0006506 Ga0587073_0006506_1078_1578 162
65 3300059492 Ga0587073_0144771 Ga0587073_0144771_133_633 162
66 3300059493 Ga0587077_045347 Ga0587077_045347_258_758 162
67 3300059503 Ga0587080_005736 Ga0587080_005736_906_1406 162
68 3300059504 Ga0587082_004259 Ga0587082_004259_1088_1582 162
69 3300059504 Ga0587082_014947 Ga0587082_014947_197_697 162
70 3300059505 Ga0587083_0003740 Ga0587083_0003740_168_668 162
71 3300059505 Ga0587083_0004813 Ga0587083_0004813_337_837 162
72 3300059505 Ga0587083_0018737 Ga0587083_0018737_141_635 162
73 3300059506 Ga0587085_004964 Ga0587085_004964_376_876 162
74 3300059506 Ga0587085_014898 Ga0587085_014898_366_866 162
75 3300059507 Ga0587086_006220 Ga0587086_006220_458_958 162
76 3300059507 Ga0587086_006966 Ga0587086_006966_190_690 162
77 3300059508 Ga0587088_007754 Ga0587088_007754_842_1342 162
78 3300059508 Ga0587088_023452 Ga0587088_023452_145_645 162
79 3300059508 Ga0587088_046943 Ga0587088_046943_303_803 162
80 3300059509 Ga0587089_005463 Ga0587089_005463_810_1310 162
81 3300059510 Ga0587090_004078 Ga0587090_004078_1106_1606 162
82 3300059510 Ga0587090_022792 Ga0587090_022792_322_822 162
83 3300059511 Ga0587091_033819 Ga0587091_033819_161_661 162
84 3300059512 Ga0587092_001080 Ga0587092_001080_739_1239 162
85 3300059512 Ga0587092_004470 Ga0587092_004470_573_1073 162
86 3300059512 Ga0587092_037885 Ga0587092_037885_27_527 162
87 3300059513 Ga0587094_004757 Ga0587094_004757_176_676 162
88 3300059513 Ga0587094_041735 Ga0587094_041735_108_608 162
89 3300059514 Ga0587095_001376 Ga0587095_001376_953_1453 162
90 3300059605 Ga0587106_004519 Ga0587106_004519_165_665 162
91 3300059607 Ga0587125_004010 Ga0587125_004010_140_640 162
92 3300059607 Ga0587125_037468 Ga0587125_037468_33_533 162
93 3300059622 Ga0587099_019591 Ga0587099_019591_220_720 162
94 3300059623 Ga0587101_003346 Ga0587101_003346_882_1382 162
95 3300059623 Ga0587101_019614 Ga0587101_019614_305_805 162
96 3300059623 Ga0587101_084944 Ga0587101_084944_81_581 162
97 3300059624 Ga0587109_004247 Ga0587109_004247_274_774 162
98 3300059624 Ga0587109_008080 Ga0587109_008080_684_1184 162
99 3300059626 Ga0587115_004331 Ga0587115_004331_159_659 162
100 3300059626 Ga0587115_026165 Ga0587115_026165_309_809 162
101 3300059627 Ga0587117_003666 Ga0587117_003666_184_684 162
102 3300059627 Ga0587117_033134 Ga0587117_033134_253_753 162
103 3300059629 Ga0587127_006431 Ga0587127_006431_66_566 162
104 3300059629 Ga0587127_014132 Ga0587127_014132_34_528 162
105 3300059630 Ga0587128_003371 Ga0587128_003371_38_538 162
106 3300059631 Ga0587130_003790 Ga0587130_003790_26_526 162
107 3300059639 Ga0587062_006396 Ga0587062_006396_601_1101 162
108 3300059640 Ga0587067_011333 Ga0587067_011333_202_702 162
109 3300059640 Ga0587067_027295 Ga0587067_027295_358_858 162
110 3300059640 Ga0587067_036492 Ga0587067_036492_31_531 162
111 3300059641 Ga0587068_001766 Ga0587068_001766_608_1108 162
112 3300059641 Ga0587068_017545 Ga0587068_017545_362_862 162
113 3300059642 Ga0587069_002395 Ga0587069_002395_160_660 162
114 3300059642 Ga0587069_003248 Ga0587069_003248_934_1434 162
115 3300059643 Ga0587072_010202 Ga0587072_010202_857_1357 162
116 3300059643 Ga0587072_021358 Ga0587072_021358_70_570 162
117 3300059644 Ga0587075_001521 Ga0587075_001521_856_1356 162
118 3300059644 Ga0587075_011083 Ga0587075_011083_33_533 162
119 3300059645 Ga0587076_002544 Ga0587076_002544_1096_1596 162
120 3300059645 Ga0587076_014957 Ga0587076_014957_672_1172 162
121 3300059645 Ga0587076_040447 Ga0587076_040447_197_697 162
122 3300059646 Ga0587078_002680 Ga0587078_002680_1108_1608 162
123 3300059646 Ga0587078_003386 Ga0587078_003386_10_510 162
124 3300059646 Ga0587078_021359 Ga0587078_021359_144_644 162
125 3300059647 Ga0587079_000919 Ga0587079_000919_1211_1711 162
126 3300059647 Ga0587079_001898 Ga0587079_001898_754_1254 162
127 3300059647 Ga0587079_009881 Ga0587079_009881_183_683 162
128 3300059647 Ga0587079_020212 Ga0587079_020212_142_636 162
129 3300059648 Ga0587100_001066 Ga0587100_001066_979_1479 162
130 3300059649 Ga0587102_001718 Ga0587102_001718_200_700 162
131 3300059649 Ga0587102_022955 Ga0587102_022955_183_683 162
132 3300059652 Ga0587107_001746 Ga0587107_001746_1173_1673 162
133 3300059652 Ga0587107_011160 Ga0587107_011160_565_1065 162
134 3300059652 Ga0587107_013544 Ga0587107_013544_502_1002 162
135 3300059654 Ga0587110_001031 Ga0587110_001031_396_896 162
136 3300059654 Ga0587110_001847 Ga0587110_001847_1071_1571 162
137 3300059656 Ga0587116_02535 Ga0587116_02535_161_661 162
138 3300059656 Ga0587116_06726 Ga0587116_06726_36_536 162
139 3300059658 Ga0587119_002665 Ga0587119_002665_159_659 162
140 3300060344 Ga0587071_002763 Ga0587071_002763_1081_1581 162
141 3300060344 Ga0587071_015721 Ga0587071_015721_711_1211 162
142 3300060346 Ga0587111_0003362 Ga0587111_0003362_759_1259 162
143 3300060346 Ga0587111_0006613 Ga0587111_0006613_247_747 162
144 3300060346 Ga0587111_0021809 Ga0587111_0021809_713_1213 162
145 3300005290 Ga0065712_10139759 Ga0065712_101397593 163
146 3300005293 Ga0065715_10091483 Ga0065715_100914833 163
147 3300005329 Ga0070683_101160068 Ga0070683_1011600681 163
148 3300005331 Ga0070670_100912032 Ga0070670_1009120321 163
149 3300005434 Ga0070709_10115568 Ga0070709_101155682 163
150 3300005435 Ga0070714_100024782 Ga0070714_1000247822 163
151 3300005445 Ga0070708_100445005 Ga0070708_1004450052 163
152 3300005458 Ga0070681_10981628 Ga0070681_109816281 163
153 3300005468 Ga0070707_101292336 Ga0070707_1012923361 163
154 3300005518 Ga0070699_100708047 Ga0070699_1007080472 163
155 3300005545 Ga0070695_100080665 Ga0070695_1000806653 163
156 3300006028 Ga0070717_11102691 Ga0070717_111026911 163
157 3300006038 Ga0075365_10057146 Ga0075365_100571466 163
158 3300006038 Ga0075365_10057467 Ga0075365_100574674 163
159 3300006048 Ga0075363_100239336 Ga0075363_1002393362 163
160 3300006173 Ga0070716_100041784 Ga0070716_1000417842 163
161 3300006237 Ga0097621_101144745 Ga0097621_1011447452 163
162 3300006353 Ga0075370_10115939 Ga0075370_101159392 163
163 3300006358 Ga0068871_100395633 Ga0068871_1003956332 163
164 3300006844 Ga0075428_100099848 Ga0075428_1000998484 163
165 3300009147 Ga0114129_10037559 Ga0114129_100375592 163
166 3300009551 Ga0105238_10005435 Ga0105238_100054355 163
167 3300010159 Ga0099796_10112314 Ga0099796_101123141 163
168 3300010375 Ga0105239_10070661 Ga0105239_100706612 163
169 3300013296 Ga0157374_10383455 Ga0157374_103834552 163
170 3300013308 Ga0157375_10000200 Ga0157375_1000020034 163
171 3300014325 Ga0163163_10002086 Ga0163163_100020868 163
172 3300014969 Ga0157376_10184961 Ga0157376_101849613 163
173 3300017792 Ga0163161_11488118 Ga0163161_114881181 163
174 3300025929 Ga0207664_10458987 Ga0207664_104589872 163
175 3300025939 Ga0207665_10126455 Ga0207665_101264552 163
176 3300026095 Ga0207676_10034643 Ga0207676_100346431 163
177 3300031548 Ga0307408_100761448 Ga0307408_1007614482 163
178 3300037418 Ga0395900_0375477 Ga0395900_0375477_470_970 163
179 3300039437 Ga0436365_1563685 Ga0436365_1563685_45_545 163
180 3300044694 Ga0466963_0410490 Ga0466963_0410490_426_923 163
181 3300045051 Ga0451576_1132900 Ga0451576_1132900_85_582 163
182 3300046459 Ga0495629_0811849 Ga0495629_0811849_17_514 163
183 3300046472 Ga0495580_0312944 Ga0495580_0312944_295_792 163
184 3300046663 Ga0495635_0232646 Ga0495635_0232646_496_993 163
185 3300046683 Ga0495658_0204063 Ga0495658_0204063_319_816 163
186 3300046809 Ga0495600_0599381 Ga0495600_0599381_133_630 163
187 3300047315 Ga0495581_0459833 Ga0495581_0459833_197_694 163
188 3300047322 Ga0495680_0199303 Ga0495680_0199303_887_1384 163
189 3300048908 Ga0496105_0668066 Ga0496105_0668066_66_569 163
190 3300048927 Ga0496124_0027969 Ga0496124_0027969_701_1198 163
191 3300050491 nmdc:mga00v17_118500_c1 nmdc:mga00v17_118500_c1_172_669 163
192 3300050492 nmdc:mga0yw44_190530_c1 nmdc:mga0yw44_190530_c1_581_1078 163
193 3300050492 nmdc:mga0yw44_44789_c1 nmdc:mga0yw44_44789_c1_1180_1677 163
194 3300050496 nmdc:mga07m45_131502_c1 nmdc:mga07m45_131502_c1_208_705 163
195 3300050507 nmdc:mga05p37_80026_c1 nmdc:mga05p37_80026_c1_1931_2431 163
196 3300050508 nmdc:mga09592_265297_c1 nmdc:mga09592_265297_c1_959_1459 163
197 3300050509 nmdc:mga0qj67_23850_c1 nmdc:mga0qj67_23850_c1_377_877 163
198 3300059477 Ga0587084_011356 Ga0587084_011356_501_1001 163
199 3300059477 Ga0587084_018494 Ga0587084_018494_113_613 163
200 3300059478 Ga0587093_024915 Ga0587093_024915_138_638 163
201 3300059478 Ga0587093_037519 Ga0587093_037519_142_648 163
202 3300059490 Ga0587066_005566 Ga0587066_005566_99_599 163
203 3300059491 Ga0587070_020273 Ga0587070_020273_399_905 163
204 3300059491 Ga0587070_021292 Ga0587070_021292_297_797 163
205 3300059492 Ga0587073_0007805 Ga0587073_0007805_1029_1529 163
206 3300059493 Ga0587077_007018 Ga0587077_007018_1057_1563 163
207 3300059493 Ga0587077_036750 Ga0587077_036750_279_779 163
208 3300059504 Ga0587082_000786 Ga0587082_000786_1078_1584 163
209 3300059506 Ga0587085_003063 Ga0587085_003063_185_685 163
210 3300059506 Ga0587085_003313 Ga0587085_003313_182_682 163
211 3300059507 Ga0587086_011641 Ga0587086_011641_138_644 163
212 3300059511 Ga0587091_002911 Ga0587091_002911_239_745 163
213 3300059511 Ga0587091_094536 Ga0587091_094536_180_680 163
214 3300059513 Ga0587094_061122 Ga0587094_061122_36_542 163
215 3300059514 Ga0587095_016112 Ga0587095_016112_36_542 163
216 3300059605 Ga0587106_004889 Ga0587106_004889_75_581 163
217 3300059607 Ga0587125_001858 Ga0587125_001858_1020_1520 163
218 3300059623 Ga0587101_058728 Ga0587101_058728_141_641 163
219 3300059624 Ga0587109_116411 Ga0587109_116411_89_598 163
220 3300059627 Ga0587117_018165 Ga0587117_018165_142_642 163
221 3300059639 Ga0587062_053074 Ga0587062_053074_30_530 163
222 3300059640 Ga0587067_006117 Ga0587067_006117_1076_1582 163
223 3300059641 Ga0587068_057543 Ga0587068_057543_53_553 163
224 3300059642 Ga0587069_003833 Ga0587069_003833_1081_1581 163
225 3300059643 Ga0587072_092562 Ga0587072_092562_22_528 163
226 3300059644 Ga0587075_002413 Ga0587075_002413_802_1308 163
227 3300059645 Ga0587076_000503 Ga0587076_000503_1086_1592 163
228 3300059646 Ga0587078_001991 Ga0587078_001991_414_920 163
229 3300059647 Ga0587079_000900 Ga0587079_000900_1290_1796 163
230 3300059652 Ga0587107_023068 Ga0587107_023068_351_851 163
231 3300059653 Ga0587108_014919 Ga0587108_014919_15_515 163
232 3300059653 Ga0587108_015696 Ga0587108_015696_42_542 163
233 3300059654 Ga0587110_000546 Ga0587110_000546_154_660 163
234 3300059656 Ga0587116_05136 Ga0587116_05136_140_640 163
235 3300059658 Ga0587119_002503 Ga0587119_002503_76_576 163
236 3300060344 Ga0587071_037085 Ga0587071_037085_162_662 163
237 3300060344 Ga0587071_040810 Ga0587071_040810_360_866 163
238 3300060344 Ga0587071_086215 Ga0587071_086215_169_669 163
239 3300060346 Ga0587111_0001070 Ga0587111_0001070_1420_1926 163
240 3300060346 Ga0587111_0050892 Ga0587111_0050892_230_730 163
241 3300060346 Ga0587111_0095982 Ga0587111_0095982_59_568 163
242 3300060346 Ga0587111_0215060 Ga0587111_0215060_15_515 163
243 iso_pu_bacteria 2643221725 2644682437 163
244 iso_pu_bacteria 2802428842 2802651209 163
245 iso_pu_bacteria 2884960567 2884963311 163
246 iso_pu_bacteria 2977268062 2977272622 163
247 3300005353 Ga0070669_100160363 Ga0070669_1001603631 164
248 3300005471 Ga0070698_100387645 Ga0070698_1003876452 164
249 3300005518 Ga0070699_100833677 Ga0070699_1008336772 164
250 3300005546 Ga0070696_100617124 Ga0070696_1006171241 164
251 3300005546 Ga0070696_100710119 Ga0070696_1007101191 164
252 3300005549 Ga0070704_100461079 Ga0070704_1004610791 164
253 3300006178 Ga0075367_10230842 Ga0075367_102308421 164
254 3300021388 Ga0213875_10022046 Ga0213875_100220466 164
255 3300025923 Ga0207681_10148418 Ga0207681_101484182 164
256 3300036712 Ga0316584_0214290 Ga0316584_0214290_637_1137 164
257 3300037418 Ga0395900_0392390 Ga0395900_0392390_787_1287 164
258 3300037466 Ga0395898_0098884 Ga0395898_0098884_276_776 164
259 3300042435 Ga0439434_0184133 Ga0439434_0184133_93_593 164
260 3300059477 Ga0587084_003424 Ga0587084_003424_1058_1558 164
261 3300059478 Ga0587093_002065 Ga0587093_002065_226_726 164
262 3300059491 Ga0587070_003060 Ga0587070_003060_1286_1786 164
263 3300059492 Ga0587073_0141687 Ga0587073_0141687_64_564 164
264 3300059493 Ga0587077_005026 Ga0587077_005026_1057_1557 164
265 3300059504 Ga0587082_061891 Ga0587082_061891_25_525 164
266 3300059507 Ga0587086_002564 Ga0587086_002564_148_648 164
267 3300059510 Ga0587090_005350 Ga0587090_005350_1046_1546 164
268 3300059511 Ga0587091_005158 Ga0587091_005158_192_692 164
269 3300059512 Ga0587092_003474 Ga0587092_003474_1052_1552 164
270 3300059513 Ga0587094_003090 Ga0587094_003090_240_740 164
271 3300059514 Ga0587095_001178 Ga0587095_001178_843_1343 164
272 3300059605 Ga0587106_009245 Ga0587106_009245_119_619 164
273 3300059623 Ga0587101_029914 Ga0587101_029914_101_601 164
274 3300059624 Ga0587109_067349 Ga0587109_067349_240_740 164
275 3300059639 Ga0587062_001339 Ga0587062_001339_216_716 164
276 3300059642 Ga0587069_003044 Ga0587069_003044_1052_1552 164
277 3300059643 Ga0587072_009520 Ga0587072_009520_235_735 164
278 3300059645 Ga0587076_003537 Ga0587076_003537_85_585 164
279 3300059646 Ga0587078_022066 Ga0587078_022066_171_671 164
280 3300059647 Ga0587079_044049 Ga0587079_044049_176_676 164
281 3300059652 Ga0587107_047515 Ga0587107_047515_193_693 164
282 3300060344 Ga0587071_006117 Ga0587071_006117_227_727 164
283 3300060346 Ga0587111_0008251 Ga0587111_0008251_1058_1558 164
284 3300060346 Ga0587111_0168363 Ga0587111_0168363_60_560 164
285 3300013100 Ga0157373_10000035 Ga0157373_100000356 165
286 3300013104 Ga0157370_10001860 Ga0157370_1000186020 165
287 3300015261 Ga0182006_1000863 Ga0182006_10008636 165
288 3300035724 Ga0373933_0375266 Ga0373933_0375266_79_624 165
289 3300039450 Ga0436363_0311674 Ga0436363_0311674_996_1508 165
290 3300046460 Ga0495638_0016948 Ga0495638_0016948_3497_4003 165
291 3300046512 Ga0495610_0049442 Ga0495610_0049442_904_1449 165
292 3300046513 Ga0495616_0213130 Ga0495616_0213130_224_730 165
293 3300046520 Ga0495637_0005144 Ga0495637_0005144_417_962 165
294 3300046616 Ga0495668_0000034 Ga0495668_0000034_236131_236676 165
295 3300047472 Ga0495686_0465802 Ga0495686_0465802_38_583 165
296 3300049744 Ga0501083_0085717 Ga0501083_0085717_707_1243 165
297 3300053104 Ga0500556_0000479 Ga0500556_0000479_5502_6047 165
298 3300053116 Ga0500592_011413 Ga0500592_011413_838_1344 165
299 3300053730 Ga0500645_001260 Ga0500645_001260_7262_7807 165
300 3300059493 Ga0587077_154113 Ga0587077_154113_20_526 165
301 3300059507 Ga0587086_055594 Ga0587086_055594_54_560 165
302 3300035113 Ga0373936_0028327 Ga0373936_0028327_1285_1845 167
303 3300035116 Ga0373945_0043606 Ga0373945_0043606_794_1354 167
304 3300035118 Ga0373954_0001190 Ga0373954_0001190_4314_4874 167
305 3300035119 Ga0373956_0022673 Ga0373956_0022673_1031_1591 167
306 3300035170 Ga0373943_0160604 Ga0373943_0160604_276_836 167
307 3300035172 Ga0373955_0039934 Ga0373955_0039934_1253_1813 167
308 3300035410 Ga0373924_0092038 Ga0373924_0092038_601_1161 167
309 3300035692 Ga0373935_0000108 Ga0373935_0000108_31331_31891 167
310 3300035724 Ga0373933_0006176 Ga0373933_0006176_2126_2686 167
311 3300036401 Ga0373937_0000007 Ga0373937_0000007_11524_12084 167
312 3300037068 Ga0373925_0000011 Ga0373925_0000011_2775_3335 167
313 3300046454 Ga0495592_0000390 Ga0495592_0000390_15513_16073 167
314 3300046459 Ga0495629_0013611 Ga0495629_0013611_4177_4737 167
315 3300046462 Ga0495651_0002515 Ga0495651_0002515_1299_1859 167
316 3300046463 Ga0495653_0000249 Ga0495653_0000249_32771_33331 167
317 3300046476 Ga0495662_0024332 Ga0495662_0024332_1237_1797 167
318 3300046477 Ga0495664_0000024 Ga0495664_0000024_91795_92355 167
319 3300046511 Ga0495608_0000004 Ga0495608_0000004_50671_51231 167
320 3300046514 Ga0495618_0000036 Ga0495618_0000036_1481_2041 167
321 3300046516 Ga0495628_0000006 Ga0495628_0000006_99502_100062 167
322 3300046517 Ga0495630_0000601 Ga0495630_0000601_24578_25138 167
323 3300046529 Ga0495652_0000038 Ga0495652_0000038_94513_95073 167
324 3300046533 Ga0495640_0000013 Ga0495640_0000013_349_909 167
325 3300046536 Ga0495587_0000004 Ga0495587_0000004_54136_54696 167
326 3300046543 Ga0495645_0000001 Ga0495645_0000001_303885_304445 167
327 3300046559 Ga0495667_0000084 Ga0495667_0000084_20547_21107 167
328 3300046642 Ga0495634_0051265 Ga0495634_0051265_614_1174 167
329 3300046663 Ga0495635_0000003 Ga0495635_0000003_303516_304076 167
330 3300046675 Ga0495657_0000248 Ga0495657_0000248_46160_46720 167
331 3300046678 Ga0495599_0000014 Ga0495599_0000014_171573_172133 167
332 3300046679 Ga0495623_0000015 Ga0495623_0000015_31213_31773 167
333 3300046680 Ga0495646_0000005 Ga0495646_0000005_216056_216616 167
334 3300046689 Ga0495613_0047066 Ga0495613_0047066_2127_2687 167
335 3300047317 Ga0495604_0000002 Ga0495604_0000002_226573_227133 167
336 3300047319 Ga0495674_0000004 Ga0495674_0000004_226122_226682 167
337 3300047322 Ga0495680_0000142 Ga0495680_0000142_14573_15133 167
338 3300047444 Ga0495675_0000053 Ga0495675_0000053_31948_32508 167
339 3300047471 Ga0495684_0000004 Ga0495684_0000004_206998_207558 167
340 3300047673 Ga0495593_0002002 Ga0495593_0002002_5664_6224 167
341 3300048088 Ga0495602_0000001 Ga0495602_0000001_303558_304118 167
342 3300053077 Ga0495601_0000026 Ga0495601_0000026_91587_92147 167
343 3300053078 Ga0495612_0000005 Ga0495612_0000005_79839_80399 167
344 3300053084 Ga0495595_0000065 Ga0495595_0000065_46245_46805 167
345 3300053085 Ga0495619_0000003 Ga0495619_0000003_308680_309240 167
346 3300044842 Ga0466957_0651833 Ga0466957_0651833_56_607 168
347 3300044658 Ga0466972_0044171 Ga0466972_0044171_1461_1994 169
348 3300044672 Ga0466982_0000006 Ga0466982_0000006_66199_66732 169
349 3300044684 Ga0466966_0001515 Ga0466966_0001515_5410_5943 169
350 3300044694 Ga0466963_0301551 Ga0466963_0301551_187_720 169
351 3300044706 Ga0466964_0006076 Ga0466964_0006076_3130_3663 169
352 3300044719 Ga0466971_0017295 Ga0466971_0017295_1939_2472 169
353 3300044735 Ga0466968_0044840 Ga0466968_0044840_673_1206 169
354 3300044765 Ga0466970_0139946 Ga0466970_0139946_101_634 169
355 3300044901 Ga0466960_0073110 Ga0466960_0073110_460_993 169
356 3300045049 Ga0466959_0321277 Ga0466959_0321277_482_1036 169
357 3300045049 Ga0466959_0324212 Ga0466959_0324212_288_821 169
358 3300061719 Ga0466962_0001003 Ga0466962_0001003_6696_7229 169
359 3300002773 JGI25152J39213_1014280 JGI25152J39213_10142803 171
360 3300002774 JGI25150J39212_1000131 JGI25150J39212_100013124 171
361 3300003187 JGI25151J46595_10042062 JGI25151J46595_100420622 171
362 3300003215 JGI25153J46596_10000036 JGI25153J46596_10000036130 171
363 3300003320 rootH2_10100040 rootH2_101000402 171
364 3300003781 Ga0055536_1020423 Ga0055536_10204233 171
365 3300003791 Ga0055530_10017057 Ga0055530_100170572 171
366 3300003792 Ga0055540_1004778 Ga0055540_10047784 171
367 3300003794 Ga0055531_10085024 Ga0055531_100850242 171
368 3300003794 Ga0055531_10085877 Ga0055531_100858772 171
369 3300025245 Ga0207425_1000037 Ga0207425_100003724 171
370 3300025258 Ga0209129_1000520 Ga0209129_10005208 171
371 3300025273 Ga0209673_1059689 Ga0209673_10596892 171
372 3300025292 Ga0209676_1009744 Ga0209676_10097447 171
373 3300025294 Ga0209025_1000117 Ga0209025_1000117148 171
374 3300025297 Ga0209758_1000103 Ga0209758_100010324 171
375 3300025298 Ga0209050_1000001 Ga0209050_10000013424 171
376 3300025303 Ga0209051_1001284 Ga0209051_100128427 171
377 3300025303 Ga0209051_1059316 Ga0209051_10593162 171
378 3300025304 Ga0209257_1000949 Ga0209257_10009496 171
379 3300025304 Ga0209257_1001068 Ga0209257_10010686 171
380 3300048920 Ga0496117_0149286 Ga0496117_0149286_344_862 171
381 3300048921 Ga0496118_0127371 Ga0496118_0127371_1098_1616 171

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07484

Collar

Phage Tail Collar Domain

7

63

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
5lye-assembly1.cif.gz_A-3 re-refined structure of the bacteriophage t4 short tail fibre pdb entry 1h6w containing 71 additionally identified residues 0.8508 4 57
5iv5-assembly1.cif.gz_O cryo-electron microscopy structure of the hexagonal pre-attachment t4 baseplate-tail tube complex 0.3931 4 163
1pdi-assembly1.cif.gz_A fitting of the c-terminal part of the short tail fibers into the cryo-em reconstruction of t4 baseplate 0.38 4 164
5iv5-assembly1.cif.gz_O cryo-electron microscopy structure of the hexagonal pre-attachment t4 baseplate-tail tube complex 0.3729 4 163
1ocy-assembly1.cif.gz_A structure of the receptor-binding domain of the bacteriophage t4 short tail fibre 0.3666 4 163
ID Description Score Start End Superfamily
1h6wA03 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.8775 8 57 3.90.1340.10
1ocyA01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.8165 4 57 3.90.1340.10
2xgfC01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.7216 1 56 3.90.1340.10
1h6wA03 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.6634 8 57 3.90.1340.10
2xgfC01 Alpha Beta;Alpha-Beta Complex;heat- and protease-stable fragment of the bacteriophage t4 short fibre, domain 3;Phage tail collar domain 0.6053 1 56 3.90.1340.10
ID Description Score Start End GO Terms
AF-A0A1T5BT98-F1-model_v4 Phage Tail Collar Domain 0.7195 2 171
AF-A0A7Y2FQZ0-F1-model_v4 Phage tail protein 0.7056 2 171
AF-A0A2M7WPM6-F1-model_v4 Phage tail protein 0.6955 2 171
AF-A0A1T5BT98-F1-model_v4 Phage Tail Collar Domain 0.6932 2 171
AF-A4U469-F1-model_v4 Microcystin dependent protein 0.6708 3 171

Feature Viewer

pLDDT pTM Quality
66.95 0.51 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map