F429027

General Info

Members Datasets Scaffolds Average Seq Length
381 229 357 499

Family's Representative Sequence

Representative Sequence 3300044683|Ga0466965_0004842|Ga0466965_0004842_4088_5605
Length 493
Sequence MALGRAFSVAIRGVEGVIVEIEADIASGLPGVHLVGLGDAALQESRDRVRAAITNCGNEWPMSRLTLALSPATLPKNGSAYDLALAAAVLSAHGKKEWPRLEKTLLLGELALDGRVRPVTGILPAVRAGKQEGWPVAVVPEENLPEASLVDGIEVWGVRTLGQLQAWLAGKGALAGRVDTVAPAPRPTVDLADVVGQTQARYAVEVAAAGAHHLFLSGPPGIGKTMLAQRLPGLLPPLSEEEALEVTAIHSVAGLLTGATPLITEPPFIAPHSGMARPGAVSRAHRGVLFLDECAEIGTSVLEAMRTPLEDGEIRLARRDGVARYPARFQLILAANECPCAPANPRDCVCPAAVKRRYLGKLSGPLMDRVDLRVQMHQVRAGAFADQVPEPTAVVRERVANARAAAAHRWQPVGVRTNAEVPGPVLRRAFRLSRTAMEPLRTALDRGTLSIRGVDRTLRVAWSIADLAGKQCPTVEDVWTALSFRDVVVHDGR

Samples

Sample ID Description Type Environment
1 2547132424 Nocardia nova SH22a Isolate Unclassified
2 2551306166 Nocardia tenerifensis NBRC 101015 Isolate Rhizosphere
3 2558860112 Pseudonocardia acaciae DSM 45401 Isolate Unclassified
4 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
5 2643221687 Mycobacterium sp. Root135 Isolate Unclassified
6 2643221692 Nocardia sp. Root136 Isolate Unclassified
7 2738541264 Mycobacterium sp. OK889 Isolate Unclassified
8 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
9 2738541356 Mycobacterium sp. OK887 Isolate Unclassified
10 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
11 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
12 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
13 2738543034 Rhodococcus sp. OK269 Isolate Unclassified
14 2744054611 Aldersonia kunmingensis DSM 45001 Isolate Rhizosphere
15 2842134933 Mycolicibacterium obuense SEMIA 442 Isolate Nodule
16 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
17 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified
18 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified
19 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
20 2919713450 Nocardia kruczakiae 4272 Isolate Rhizosphere
21 2922554459 Rhodococcus sp. 66b Isolate Unclassified
22 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
23 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
24 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
25 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
26 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
27 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
31 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
35 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
36 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
50 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
51 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
57 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
58 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
59 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
60 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
61 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
62 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
63 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
64 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
65 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
66 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
67 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
68 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
69 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
70 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
71 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
72 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
73 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
74 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
78 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
79 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
80 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
81 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
84 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
96 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
97 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
98 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
134 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
135 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
136 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
137 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
138 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
139 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
140 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
141 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
142 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
143 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
144 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
145 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
146 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
147 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
148 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
149 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
150 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
151 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
152 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
153 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
154 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
158 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
159 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
160 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
161 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
162 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
163 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
164 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
165 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
166 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
170 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
171 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
180 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
181 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
182 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
183 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
184 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
187 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
188 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
189 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
190 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
191 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
192 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
193 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
194 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
195 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
196 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
197 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
198 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
199 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
201 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
204 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
205 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
206 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
207 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
210 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
211 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
212 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
213 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
214 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
215 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
216 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
218 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
222 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
223 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
224 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
225 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
226 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
227 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
228 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.7
Metatranscriptomes 0
Isolates 6.3

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.55
Nodule 0.26
Rhizoplane 12.34
Rhizosphere 64.3
Stem 0
Stem Tuber 0
Unclassified 11.55

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10000247 3300002077 Bacteria 8745
2 JGI24744J21845_10012747 3300002077 Bacteria 1700
3 JGI24742J22300_10003964 3300002244 Bacteria 2415
4 Ga0055540_1000057 3300003792 Bacteria 136356
5 Ga0055540_1007656 3300003792 Bacteria 4028
6 Ga0055540_1012070 3300003792 Bacteria 2738
7 Ga0070683_100153651 3300005329 Bacteria 2182
8 Ga0070690_100001876 3300005330 Bacteria 11149
9 Ga0070670_100029017 3300005331 Bacteria 4762
10 Ga0070666_10015522 3300005335 Bacteria 4860
11 Ga0070682_100012745 3300005337 Bacteria 4825
12 Ga0068868_100012095 3300005338 Bacteria 6303
13 Ga0070668_100012233 3300005347 Bacteria 6394
14 Ga0070668_100025907 3300005347 Bacteria 4447
15 Ga0070671_100006018 3300005355 Bacteria 9669
16 Ga0070674_100006799 3300005356 Bacteria 6701
17 Ga0070688_100088807 3300005365 Bacteria 2016
18 Ga0070667_100003100 3300005367 Bacteria 14303
19 Ga0070667_100015262 3300005367 Bacteria 6348
20 Ga0070709_10006943 3300005434 Bacteria 6182
21 Ga0070713_100018707 3300005436 Bacteria 5268
22 Ga0070710_10002268 3300005437 Bacteria 9095
23 Ga0070701_10007431 3300005438 Bacteria 4682
24 Ga0070701_10008490 3300005438 Bacteria 4445
25 Ga0070711_100000375 3300005439 Bacteria 23132
26 Ga0070663_100013413 3300005455 Bacteria 5225
27 Ga0070663_100083960 3300005455 Bacteria 2346
28 Ga0070663_100143650 3300005455 Bacteria 1824
29 Ga0070678_100001259 3300005456 Bacteria 13431
30 Ga0070662_100015363 3300005457 Bacteria 5126
31 Ga0068867_100058540 3300005459 Bacteria 2855
32 Ga0070685_10050904 3300005466 Bacteria 2394
33 Ga0070672_100097612 3300005543 Bacteria 2379
34 Ga0070686_100005397 3300005544 Bacteria 7076
35 Ga0070696_100001702 3300005546 Bacteria 14418
36 Ga0070665_100030932 3300005548 Bacteria 5388
37 Ga0070665_100047606 3300005548 Bacteria 4303
38 Ga0070665_100050045 3300005548 Bacteria 4193
39 Ga0070704_100001435 3300005549 Bacteria 12737
40 Ga0070704_100013616 3300005549 Bacteria 5055
41 Ga0068855_100290747 3300005563 Bacteria 1811
42 Ga0068854_100003064 3300005578 Bacteria 10404
43 Ga0070702_100000895 3300005615 Bacteria 11606
44 Ga0068859_100008118 3300005617 Bacteria 10645
45 Ga0068859_100127548 3300005617 Bacteria 2614
46 Ga0068866_10000812 3300005718 Bacteria 13959
47 Ga0068861_100009768 3300005719 Bacteria 6635
48 Ga0068863_100070438 3300005841 Bacteria 3307
49 Ga0068858_100001306 3300005842 Bacteria 25730
50 Ga0068858_100106362 3300005842 Bacteria 2619
51 Ga0068860_100005764 3300005843 Bacteria 12488
52 Ga0068862_100030890 3300005844 Bacteria 4516
53 Ga0075365_10042179 3300006038 Bacteria 2982
54 Ga0075365_10110795 3300006038 Bacteria 1886
55 Ga0075363_100003126 3300006048 Bacteria 6954
56 Ga0075363_100004513 3300006048 Bacteria 6101
57 Ga0075363_100016657 3300006048 Bacteria 3634
58 Ga0075363_100024170 3300006048 Bacteria 3086
59 Ga0075363_100031242 3300006048 Bacteria 2760
60 Ga0075364_10001383 3300006051 Bacteria 13095
61 Ga0075364_10002224 3300006051 Bacteria 10884
62 Ga0075364_10006919 3300006051 Bacteria 6696
63 Ga0075364_10011580 3300006051 Bacteria 5360
64 Ga0070715_10001286 3300006163 Bacteria 7188
65 Ga0070715_10003091 3300006163 Bacteria 5220
66 Ga0070716_100003259 3300006173 Bacteria 7626
67 Ga0070716_100007270 3300006173 Bacteria 5446
68 Ga0070712_100008493 3300006175 Bacteria 6463
69 Ga0075367_10013035 3300006178 Bacteria 4455
70 Ga0075367_10057406 3300006178 Bacteria 2314
71 Ga0075369_10002341 3300006186 Bacteria 6748
72 Ga0075369_10006099 3300006186 Bacteria 4545
73 Ga0075369_10021119 3300006186 Bacteria 2672
74 Ga0068871_100022287 3300006358 Bacteria 4883
75 Ga0068871_100065894 3300006358 Bacteria 2968
76 Ga0075428_100004253 3300006844 Bacteria 15752
77 Ga0075430_100027589 3300006846 Bacteria 4824
78 Ga0068865_100003677 3300006881 Bacteria 9215
79 Ga0097620_100008118 3300006931 Bacteria 10645
80 Ga0097620_100127545 3300006931 Bacteria 2614
81 Ga0105245_10001029 3300009098 Bacteria 25345
82 Ga0105247_10009458 3300009101 Bacteria 5914
83 Ga0105247_10120426 3300009101 Bacteria 1700
84 Ga0114129_10002350 3300009147 Bacteria 26252
85 Ga0105243_10000749 3300009148 Bacteria 31120
86 Ga0105243_10001000 3300009148 Bacteria 26146
87 Ga0105242_10000759 3300009176 Bacteria 25113
88 Ga0105248_10003071 3300009177 Bacteria 18513
89 Ga0105248_10044124 3300009177 Bacteria 5000
90 Ga0105237_10010195 3300009545 Bacteria 10012
91 Ga0105237_10024406 3300009545 Bacteria 6186
92 Ga0105237_10257418 3300009545 Bacteria 1747
93 Ga0105249_10005589 3300009553 Bacteria 10869
94 Ga0105249_10015924 3300009553 Bacteria 6664
95 Ga0105239_10016836 3300010375 Bacteria 8080
96 Ga0105239_10024892 3300010375 Bacteria 6592
97 Ga0105239_10158396 3300010375 Bacteria 2529
98 Ga0105246_10098421 3300011119 Bacteria 2125
99 Ga0157374_10034328 3300013296 Bacteria 4632
100 Ga0157378_10001038 3300013297 Bacteria 25353
101 Ga0163162_10018684 3300013306 Bacteria 6791
102 Ga0157372_10011618 3300013307 Bacteria 9375
103 Ga0157375_10000838 3300013308 Bacteria 26885
104 Ga0163163_10008789 3300014325 Bacteria 8989
105 Ga0157380_10001428 3300014326 Bacteria 15636
106 Ga0157379_10016789 3300014968 Bacteria 6442
107 Ga0163161_10003257 3300017792 Bacteria 11411
108 Ga0213876_10030618 3300021384 Bacteria 2839
109 Ga0213875_10003146 3300021388 Bacteria 9492
110 Ga0209051_1000075 3300025303 Bacteria 205011
111 Ga0209051_1004157 3300025303 Bacteria 9049
112 Ga0209051_1005472 3300025303 Bacteria 7411
113 Ga0207692_10003952 3300025898 Bacteria 5820
114 Ga0207642_10000117 3300025899 Bacteria 21526
115 Ga0207688_10005173 3300025901 Bacteria 7091
116 Ga0207688_10007002 3300025901 Bacteria 6133
117 Ga0207680_10084053 3300025903 Bacteria 2007
118 Ga0207645_10106530 3300025907 Bacteria 1812
119 Ga0207671_10021892 3300025914 Bacteria 4842
120 Ga0207693_10000930 3300025915 Bacteria 26312
121 Ga0207693_10001479 3300025915 Bacteria 20767
122 Ga0207663_10002583 3300025916 Bacteria 8711
123 Ga0207663_10034294 3300025916 Bacteria 3033
124 Ga0207657_10255180 3300025919 Bacteria 1397
125 Ga0207687_10001341 3300025927 Bacteria 16838
126 Ga0207644_10021360 3300025931 Bacteria 4408
127 Ga0207690_10018077 3300025932 Bacteria 4318
128 Ga0207706_10010030 3300025933 Bacteria 8679
129 Ga0207686_10002045 3300025934 Bacteria 11121
130 Ga0207709_10004572 3300025935 Bacteria 7967
131 Ga0207709_10033343 3300025935 Bacteria 3023
132 Ga0207669_10000297 3300025937 Bacteria 22865
133 Ga0207665_10008653 3300025939 Bacteria 6699
134 Ga0207665_10027374 3300025939 Bacteria 3767
135 Ga0207691_10197079 3300025940 Bacteria 1754
136 Ga0207711_10014691 3300025941 Bacteria 6506
137 Ga0207667_10051635 3300025949 Bacteria 4333
138 Ga0207712_10008422 3300025961 Bacteria 6516
139 Ga0207712_10011195 3300025961 Bacteria 5711
140 Ga0207668_10007672 3300025972 Bacteria 6420
141 Ga0207658_10004009 3300025986 Bacteria 10307
142 Ga0207658_10015254 3300025986 Bacteria 5271
143 Ga0207658_10059413 3300025986 Bacteria 2849
144 Ga0207658_10145445 3300025986 Bacteria 1924
145 Ga0207703_10001189 3300026035 Bacteria 24483
146 Ga0207703_10086661 3300026035 Bacteria 2624
147 Ga0207703_10099219 3300026035 Bacteria 2465
148 Ga0207639_10003053 3300026041 Bacteria 11278
149 Ga0207678_10013971 3300026067 Bacteria 7057
150 Ga0207678_10024388 3300026067 Bacteria 5281
151 Ga0207678_10111180 3300026067 Bacteria 2337
152 Ga0207708_10004036 3300026075 Bacteria 10792
153 Ga0207708_10135300 3300026075 Bacteria 1930
154 Ga0207641_10034263 3300026088 Bacteria 4223
155 Ga0207641_10067601 3300026088 Bacteria 3062
156 Ga0207648_10001361 3300026089 Bacteria 27023
157 Ga0207675_100003845 3300026118 Bacteria 14607
158 Ga0207675_100018540 3300026118 Bacteria 6492
159 Ga0207683_10002759 3300026121 Bacteria 15343
160 Ga0207683_10005268 3300026121 Bacteria 11099
161 Ga0268266_10004748 3300028379 Bacteria 12923
162 Ga0268266_10111901 3300028379 Bacteria 2420
163 Ga0268264_10005225 3300028381 Bacteria 10994
164 Ga0265327_10001656 3300031251 Bacteria 26814
165 Ga0265327_10013030 3300031251 Bacteria 5555
166 Ga0307410_10010859 3300031852 Bacteria 5184
167 Ga0316582_0066994 3300036647 Bacteria 2316
168 Ga0316584_0012973 3300036712 Bacteria 5887
169 Ga0436364_1058231 3300037853 Bacteria 9767
170 Ga0436365_0865525 3300039437 Bacteria 17320
171 Ga0436365_0997910 3300039437 Bacteria 8476
172 Ga0436365_1063989 3300039437 Bacteria 3232
173 Ga0436365_1378611 3300039437 Bacteria 178407
174 Ga0436363_1000063 3300039450 Bacteria 2011
175 Ga0439465_0003815 3300041413 Bacteria 4915
176 Ga0439465_0010055 3300041413 Bacteria 2976
177 Ga0451793_1402306 3300041452 Bacteria 2517
178 Ga0466969_0014653 3300044656 Bacteria 4122
179 Ga0466972_0007204 3300044658 Bacteria 5585
180 Ga0466972_0059376 3300044658 Bacteria 1836
181 Ga0466965_0004842 3300044683 Bacteria 6004
182 Ga0466965_0029742 3300044683 Bacteria 2659
183 Ga0466965_0050789 3300044683 Bacteria 2056
184 Ga0466965_0056937 3300044683 Bacteria 1947
185 Ga0466965_0078145 3300044683 Bacteria 1671
186 Ga0466966_0004656 3300044684 Bacteria 9034
187 Ga0466966_0005734 3300044684 Bacteria 8171
188 Ga0466966_0079661 3300044684 Bacteria 2041
189 Ga0466961_0008972 3300044693 Bacteria 6381
190 Ga0466961_0009580 3300044693 Bacteria 6167
191 Ga0466963_0005518 3300044694 Bacteria 7404
192 Ga0466964_0051746 3300044706 Bacteria 1687
193 Ga0466971_0001079 3300044719 Bacteria 11324
194 Ga0466968_0002156 3300044735 Bacteria 7180
195 Ga0466968_0007107 3300044735 Bacteria 4247
196 Ga0466970_0046034 3300044765 Bacteria 2323
197 Ga0466970_0054231 3300044765 Bacteria 2141
198 Ga0466970_0058182 3300044765 Bacteria 2068
199 Ga0466957_0006464 3300044842 Bacteria 6617
200 Ga0466957_0012567 3300044842 Bacteria 4901
201 Ga0466957_0047121 3300044842 Bacteria 2618
202 Ga0466957_0083639 3300044842 Bacteria 1991
203 Ga0466960_0000117 3300044901 Bacteria 26501
204 Ga0466960_0001036 3300044901 Bacteria 9953
205 Ga0466960_0003419 3300044901 Bacteria 6102
206 Ga0466960_0005381 3300044901 Bacteria 5070
207 Ga0466960_0008474 3300044901 Bacteria 4212
208 Ga0466959_0024162 3300045049 Bacteria 4500
209 Ga0466959_0034308 3300045049 Bacteria 3752
210 Ga0466959_0143849 3300045049 Bacteria 1683
211 Ga0466958_0001238 3300045836 Bacteria 11971
212 Ga0466958_0013126 3300045836 Bacteria 4710
213 Ga0466958_0083612 3300045836 Bacteria 1967
214 Ga0466967_0002017 3300045976 Bacteria 12376
215 Ga0466967_0019926 3300045976 Bacteria 5408
216 Ga0466967_0020211 3300045976 Bacteria 5375
217 Ga0466967_0045215 3300045976 Bacteria 3825
218 Ga0466967_0088485 3300045976 Bacteria 2810
219 Ga0495629_0009084 3300046459 Bacteria 7281
220 Ga0495638_0000404 3300046460 Bacteria 52857
221 Ga0495582_0011430 3300046473 Bacteria 4891
222 Ga0495607_0029650 3300046501 Bacteria 3366
223 Ga0495583_0029257 3300046506 Bacteria 2698
224 Ga0495606_0025815 3300046507 Bacteria 4198
225 Ga0495648_0004183 3300046524 Bacteria 12400
226 Ga0495640_0037562 3300046533 Bacteria 3416
227 Ga0495668_0006065 3300046616 Bacteria 8005
228 Ga0495611_0018288 3300046648 Bacteria 3005
229 Ga0495588_0010065 3300046674 Bacteria 4385
230 Ga0495581_0049740 3300047315 Bacteria 2421
231 Ga0495674_0064252 3300047319 Bacteria 3191
232 Ga0495672_0003432 3300047320 Bacteria 13573
233 Ga0495672_0093169 3300047320 Bacteria 1650
234 Ga0495683_0001077 3300047323 Bacteria 18893
235 Ga0495673_0002291 3300047469 Bacteria 13712
236 Ga0495686_0002735 3300047472 Bacteria 16115
237 Ga0495593_0010681 3300047673 Bacteria 5294
238 Ga0496100_0000009 3300048903 Bacteria 225785
239 Ga0496100_0000857 3300048903 Bacteria 14548
240 Ga0496100_0004952 3300048903 Bacteria 7120
241 Ga0496101_0000018 3300048904 Bacteria 236102
242 Ga0496101_0000102 3300048904 Bacteria 88779
243 Ga0496101_0000931 3300048904 Bacteria 17274
244 Ga0496101_0003929 3300048904 Bacteria 9287
245 Ga0496102_0000037 3300048905 Bacteria 199368
246 Ga0496102_0001982 3300048905 Bacteria 17690
247 Ga0496102_0007513 3300048905 Bacteria 9320
248 Ga0496102_0111822 3300048905 Bacteria 2547
249 Ga0496103_0000004 3300048906 Bacteria 510080
250 Ga0496103_0000538 3300048906 Bacteria 30478
251 Ga0496103_0000666 3300048906 Bacteria 25814
252 Ga0496104_0002403 3300048907 Bacteria 16120
253 Ga0496104_0014311 3300048907 Bacteria 7164
254 Ga0496104_0039506 3300048907 Bacteria 4418
255 Ga0496104_0152696 3300048907 Bacteria 2216
256 Ga0496106_0001031 3300048909 Bacteria 20511
257 Ga0496106_0001747 3300048909 Bacteria 16235
258 Ga0496106_0003068 3300048909 Bacteria 12455
259 Ga0496106_0022980 3300048909 Bacteria 4631
260 Ga0496107_0000812 3300048910 Bacteria 18155
261 Ga0496107_0001670 3300048910 Bacteria 13874
262 Ga0496107_0012063 3300048910 Bacteria 6026
263 Ga0496108_0003170 3300048911 Bacteria 13234
264 Ga0496108_0033508 3300048911 Bacteria 4267
265 Ga0496108_0118779 3300048911 Bacteria 2267
266 Ga0496108_0259595 3300048911 Bacteria 1512
267 Ga0496109_0000434 3300048912 Bacteria 36428
268 Ga0496109_0001781 3300048912 Bacteria 17907
269 Ga0496109_0016900 3300048912 Bacteria 6385
270 Ga0496109_0046174 3300048912 Bacteria 3956
271 Ga0496110_0000204 3300048913 Bacteria 37863
272 Ga0496110_0005194 3300048913 Bacteria 10189
273 Ga0496110_0114199 3300048913 Bacteria 2430
274 Ga0496111_0004697 3300048914 Bacteria 8660
275 Ga0496111_0029454 3300048914 Bacteria 3900
276 Ga0496112_0009281 3300048915 Bacteria 8845
277 Ga0496112_0013491 3300048915 Bacteria 7546
278 Ga0496113_0029650 3300048916 Bacteria 3955
279 Ga0496114_0000183 3300048917 Bacteria 44987
280 Ga0496114_0008349 3300048917 Bacteria 8205
281 Ga0496115_0002353 3300048918 Bacteria 13559
282 Ga0496115_0008628 3300048918 Bacteria 7548
283 Ga0496115_0012439 3300048918 Bacteria 6406
284 Ga0496116_0000276 3300048919 Bacteria 89506
285 Ga0496116_0000720 3300048919 Bacteria 42406
286 Ga0496117_0000003 3300048920 Bacteria 1881097
287 Ga0496117_0065452 3300048920 Bacteria 2471
288 Ga0496118_0000001 3300048921 Bacteria 1881100
289 Ga0496118_0000341 3300048921 Bacteria 79469
290 Ga0496118_0004777 3300048921 Bacteria 15830
291 Ga0496119_0005210 3300048922 Bacteria 12553
292 Ga0496119_0014264 3300048922 Bacteria 6238
293 Ga0496121_0000023 3300048924 Bacteria 463448
294 Ga0496121_0000338 3300048924 Bacteria 97703
295 Ga0496122_0000038 3300048925 Bacteria 295624
296 Ga0496123_0002987 3300048926 Bacteria 19631
297 Ga0496124_0000014 3300048927 Bacteria 463448
298 Ga0496125_0000020 3300048928 Bacteria 463448
299 Ga0496125_0062750 3300048928 Bacteria 2968
300 Ga0496126_0000023 3300048929 Bacteria 463448
301 Ga0496126_0000551 3300048929 Bacteria 72093
302 Ga0496126_0006107 3300048929 Bacteria 13507
303 Ga0496126_0024621 3300048929 Bacteria 5808
304 Ga0501032_0006716 3300049569 Bacteria 8448
305 Ga0501032_0009164 3300049569 Bacteria 7180
306 Ga0501033_0009441 3300049570 Bacteria 7511
307 Ga0501033_0066807 3300049570 Bacteria 2644
308 Ga0501036_0023259 3300049572 Bacteria 5218
309 Ga0501037_0000663 3300049573 Bacteria 26405
310 Ga0501037_0007033 3300049573 Bacteria 8218
311 Ga0501038_0004859 3300049574 Bacteria 12487
312 Ga0501039_0007737 3300049575 Bacteria 8200
313 Ga0501043_0023280 3300049579 Bacteria 4857
314 Ga0501046_0002698 3300049580 Bacteria 16521
315 Ga0501047_0005652 3300049581 Bacteria 11774
316 Ga0501047_0010238 3300049581 Bacteria 8870
317 Ga0501048_0029617 3300049582 Bacteria 3968
318 Ga0501068_0028500 3300049584 Bacteria 3303
319 Ga0501069_0014361 3300049585 Bacteria 4233
320 Ga0501070_0002391 3300049586 Bacteria 16459
321 Ga0501070_0059414 3300049586 Bacteria 3169
322 Ga0501070_0129501 3300049586 Bacteria 2085
323 Ga0501073_0025482 3300049589 Bacteria 4241
324 Ga0501077_0086665 3300049593 Bacteria 1985
325 Ga0501080_0025955 3300049742 Bacteria 5443
326 Ga0501080_0070297 3300049742 Bacteria 3255
327 Ga0501083_0105566 3300049744 Bacteria 1855
328 Ga0501035_0007347 3300049822 Bacteria 10297
329 Ga0501035_0014536 3300049822 Bacteria 7267
330 Ga0501044_0002147 3300049823 Bacteria 22617
331 Ga0501044_0002237 3300049823 Bacteria 22151
332 Ga0501044_0004046 3300049823 Bacteria 16449
333 Ga0501044_0030431 3300049823 Bacteria 5690
334 nmdc:mga03n38_11266_c1 3300050490 Bacteria 3324
335 nmdc:mga03n38_12226_c1 3300050490 Bacteria 3223
336 nmdc:mga03n38_12828_c1 3300050490 Bacteria 3166
337 nmdc:mga03n38_1904_c1 3300050490 Bacteria 5060
338 nmdc:mga03n38_32215_c1 3300050490 Bacteria 2219
339 nmdc:mga03n38_54153_c1 3300050490 Bacteria 1802
340 nmdc:mga00v17_1631_c1 3300050491 Bacteria 11734
341 nmdc:mga00v17_24717_c1 3300050491 Bacteria 3487
342 nmdc:mga00v17_6388_c1 3300050491 Bacteria 6252
343 nmdc:mga00v17_7327_c1 3300050491 Bacteria 5880
344 nmdc:mga0yw44_126278_c1 3300050492 Bacteria 1652
345 nmdc:mga0yw44_59620_c1 3300050492 Bacteria 2335
346 nmdc:mga07m45_74272_c1 3300050496 Bacteria 1937
347 nmdc:mga0sz30_19051_c1 3300050516 Bacteria 2752
348 nmdc:mga0sz30_4872_c1 3300050516 Bacteria 4888
349 nmdc:mga0sz30_5392_c1 3300050516 Bacteria 4689
350 nmdc:mga0sz30_71854_c1 3300050516 Bacteria 1490
351 Ga0500635_0002094 3300053080 Bacteria 4891
352 Ga0495655_0001252 3300053083 Bacteria 3923
353 Ga0500643_010351 3300053087 Bacteria 3477
354 Ga0500562_003304 3300053108 Bacteria 4031
355 Ga0500652_000574 3300053131 Bacteria 12816
356 Ga0500645_015161 3300053730 Bacteria 2446
357 Ga0466962_0002774 3300061719 Bacteria 8321

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025919 Ga0207657_10255180 Ga0207657_102551801 412
2 3300025939 Ga0207665_10027374 Ga0207665_100273741 414
3 3300025949 Ga0207667_10051635 Ga0207667_100516351 415
4 3300050516 nmdc:mga0sz30_71854_c1 nmdc:mga0sz30_71854_c1_186_1469 415
5 3300048911 Ga0496108_0259595 Ga0496108_0259595_37_1362 441
6 3300048913 Ga0496110_0114199 Ga0496110_0114199_1029_2357 442
7 3300006163 Ga0070715_10003091 Ga0070715_100030911 473
8 3300009545 Ga0105237_10257418 Ga0105237_102574182 473
9 3300010375 Ga0105239_10158396 Ga0105239_101583961 477
10 3300025940 Ga0207691_10197079 Ga0207691_101970792 477
11 3300045976 Ga0466967_0088485 Ga0466967_0088485_1316_2788 478
12 3300044683 Ga0466965_0029742 Ga0466965_0029742_855_2360 479
13 3300044765 Ga0466970_0046034 Ga0466970_0046034_312_1817 479
14 3300044901 Ga0466960_0005381 Ga0466960_0005381_1601_3106 479
15 3300044683 Ga0466965_0056937 Ga0466965_0056937_408_1919 484
16 3300044901 Ga0466960_0000117 Ga0466960_0000117_8847_10358 484
17 3300050490 nmdc:mga03n38_11266_c1 nmdc:mga03n38_11266_c1_1821_3293 490
18 3300005436 Ga0070713_100018707 Ga0070713_1000187073 491
19 3300006038 Ga0075365_10110795 Ga0075365_101107952 491
20 3300006051 Ga0075364_10002224 Ga0075364_1000222411 491
21 3300006178 Ga0075367_10057406 Ga0075367_100574062 491
22 3300036647 Ga0316582_0066994 Ga0316582_0066994_25_1536 491
23 3300036712 Ga0316584_0012973 Ga0316584_0012973_4201_5712 491
24 3300039437 Ga0436365_0865525 Ga0436365_0865525_6511_8025 491
25 3300039437 Ga0436365_1378611 Ga0436365_1378611_32226_33737 491
26 3300044656 Ga0466969_0014653 Ga0466969_0014653_1000_2511 491
27 3300044683 Ga0466965_0004842 Ga0466965_0004842_4088_5605 491
28 3300044683 Ga0466965_0050789 Ga0466965_0050789_445_1956 491
29 3300044684 Ga0466966_0005734 Ga0466966_0005734_4426_5937 491
30 3300044684 Ga0466966_0079661 Ga0466966_0079661_237_1748 491
31 3300044693 Ga0466961_0008972 Ga0466961_0008972_388_1899 491
32 3300044694 Ga0466963_0005518 Ga0466963_0005518_5512_7023 491
33 3300044735 Ga0466968_0002156 Ga0466968_0002156_2181_3698 491
34 3300044735 Ga0466968_0007107 Ga0466968_0007107_551_2062 491
35 3300044765 Ga0466970_0054231 Ga0466970_0054231_355_1866 491
36 3300044842 Ga0466957_0006464 Ga0466957_0006464_4146_5657 491
37 3300044842 Ga0466957_0012567 Ga0466957_0012567_1124_2641 491
38 3300044842 Ga0466957_0047121 Ga0466957_0047121_550_2061 491
39 3300044901 Ga0466960_0001036 Ga0466960_0001036_8017_9528 491
40 3300044901 Ga0466960_0003419 Ga0466960_0003419_986_2503 491
41 3300044901 Ga0466960_0008474 Ga0466960_0008474_340_1851 491
42 3300045049 Ga0466959_0024162 Ga0466959_0024162_628_2139 491
43 3300045049 Ga0466959_0034308 Ga0466959_0034308_1974_3491 491
44 3300045836 Ga0466958_0001238 Ga0466958_0001238_4272_5783 491
45 3300045836 Ga0466958_0013126 Ga0466958_0013126_103_1614 491
46 3300045976 Ga0466967_0002017 Ga0466967_0002017_6238_7749 491
47 3300045976 Ga0466967_0019926 Ga0466967_0019926_3650_5161 491
48 3300045976 Ga0466967_0020211 Ga0466967_0020211_1266_2783 491
49 3300047320 Ga0495672_0093169 Ga0495672_0093169_45_1556 491
50 3300048921 Ga0496118_0000341 Ga0496118_0000341_67274_68785 491
51 3300048929 Ga0496126_0024621 Ga0496126_0024621_3479_4990 491
52 3300049569 Ga0501032_0006716 Ga0501032_0006716_1362_2873 491
53 3300049570 Ga0501033_0066807 Ga0501033_0066807_982_2493 491
54 3300049580 Ga0501046_0002698 Ga0501046_0002698_4377_5888 491
55 3300049581 Ga0501047_0010238 Ga0501047_0010238_4551_6062 491
56 3300049582 Ga0501048_0029617 Ga0501048_0029617_238_1749 491
57 3300049585 Ga0501069_0014361 Ga0501069_0014361_1668_3179 491
58 3300049586 Ga0501070_0002391 Ga0501070_0002391_1349_2860 491
59 3300049742 Ga0501080_0025955 Ga0501080_0025955_2659_4170 491
60 3300049822 Ga0501035_0014536 Ga0501035_0014536_709_2220 491
61 3300049823 Ga0501044_0004046 Ga0501044_0004046_10960_12471 491
62 3300050491 nmdc:mga00v17_24717_c1 nmdc:mga00v17_24717_c1_822_2333 491
63 3300050492 nmdc:mga0yw44_59620_c1 nmdc:mga0yw44_59620_c1_665_2176 491
64 3300053087 Ga0500643_010351 Ga0500643_010351_1476_2987 491
65 3300053730 Ga0500645_015161 Ga0500645_015161_246_1757 491
66 3300050490 nmdc:mga03n38_54153_c1 nmdc:mga03n38_54153_c1_23_1510 495
67 3300005841 Ga0068863_100070438 Ga0068863_1000704383 497
68 3300009177 Ga0105248_10044124 Ga0105248_100441243 497
69 3300025941 Ga0207711_10014691 Ga0207711_100146913 497
70 3300026088 Ga0207641_10067601 Ga0207641_100676013 497
71 3300048904 Ga0496101_0000931 Ga0496101_0000931_8034_9545 497
72 3300048907 Ga0496104_0002403 Ga0496104_0002403_1867_3378 497
73 3300048909 Ga0496106_0001747 Ga0496106_0001747_3400_4911 497
74 3300048917 Ga0496114_0008349 Ga0496114_0008349_877_2388 497
75 3300048918 Ga0496115_0002353 Ga0496115_0002353_1266_2777 497
76 3300053080 Ga0500635_0002094 Ga0500635_0002094_2801_4318 497
77 3300053131 Ga0500652_000574 Ga0500652_000574_9814_11331 497
78 iso_pu_bacteria 2939582691 2939587282 497
79 iso_pu_bacteria 2547132424 2548697855 498
80 iso_pu_bacteria 2551306166 2552109502 498
81 iso_pu_bacteria 2558860112 2558910913 498
82 iso_pu_bacteria 2565956761 2566996439 498
83 iso_pu_bacteria 2643221692 2644513005 498
84 iso_pu_bacteria 2738541264 2738667416 498
85 iso_pu_bacteria 2738541308 2738889974 498
86 iso_pu_bacteria 2738541356 2739146486 498
87 iso_pu_bacteria 2738543005 2739205326 498
88 iso_pu_bacteria 2738543011 2739238732 498
89 iso_pu_bacteria 2738543034 2739362191 498
90 iso_pu_bacteria 2744054611 2744957110 498
91 iso_pu_bacteria 2889300758 2889301005 498
92 iso_pu_bacteria 2919713450 2919715970 498
93 iso_pu_bacteria 2922554459 2922555616 498
94 iso_pu_bacteria 2928142448 2928144953 498
95 iso_pu_bacteria 2939743619 2939744524 498
96 3300031251 Ga0265327_10001656 Ga0265327_1000165631 499
97 3300031251 Ga0265327_10013030 Ga0265327_100130309 499
98 iso_pu_bacteria 2643221687 2644486434 499
99 iso_pu_bacteria 2738543028 2739333004 499
100 iso_pu_bacteria 2842134933 2842138454 499
101 iso_pu_bacteria 2902792274 2902798445 499
102 iso_pu_bacteria 2902799365 2902801610 499
103 iso_pu_bacteria 2902837492 2902840150 499
104 3300003792 Ga0055540_1000057 Ga0055540_1000057138 502
105 3300005335 Ga0070666_10015522 Ga0070666_100155221 502
106 3300009148 Ga0105243_10000749 Ga0105243_100007492 502
107 3300009545 Ga0105237_10024406 Ga0105237_100244064 502
108 3300025303 Ga0209051_1000075 Ga0209051_10000753 502
109 3300025903 Ga0207680_10084053 Ga0207680_100840532 502
110 3300025914 Ga0207671_10021892 Ga0207671_100218924 502
111 3300025935 Ga0207709_10033343 Ga0207709_100333432 502
112 3300041413 Ga0439465_0010055 Ga0439465_0010055_869_2377 502
113 3300046501 Ga0495607_0029650 Ga0495607_0029650_455_1963 502
114 3300046616 Ga0495668_0006065 Ga0495668_0006065_3430_4938 502
115 3300046674 Ga0495588_0010065 Ga0495588_0010065_1309_2817 502
116 3300047315 Ga0495581_0049740 Ga0495581_0049740_626_2134 502
117 3300047323 Ga0495683_0001077 Ga0495683_0001077_2169_3677 502
118 3300048903 Ga0496100_0000009 Ga0496100_0000009_149286_150794 502
119 3300048904 Ga0496101_0000018 Ga0496101_0000018_211012_212520 502
120 3300048905 Ga0496102_0001982 Ga0496102_0001982_9005_10513 502
121 3300048906 Ga0496103_0000666 Ga0496103_0000666_9252_10760 502
122 3300048907 Ga0496104_0152696 Ga0496104_0152696_391_1899 502
123 3300048909 Ga0496106_0001031 Ga0496106_0001031_11515_13023 502
124 3300048910 Ga0496107_0000812 Ga0496107_0000812_14642_16150 502
125 3300048911 Ga0496108_0118779 Ga0496108_0118779_546_2054 502
126 3300048912 Ga0496109_0000434 Ga0496109_0000434_20506_22014 502
127 3300048913 Ga0496110_0000204 Ga0496110_0000204_23106_24614 502
128 3300048914 Ga0496111_0004697 Ga0496111_0004697_4672_6180 502
129 3300048918 Ga0496115_0012439 Ga0496115_0012439_3886_5394 502
130 3300048919 Ga0496116_0000720 Ga0496116_0000720_3890_5398 502
131 3300048920 Ga0496117_0065452 Ga0496117_0065452_32_1540 502
132 3300048921 Ga0496118_0004777 Ga0496118_0004777_8815_10323 502
133 3300048922 Ga0496119_0005210 Ga0496119_0005210_5909_7417 502
134 3300048924 Ga0496121_0000023 Ga0496121_0000023_240970_242478 502
135 3300048925 Ga0496122_0000038 Ga0496122_0000038_240970_242478 502
136 3300048926 Ga0496123_0002987 Ga0496123_0002987_13028_14536 502
137 3300048927 Ga0496124_0000014 Ga0496124_0000014_240970_242478 502
138 3300048928 Ga0496125_0000020 Ga0496125_0000020_220971_222479 502
139 3300048928 Ga0496125_0062750 Ga0496125_0062750_798_2306 502
140 3300048929 Ga0496126_0000023 Ga0496126_0000023_240970_242478 502
141 3300050490 nmdc:mga03n38_12226_c1 nmdc:mga03n38_12226_c1_512_2020 502
142 3300002077 JGI24744J21845_10000247 JGI24744J21845_100002473 503
143 3300002077 JGI24744J21845_10012747 JGI24744J21845_100127472 503
144 3300002244 JGI24742J22300_10003964 JGI24742J22300_100039642 503
145 3300003792 Ga0055540_1007656 Ga0055540_10076562 503
146 3300003792 Ga0055540_1012070 Ga0055540_10120702 503
147 3300005329 Ga0070683_100153651 Ga0070683_1001536512 503
148 3300005330 Ga0070690_100001876 Ga0070690_10000187611 503
149 3300005331 Ga0070670_100029017 Ga0070670_1000290173 503
150 3300005337 Ga0070682_100012745 Ga0070682_1000127452 503
151 3300005338 Ga0068868_100012095 Ga0068868_1000120955 503
152 3300005347 Ga0070668_100012233 Ga0070668_1000122334 503
153 3300005347 Ga0070668_100025907 Ga0070668_1000259073 503
154 3300005355 Ga0070671_100006018 Ga0070671_1000060184 503
155 3300005356 Ga0070674_100006799 Ga0070674_1000067994 503
156 3300005365 Ga0070688_100088807 Ga0070688_1000888072 503
157 3300005367 Ga0070667_100003100 Ga0070667_1000031004 503
158 3300005367 Ga0070667_100015262 Ga0070667_1000152625 503
159 3300005434 Ga0070709_10006943 Ga0070709_100069432 503
160 3300005437 Ga0070710_10002268 Ga0070710_100022689 503
161 3300005438 Ga0070701_10007431 Ga0070701_100074312 503
162 3300005438 Ga0070701_10008490 Ga0070701_100084904 503
163 3300005439 Ga0070711_100000375 Ga0070711_10000037517 503
164 3300005455 Ga0070663_100013413 Ga0070663_1000134132 503
165 3300005455 Ga0070663_100083960 Ga0070663_1000839602 503
166 3300005455 Ga0070663_100143650 Ga0070663_1001436502 503
167 3300005456 Ga0070678_100001259 Ga0070678_10000125911 503
168 3300005457 Ga0070662_100015363 Ga0070662_1000153634 503
169 3300005459 Ga0068867_100058540 Ga0068867_1000585403 503
170 3300005466 Ga0070685_10050904 Ga0070685_100509042 503
171 3300005543 Ga0070672_100097612 Ga0070672_1000976122 503
172 3300005544 Ga0070686_100005397 Ga0070686_1000053976 503
173 3300005546 Ga0070696_100001702 Ga0070696_1000017024 503
174 3300005548 Ga0070665_100030932 Ga0070665_1000309325 503
175 3300005548 Ga0070665_100047606 Ga0070665_1000476062 503
176 3300005548 Ga0070665_100050045 Ga0070665_1000500454 503
177 3300005549 Ga0070704_100001435 Ga0070704_1000014354 503
178 3300005549 Ga0070704_100013616 Ga0070704_1000136164 503
179 3300005563 Ga0068855_100290747 Ga0068855_1002907472 503
180 3300005578 Ga0068854_100003064 Ga0068854_1000030644 503
181 3300005615 Ga0070702_100000895 Ga0070702_10000089512 503
182 3300005617 Ga0068859_100008118 Ga0068859_1000081189 503
183 3300005617 Ga0068859_100127548 Ga0068859_1001275482 503
184 3300005718 Ga0068866_10000812 Ga0068866_1000081211 503
185 3300005719 Ga0068861_100009768 Ga0068861_1000097684 503
186 3300005842 Ga0068858_100001306 Ga0068858_10000130619 503
187 3300005842 Ga0068858_100106362 Ga0068858_1001063622 503
188 3300005843 Ga0068860_100005764 Ga0068860_10000576412 503
189 3300005844 Ga0068862_100030890 Ga0068862_1000308905 503
190 3300006038 Ga0075365_10042179 Ga0075365_100421793 503
191 3300006048 Ga0075363_100003126 Ga0075363_1000031264 503
192 3300006048 Ga0075363_100004513 Ga0075363_1000045132 503
193 3300006048 Ga0075363_100016657 Ga0075363_1000166572 503
194 3300006048 Ga0075363_100024170 Ga0075363_1000241701 503
195 3300006048 Ga0075363_100031242 Ga0075363_1000312422 503
196 3300006051 Ga0075364_10001383 Ga0075364_100013834 503
197 3300006051 Ga0075364_10006919 Ga0075364_100069195 503
198 3300006051 Ga0075364_10011580 Ga0075364_100115807 503
199 3300006163 Ga0070715_10001286 Ga0070715_100012865 503
200 3300006173 Ga0070716_100003259 Ga0070716_1000032597 503
201 3300006173 Ga0070716_100007270 Ga0070716_1000072704 503
202 3300006175 Ga0070712_100008493 Ga0070712_1000084934 503
203 3300006178 Ga0075367_10013035 Ga0075367_100130352 503
204 3300006186 Ga0075369_10002341 Ga0075369_100023414 503
205 3300006186 Ga0075369_10006099 Ga0075369_100060993 503
206 3300006186 Ga0075369_10021119 Ga0075369_100211192 503
207 3300006358 Ga0068871_100022287 Ga0068871_1000222874 503
208 3300006358 Ga0068871_100065894 Ga0068871_1000658942 503
209 3300006844 Ga0075428_100004253 Ga0075428_10000425311 503
210 3300006846 Ga0075430_100027589 Ga0075430_1000275894 503
211 3300006881 Ga0068865_100003677 Ga0068865_10000367710 503
212 3300006931 Ga0097620_100008118 Ga0097620_1000081189 503
213 3300006931 Ga0097620_100127545 Ga0097620_1001275452 503
214 3300009098 Ga0105245_10001029 Ga0105245_1000102920 503
215 3300009101 Ga0105247_10009458 Ga0105247_100094584 503
216 3300009101 Ga0105247_10120426 Ga0105247_101204262 503
217 3300009147 Ga0114129_10002350 Ga0114129_1000235023 503
218 3300009148 Ga0105243_10001000 Ga0105243_1000100020 503
219 3300009176 Ga0105242_10000759 Ga0105242_100007594 503
220 3300009177 Ga0105248_10003071 Ga0105248_100030717 503
221 3300009545 Ga0105237_10010195 Ga0105237_100101955 503
222 3300009553 Ga0105249_10005589 Ga0105249_100055897 503
223 3300009553 Ga0105249_10015924 Ga0105249_100159244 503
224 3300010375 Ga0105239_10016836 Ga0105239_100168367 503
225 3300010375 Ga0105239_10024892 Ga0105239_100248925 503
226 3300011119 Ga0105246_10098421 Ga0105246_100984212 503
227 3300013296 Ga0157374_10034328 Ga0157374_100343285 503
228 3300013297 Ga0157378_10001038 Ga0157378_100010384 503
229 3300013306 Ga0163162_10018684 Ga0163162_100186844 503
230 3300013307 Ga0157372_10011618 Ga0157372_100116184 503
231 3300013308 Ga0157375_10000838 Ga0157375_100008384 503
232 3300014325 Ga0163163_10008789 Ga0163163_100087892 503
233 3300014326 Ga0157380_10001428 Ga0157380_1000142813 503
234 3300014968 Ga0157379_10016789 Ga0157379_100167896 503
235 3300017792 Ga0163161_10003257 Ga0163161_100032574 503
236 3300021384 Ga0213876_10030618 Ga0213876_100306181 503
237 3300021388 Ga0213875_10003146 Ga0213875_100031462 503
238 3300025303 Ga0209051_1004157 Ga0209051_10041573 503
239 3300025303 Ga0209051_1005472 Ga0209051_10054722 503
240 3300025898 Ga0207692_10003952 Ga0207692_100039524 503
241 3300025899 Ga0207642_10000117 Ga0207642_100001177 503
242 3300025901 Ga0207688_10005173 Ga0207688_100051733 503
243 3300025901 Ga0207688_10007002 Ga0207688_100070023 503
244 3300025907 Ga0207645_10106530 Ga0207645_101065302 503
245 3300025915 Ga0207693_10000930 Ga0207693_1000093020 503
246 3300025915 Ga0207693_10001479 Ga0207693_100014795 503
247 3300025916 Ga0207663_10002583 Ga0207663_100025836 503
248 3300025916 Ga0207663_10034294 Ga0207663_100342943 503
249 3300025927 Ga0207687_10001341 Ga0207687_1000134114 503
250 3300025931 Ga0207644_10021360 Ga0207644_100213604 503
251 3300025932 Ga0207690_10018077 Ga0207690_100180772 503
252 3300025933 Ga0207706_10010030 Ga0207706_100100306 503
253 3300025934 Ga0207686_10002045 Ga0207686_1000204510 503
254 3300025935 Ga0207709_10004572 Ga0207709_100045722 503
255 3300025937 Ga0207669_10000297 Ga0207669_100002979 503
256 3300025939 Ga0207665_10008653 Ga0207665_100086533 503
257 3300025961 Ga0207712_10008422 Ga0207712_100084226 503
258 3300025961 Ga0207712_10011195 Ga0207712_100111954 503
259 3300025972 Ga0207668_10007672 Ga0207668_100076724 503
260 3300025986 Ga0207658_10004009 Ga0207658_100040095 503
261 3300025986 Ga0207658_10015254 Ga0207658_100152542 503
262 3300025986 Ga0207658_10059413 Ga0207658_100594132 503
263 3300025986 Ga0207658_10145445 Ga0207658_101454451 503
264 3300026035 Ga0207703_10001189 Ga0207703_1000118920 503
265 3300026035 Ga0207703_10086661 Ga0207703_100866612 503
266 3300026035 Ga0207703_10099219 Ga0207703_100992192 503
267 3300026041 Ga0207639_10003053 Ga0207639_100030533 503
268 3300026067 Ga0207678_10013971 Ga0207678_100139716 503
269 3300026067 Ga0207678_10024388 Ga0207678_100243882 503
270 3300026067 Ga0207678_10111180 Ga0207678_101111802 503
271 3300026075 Ga0207708_10004036 Ga0207708_100040364 503
272 3300026075 Ga0207708_10135300 Ga0207708_101353002 503
273 3300026088 Ga0207641_10034263 Ga0207641_100342634 503
274 3300026089 Ga0207648_10001361 Ga0207648_100013616 503
275 3300026118 Ga0207675_100003845 Ga0207675_10000384511 503
276 3300026118 Ga0207675_100018540 Ga0207675_1000185407 503
277 3300026121 Ga0207683_10002759 Ga0207683_100027594 503
278 3300026121 Ga0207683_10005268 Ga0207683_100052689 503
279 3300028379 Ga0268266_10004748 Ga0268266_1000474810 503
280 3300028379 Ga0268266_10111901 Ga0268266_101119012 503
281 3300028381 Ga0268264_10005225 Ga0268264_100052253 503
282 3300031852 Ga0307410_10010859 Ga0307410_100108595 503
283 3300037853 Ga0436364_1058231 Ga0436364_1058231_7003_8514 503
284 3300039437 Ga0436365_0997910 Ga0436365_0997910_570_2081 503
285 3300039437 Ga0436365_1063989 Ga0436365_1063989_678_2189 503
286 3300039450 Ga0436363_1000063 Ga0436363_1000063_277_1788 503
287 3300041413 Ga0439465_0003815 Ga0439465_0003815_3315_4826 503
288 3300041452 Ga0451793_1402306 Ga0451793_1402306_810_2321 503
289 3300044658 Ga0466972_0007204 Ga0466972_0007204_2184_3695 503
290 3300044658 Ga0466972_0059376 Ga0466972_0059376_113_1624 503
291 3300044683 Ga0466965_0078145 Ga0466965_0078145_47_1558 503
292 3300044684 Ga0466966_0004656 Ga0466966_0004656_5839_7350 503
293 3300044693 Ga0466961_0009580 Ga0466961_0009580_811_2322 503
294 3300044706 Ga0466964_0051746 Ga0466964_0051746_114_1625 503
295 3300044719 Ga0466971_0001079 Ga0466971_0001079_4893_6404 503
296 3300044765 Ga0466970_0058182 Ga0466970_0058182_422_1933 503
297 3300044842 Ga0466957_0083639 Ga0466957_0083639_64_1575 503
298 3300045049 Ga0466959_0143849 Ga0466959_0143849_159_1670 503
299 3300045836 Ga0466958_0083612 Ga0466958_0083612_211_1722 503
300 3300045976 Ga0466967_0045215 Ga0466967_0045215_1109_2620 503
301 3300046459 Ga0495629_0009084 Ga0495629_0009084_1716_3227 503
302 3300046460 Ga0495638_0000404 Ga0495638_0000404_11015_12526 503
303 3300046473 Ga0495582_0011430 Ga0495582_0011430_2154_3665 503
304 3300046506 Ga0495583_0029257 Ga0495583_0029257_96_1607 503
305 3300046507 Ga0495606_0025815 Ga0495606_0025815_1561_3072 503
306 3300046524 Ga0495648_0004183 Ga0495648_0004183_7265_8776 503
307 3300046533 Ga0495640_0037562 Ga0495640_0037562_1643_3154 503
308 3300046648 Ga0495611_0018288 Ga0495611_0018288_608_2119 503
309 3300047319 Ga0495674_0064252 Ga0495674_0064252_1113_2624 503
310 3300047320 Ga0495672_0003432 Ga0495672_0003432_4211_5722 503
311 3300047469 Ga0495673_0002291 Ga0495673_0002291_7852_9363 503
312 3300047472 Ga0495686_0002735 Ga0495686_0002735_10434_11945 503
313 3300047673 Ga0495593_0010681 Ga0495593_0010681_2218_3729 503
314 3300048903 Ga0496100_0000857 Ga0496100_0000857_240_1751 503
315 3300048903 Ga0496100_0004952 Ga0496100_0004952_4145_5656 503
316 3300048904 Ga0496101_0000102 Ga0496101_0000102_4474_5985 503
317 3300048904 Ga0496101_0003929 Ga0496101_0003929_67_1578 503
318 3300048905 Ga0496102_0000037 Ga0496102_0000037_82820_84331 503
319 3300048905 Ga0496102_0007513 Ga0496102_0007513_6244_7755 503
320 3300048905 Ga0496102_0111822 Ga0496102_0111822_443_1954 503
321 3300048906 Ga0496103_0000004 Ga0496103_0000004_393532_395043 503
322 3300048906 Ga0496103_0000538 Ga0496103_0000538_21768_23279 503
323 3300048907 Ga0496104_0014311 Ga0496104_0014311_1925_3436 503
324 3300048907 Ga0496104_0039506 Ga0496104_0039506_1571_3082 503
325 3300048909 Ga0496106_0003068 Ga0496106_0003068_4764_6275 503
326 3300048909 Ga0496106_0022980 Ga0496106_0022980_2724_4235 503
327 3300048910 Ga0496107_0001670 Ga0496107_0001670_2018_3529 503
328 3300048910 Ga0496107_0012063 Ga0496107_0012063_1075_2586 503
329 3300048911 Ga0496108_0003170 Ga0496108_0003170_10067_11578 503
330 3300048911 Ga0496108_0033508 Ga0496108_0033508_2188_3699 503
331 3300048912 Ga0496109_0001781 Ga0496109_0001781_4774_6285 503
332 3300048912 Ga0496109_0016900 Ga0496109_0016900_2813_4324 503
333 3300048912 Ga0496109_0046174 Ga0496109_0046174_826_2337 503
334 3300048913 Ga0496110_0005194 Ga0496110_0005194_6053_7564 503
335 3300048914 Ga0496111_0029454 Ga0496111_0029454_1915_3426 503
336 3300048915 Ga0496112_0009281 Ga0496112_0009281_4121_5632 503
337 3300048915 Ga0496112_0013491 Ga0496112_0013491_1175_2686 503
338 3300048916 Ga0496113_0029650 Ga0496113_0029650_1732_3243 503
339 3300048917 Ga0496114_0000183 Ga0496114_0000183_34128_35639 503
340 3300048918 Ga0496115_0008628 Ga0496115_0008628_3592_5103 503
341 3300048919 Ga0496116_0000276 Ga0496116_0000276_82794_84305 503
342 3300048920 Ga0496117_0000003 Ga0496117_0000003_1591935_1593446 503
343 3300048921 Ga0496118_0000001 Ga0496118_0000001_1591938_1593449 503
344 3300048922 Ga0496119_0014264 Ga0496119_0014264_2079_3590 503
345 3300048924 Ga0496121_0000338 Ga0496121_0000338_91719_93230 503
346 3300048929 Ga0496126_0000551 Ga0496126_0000551_65362_66873 503
347 3300048929 Ga0496126_0006107 Ga0496126_0006107_948_2465 503
348 3300049569 Ga0501032_0009164 Ga0501032_0009164_5084_6595 503
349 3300049570 Ga0501033_0009441 Ga0501033_0009441_1321_2832 503
350 3300049572 Ga0501036_0023259 Ga0501036_0023259_3456_4967 503
351 3300049573 Ga0501037_0000663 Ga0501037_0000663_21819_23330 503
352 3300049573 Ga0501037_0007033 Ga0501037_0007033_4550_6061 503
353 3300049574 Ga0501038_0004859 Ga0501038_0004859_8269_9780 503
354 3300049575 Ga0501039_0007737 Ga0501039_0007737_2557_4068 503
355 3300049579 Ga0501043_0023280 Ga0501043_0023280_2761_4272 503
356 3300049581 Ga0501047_0005652 Ga0501047_0005652_2342_3853 503
357 3300049584 Ga0501068_0028500 Ga0501068_0028500_1553_3064 503
358 3300049586 Ga0501070_0059414 Ga0501070_0059414_1420_2931 503
359 3300049586 Ga0501070_0129501 Ga0501070_0129501_432_1943 503
360 3300049589 Ga0501073_0025482 Ga0501073_0025482_2349_3860 503
361 3300049593 Ga0501077_0086665 Ga0501077_0086665_331_1842 503
362 3300049742 Ga0501080_0070297 Ga0501080_0070297_360_1871 503
363 3300049744 Ga0501083_0105566 Ga0501083_0105566_99_1610 503
364 3300049822 Ga0501035_0007347 Ga0501035_0007347_93_1604 503
365 3300049823 Ga0501044_0002147 Ga0501044_0002147_3859_5370 503
366 3300049823 Ga0501044_0002237 Ga0501044_0002237_17278_18789 503
367 3300049823 Ga0501044_0030431 Ga0501044_0030431_2006_3517 503
368 3300050490 nmdc:mga03n38_12828_c1 nmdc:mga03n38_12828_c1_525_2036 503
369 3300050490 nmdc:mga03n38_1904_c1 nmdc:mga03n38_1904_c1_2672_4183 503
370 3300050490 nmdc:mga03n38_32215_c1 nmdc:mga03n38_32215_c1_569_2080 503
371 3300050491 nmdc:mga00v17_1631_c1 nmdc:mga00v17_1631_c1_7495_9006 503
372 3300050491 nmdc:mga00v17_6388_c1 nmdc:mga00v17_6388_c1_4573_6084 503
373 3300050491 nmdc:mga00v17_7327_c1 nmdc:mga00v17_7327_c1_1192_2703 503
374 3300050492 nmdc:mga0yw44_126278_c1 nmdc:mga0yw44_126278_c1_21_1532 503
375 3300050496 nmdc:mga07m45_74272_c1 nmdc:mga07m45_74272_c1_337_1848 503
376 3300050516 nmdc:mga0sz30_19051_c1 nmdc:mga0sz30_19051_c1_918_2429 503
377 3300050516 nmdc:mga0sz30_4872_c1 nmdc:mga0sz30_4872_c1_2500_4011 503
378 3300050516 nmdc:mga0sz30_5392_c1 nmdc:mga0sz30_5392_c1_2920_4431 503
379 3300053083 Ga0495655_0001252 Ga0495655_0001252_1355_2866 503
380 3300053108 Ga0500562_003304 Ga0500562_003304_809_2320 503
381 3300061719 Ga0466962_0002774 Ga0466962_0002774_934_2445 503

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13335

Mg_chelatase_C

Magnesium chelatase, subunit ChlI C-terminal

389

485

0.97

PF01078

Mg_chelatase

Magnesium chelatase, subunit ChlI

190

384

0.96

PF13541

ChlI

Subunit ChlI of Mg-chelatase

21

143

0.96

PF05362

Lon_C

Lon protease (S16) C-terminal proteolytic domain

1

155

0.84

PF07728

AAA_5

AAA domain (dynein-related subfamily)

213

357

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6on2-assembly1.cif.gz_F lon protease from yersinia pestis with y2853 substrate 0.8745 1 166
5lkq-assembly1.cif.gz_B protease domain of rada 0.8715 2 167
6x27-assembly12.cif.gz_L lon protease proteolytic domain complexed with bortezomib 0.8701 1 166
7sxo-assembly1.cif.gz_C yeast lon (pim1) with endogenous substrate 0.8697 1 170
7krz-assembly1.cif.gz_F human mitochondrial lonp1 in complex with bortezomib 0.8693 4 166
ID Description Score Start End Superfamily
af_P9WPR1_2_172_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9781 2 172 3.30.230.10
af_P9WPR1_2_172_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9725 2 172 3.30.230.10
af_P9WPR1_187_501_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9412 187 502 3.40.50.300
af_P9WPR1_187_501_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9383 187 502 3.40.50.300
af_P22787_5_170_3.30.230.10 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2; 0.9218 6 170 3.30.230.10
ID Description Score Start End GO Terms
AF-A0A2S8KWE3-F1-model_v4 deleted 0.9595 1 503
AF-A0A3D2VMI6-F1-model_v4 ATP-binding protein 0.9576 1 75
AF-A0A7I7XFD0-F1-model_v4 AAA+ ATPase domain-containing protein 0.9571 1 503 GO:0005524
GO:0016887
AF-P68908-F1-model_v4 Uncharacterized protein Mb2921c 0.9556 1 503 GO:0005524
GO:0016887
AF-A0A7V9FVA6-F1-model_v4 ATP-binding protein 0.9539 1 150 GO:0005524

Feature Viewer

pLDDT pTM Quality
83.31 0.83 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map