F428992

General Info

Members Datasets Scaffolds Average Seq Length
381 208 378 234

Family's Representative Sequence

Representative Sequence 3300028794|Ga0307515_10000059|Ga0307515_10000059174
Length 265
Sequence MPAAPYNTQQNFLQSDQYLYCSLFLFLIQKSAMNVVITGASKGFGRAIAETFAAGGHHLFICSRNEIDLYRAMEELMTRYPDIKIKAKARDISVKEQAIDFGEWLLANAYNIDVLVNNAGRFIPGSIHNENEGVLEEMMQTNVYSAYHLTRTLLPAMIKRKSGHIFNICSIASLNAYHNGGAYSISKFALHGFSKNLREELKPHQIKVTSVFPGAAYTDSWSGSGIDPNRIMESNDIAAMIYAAACLSPQACVEDIIIRPQLGDL

Samples

Sample ID Description Type Environment
1 2738541278 Niastella sp. CF465 Isolate Unclassified
2 2929154850 Filimonas sp. R-72421 Hybrid assembly Isolate Unclassified
3 2929921140 Chitinophaga sp. R-72609 Hybrid assembly Isolate Unclassified
4 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
7 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
8 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
9 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
10 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
11 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
12 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
13 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
14 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
15 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
16 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
36 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
37 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
38 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
44 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
45 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
46 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
50 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
60 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
61 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
63 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
64 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
65 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
66 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
67 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
68 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
69 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
70 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
71 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
76 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
77 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
78 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
79 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
80 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
81 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
82 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
86 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
87 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
88 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
89 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
91 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
133 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
137 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
138 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
139 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
140 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
141 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
142 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
143 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
144 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
145 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
146 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
147 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
150 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
151 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
152 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
153 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
154 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
155 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
156 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
157 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
158 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
159 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
160 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
161 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
162 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
163 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
164 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
165 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
166 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
167 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
168 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
169 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
172 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
173 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
174 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
175 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
176 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
177 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
178 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
179 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
180 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
181 3300049703 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control Metagenome Rhizosphere
182 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
183 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
184 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
185 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
186 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
187 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
188 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
193 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
194 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
195 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
196 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
197 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
198 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
199 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
200 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
201 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
202 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
203 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
204 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
205 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
206 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 8003151029 Chitinophaga sp. GbtcB8 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0
Isolates 1.05

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.82
Nodule 0
Rhizoplane 0.26
Rhizosphere 84.78
Stem 0
Stem Tuber 0
Unclassified 8.14

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24744J21845_10012468 3300002077 Bacteria 1724
2 JGI24751J29686_10019815 3300002459 Bacteria 1393
3 JGI25154J39366_1000023 3300002738 Bacteria 219569
4 JGI25157J39369_1017172 3300002741 Bacteria 880
5 rootH1_10108546 3300003316 Bacteria 7212
6 rootH1_10108546 3300003323 Unclassified 2346
7 rootH2_10001613 3300003320 Bacteria 20111
8 rootH2_10001614 3300003320 Bacteria 29985
9 rootH2_10023604 3300003320 Bacteria 13207
10 rootH2_10045482 3300003320 Bacteria 4174
11 rootL2_10008865 3300003322 Bacteria 21299
12 rootL2_10011803 3300003322 Bacteria 2006
13 rootL2_10026021 3300003322 Bacteria 20401
14 rootL2_10129454 3300003322 Bacteria 5168
15 rootH1_10007189 3300003323 Bacteria 65578
16 rootH1_10141599 3300003323 Bacteria 2453
17 rootH1_10161708 3300003323 Bacteria 2096
18 JGI25160J50197_1000765 3300003354 Bacteria 17319
19 Ga0065712_10016751 3300005290 Bacteria 1744
20 Ga0065712_10076530 3300005290 Bacteria 3644
21 Ga0065715_10130693 3300005293 Bacteria 2021
22 Ga0070658_10087832 3300005327 Unclassified 2560
23 Ga0070676_10316934 3300005328 Unclassified 1062
24 Ga0070683_100002723 3300005329 Bacteria 14112
25 Ga0070670_100019080 3300005331 Bacteria 5881
26 Ga0070670_100027025 3300005331 Bacteria 4936
27 Ga0070670_100497562 3300005331 Bacteria 1084
28 Ga0068869_100015968 3300005334 Bacteria 5053
29 Ga0068869_100020539 3300005334 Bacteria 4529
30 Ga0068869_100058799 3300005334 Unclassified 2812
31 Ga0068869_100427485 3300005334 Bacteria 1094
32 Ga0070666_10000072 3300005335 Bacteria 75356
33 Ga0070666_10019589 3300005335 Bacteria 4370
34 Ga0070666_10096849 3300005335 Unclassified 2031
35 Ga0070682_100000019 3300005337 Bacteria 220844
36 Ga0068868_100031884 3300005338 Bacteria 4051
37 Ga0068868_100751094 3300005338 Unclassified 876
38 Ga0070660_100366946 3300005339 Bacteria 1187
39 Ga0070689_100178554 3300005340 Bacteria 1723
40 Ga0070689_100182379 3300005340 Unclassified 1706
41 Ga0070689_100451335 3300005340 Bacteria 1094
42 Ga0070669_100001473 3300005353 Bacteria 17021
43 Ga0070669_100073359 3300005353 Bacteria 2535
44 Ga0070669_100156634 3300005353 Unclassified 1767
45 Ga0070669_100216889 3300005353 Unclassified 1512
46 Ga0070675_100168112 3300005354 Bacteria 1890
47 Ga0070671_100014066 3300005355 Bacteria 6460
48 Ga0070674_100026200 3300005356 Bacteria 3805
49 Ga0070673_100017881 3300005364 Bacteria 5052
50 Ga0070673_100091330 3300005364 Bacteria 2489
51 Ga0070673_100296906 3300005364 Unclassified 1421
52 Ga0070688_100432157 3300005365 Bacteria 981
53 Ga0070659_100001406 3300005366 Bacteria 17358
54 Ga0070667_100005066 3300005367 Bacteria 11030
55 Ga0070667_100007874 3300005367 Bacteria 8840
56 Ga0070667_100021229 3300005367 Bacteria 5395
57 Ga0070667_100064204 3300005367 Bacteria 3115
58 Ga0070700_100109981 3300005441 Bacteria 1831
59 Ga0070678_100027845 3300005456 Bacteria 3843
60 Ga0068867_100068349 3300005459 Bacteria 2651
61 Ga0068867_100181776 3300005459 Bacteria 1672
62 Ga0068867_100424682 3300005459 Unclassified 1127
63 Ga0070685_10009945 3300005466 Bacteria 4934
64 Ga0070685_10015240 3300005466 Bacteria 4081
65 Ga0070707_100544870 3300005468 Bacteria 1122
66 Ga0070698_100008121 3300005471 Bacteria 11346
67 Ga0070698_100219728 3300005471 Bacteria 1834
68 Ga0070684_100098957 3300005535 Bacteria 2602
69 Ga0068853_100101327 3300005539 Bacteria 2547
70 Ga0068853_100112208 3300005539 Bacteria 2423
71 Ga0068853_100252424 3300005539 Bacteria 1619
72 Ga0070672_100050456 3300005543 Bacteria 3240
73 Ga0070665_100000014 3300005548 Bacteria 484881
74 Ga0070665_100073080 3300005548 Bacteria 3436
75 Ga0068855_100010998 3300005563 Bacteria 10920
76 Ga0068854_100023108 3300005578 Bacteria 4243
77 Ga0068856_100048679 3300005614 Bacteria 4178
78 Ga0068852_100005115 3300005616 Bacteria 9343
79 Ga0068852_100031863 3300005616 Bacteria 4358
80 Ga0068859_100000006 3300005617 Bacteria 421509
81 Ga0068859_100285774 3300005617 Bacteria 1742
82 Ga0068859_100337782 3300005617 Bacteria 1600
83 Ga0068859_100629552 3300005617 Bacteria 1165
84 Ga0068864_100023261 3300005618 Bacteria 5202
85 Ga0068864_100065898 3300005618 Bacteria 3142
86 Ga0068864_100095234 3300005618 Bacteria 2633
87 Ga0068861_100220778 3300005719 Bacteria 1602
88 Ga0068851_10013185 3300005834 Bacteria 3910
89 Ga0068851_10053118 3300005834 Bacteria 2062
90 Ga0068870_10082814 3300005840 Bacteria 1777
91 Ga0068863_100033537 3300005841 Bacteria 4891
92 Ga0068863_100236855 3300005841 Unclassified 1762
93 Ga0068858_100004205 3300005842 Bacteria 14172
94 Ga0068858_100103960 3300005842 Bacteria 2650
95 Ga0068860_100000061 3300005843 Bacteria 192548
96 Ga0068860_100001096 3300005843 Bacteria 29818
97 Ga0068860_100002430 3300005843 Bacteria 19567
98 Ga0075366_10015481 3300006195 Bacteria 4372
99 Ga0075366_10319332 3300006195 Bacteria 951
100 Ga0097621_100002080 3300006237 Bacteria 13697
101 Ga0097621_100124415 3300006237 Bacteria 2189
102 Ga0097621_100128518 3300006237 Bacteria 2154
103 Ga0097621_100164824 3300006237 Bacteria 1907
104 Ga0097621_100175087 3300006237 Bacteria 1852
105 Ga0068871_100011294 3300006358 Bacteria 6549
106 Ga0068871_100040598 3300006358 Bacteria 3728
107 Ga0068871_100185708 3300006358 Bacteria 1789
108 Ga0068871_100529080 3300006358 Unclassified 1065
109 Ga0075428_100010088 3300006844 Bacteria 10494
110 Ga0075428_100021474 3300006844 Bacteria 7145
111 Ga0075428_100259270 3300006844 Bacteria 1872
112 Ga0075429_100005982 3300006880 Bacteria 10515
113 Ga0068865_100029896 3300006881 Unclassified 3619
114 Ga0068865_100042785 3300006881 Bacteria 3091
115 Ga0068865_100094096 3300006881 Unclassified 2180
116 Ga0097620_100000006 3300006931 Bacteria 421509
117 Ga0097620_100285772 3300006931 Bacteria 1742
118 Ga0097620_100337784 3300006931 Bacteria 1600
119 Ga0097620_100629559 3300006931 Bacteria 1165
120 Ga0105240_10000800 3300009093 Bacteria 56989
121 Ga0105240_10001787 3300009093 Bacteria 36277
122 Ga0105240_10001808 3300009093 Bacteria 36002
123 Ga0105240_10004358 3300009093 Bacteria 21601
124 Ga0105240_10320055 3300009093 Unclassified 1768
125 Ga0105240_10436249 3300009093 Bacteria 1469
126 Ga0111539_10179329 3300009094 Bacteria 2474
127 Ga0105245_10116422 3300009098 Unclassified 2492
128 Ga0105245_10193788 3300009098 Bacteria 1948
129 Ga0105245_10717955 3300009098 Unclassified 1034
130 Ga0105245_10758420 3300009098 Bacteria 1007
131 Ga0105247_10004545 3300009101 Bacteria 8845
132 Ga0105241_10002863 3300009174 Bacteria 12889
133 Ga0105241_10024166 3300009174 Bacteria 4513
134 Ga0105242_10014250 3300009176 Bacteria 6158
135 Ga0105242_10033301 3300009176 Bacteria 4126
136 Ga0105242_10362748 3300009176 Unclassified 1341
137 Ga0105248_11107997 3300009177 Bacteria 895
138 Ga0105237_10005526 3300009545 Bacteria 14250
139 Ga0105237_10006018 3300009545 Bacteria 13573
140 Ga0105237_10641995 3300009545 Bacteria 1068
141 Ga0105237_11034522 3300009545 Unclassified 828
142 Ga0105238_10000592 3300009551 Bacteria 38095
143 Ga0105238_10041703 3300009551 Bacteria 4649
144 Ga0105249_10003608 3300009553 Bacteria 13384
145 Ga0105249_10110038 3300009553 Bacteria 2603
146 Ga0105249_10412863 3300009553 Bacteria 1382
147 Ga0105249_10631445 3300009553 Bacteria 1128
148 Ga0105239_10000019 3300010375 Bacteria 273836
149 Ga0105239_10001405 3300010375 Bacteria 32195
150 Ga0105239_10043095 3300010375 Unclassified 4945
151 Ga0105239_10047892 3300010375 Bacteria 4685
152 Ga0105239_10048779 3300010375 Bacteria 4643
153 Ga0105239_10086497 3300010375 Bacteria 3455
154 Ga0105246_10044999 3300011119 Bacteria 3003
155 Ga0105246_10442471 3300011119 Bacteria 1090
156 Ga0157373_10000115 3300013100 Bacteria 63326
157 Ga0157374_10000011 3300013296 Bacteria 466749
158 Ga0157374_10209207 3300013296 Bacteria 1912
159 Ga0157374_10814220 3300013296 Unclassified 950
160 Ga0157378_10053579 3300013297 Bacteria 3592
161 Ga0157378_10098503 3300013297 Bacteria 2666
162 Ga0157378_10138632 3300013297 Unclassified 2257
163 Ga0163162_10002714 3300013306 Bacteria 16800
164 Ga0163162_10004708 3300013306 Bacteria 13154
165 Ga0163162_10511533 3300013306 Unclassified 1331
166 Ga0163162_10617355 3300013306 Unclassified 1210
167 Ga0157372_10091688 3300013307 Unclassified 3456
168 Ga0157372_10124972 3300013307 Bacteria 2958
169 Ga0157372_10196266 3300013307 Bacteria 2338
170 Ga0157372_10577664 3300013307 Bacteria 1310
171 Ga0157372_10737128 3300013307 Bacteria 1146
172 Ga0157375_10060457 3300013308 Unclassified 3757
173 Ga0157375_10218726 3300013308 Bacteria 2063
174 Ga0163163_10085587 3300014325 Unclassified 3161
175 Ga0157380_10041582 3300014326 Unclassified 3588
176 Ga0157380_10081707 3300014326 Bacteria 2644
177 Ga0157380_10132928 3300014326 Bacteria 2126
178 Ga0157380_10421280 3300014326 Bacteria 1274
179 Ga0157377_10028355 3300014745 Bacteria 3013
180 Ga0157377_10085024 3300014745 Bacteria 1857
181 Ga0157376_10002332 3300014969 Bacteria 12822
182 Ga0157376_10067562 3300014969 Bacteria 3024
183 Ga0163161_10074668 3300017792 Bacteria 2487
184 Ga0163161_10110470 3300017792 Bacteria 2055
185 Ga0163161_10415329 3300017792 Bacteria 1081
186 Ga0213876_10000680 3300021384 Bacteria 24189
187 Ga0209646_1000004 3300025246 Bacteria 786587
188 Ga0209026_1000136 3300025250 Bacteria 116507
189 Ga0209026_1000478 3300025250 Bacteria 30162
190 Ga0209129_1023329 3300025258 Bacteria 1104
191 Ga0207666_1000677 3300025271 Bacteria 4088
192 Ga0207426_1000211 3300025302 Bacteria 137322
193 Ga0207426_1001807 3300025302 Bacteria 15872
194 Ga0207697_10028303 3300025315 Bacteria 2292
195 Ga0207697_10156673 3300025315 Bacteria 992
196 Ga0207656_10093788 3300025321 Bacteria 1366
197 Ga0207656_10130713 3300025321 Bacteria 1176
198 Ga0207682_10057034 3300025893 Bacteria 1627
199 Ga0207642_10068365 3300025899 Bacteria 1681
200 Ga0207688_10014553 3300025901 Bacteria 4274
201 Ga0207680_10000137 3300025903 Bacteria 34668
202 Ga0207680_10080124 3300025903 Unclassified 2050
203 Ga0207645_10002012 3300025907 Bacteria 16324
204 Ga0207643_10025235 3300025908 Bacteria 3284
205 Ga0207705_10127002 3300025909 Unclassified 1896
206 Ga0207654_10006854 3300025911 Bacteria 5734
207 Ga0207654_10011213 3300025911 Bacteria 4567
208 Ga0207654_10067014 3300025911 Unclassified 2119
209 Ga0207695_10000087 3300025913 Bacteria 276412
210 Ga0207695_10000863 3300025913 Bacteria 55452
211 Ga0207695_10001230 3300025913 Bacteria 43841
212 Ga0207695_10001645 3300025913 Bacteria 35984
213 Ga0207695_10067464 3300025913 Unclassified 3670
214 Ga0207671_10000311 3300025914 Bacteria 71753
215 Ga0207671_10000931 3300025914 Bacteria 36651
216 Ga0207671_10022697 3300025914 Bacteria 4741
217 Ga0207671_10036310 3300025914 Unclassified 3655
218 Ga0207671_10263900 3300025914 Bacteria 1356
219 Ga0207662_10016699 3300025918 Bacteria 4145
220 Ga0207657_10338837 3300025919 Bacteria 1187
221 Ga0207681_10027603 3300025923 Bacteria 3672
222 Ga0207681_10074799 3300025923 Bacteria 2374
223 Ga0207650_10026266 3300025925 Bacteria 4152
224 Ga0207650_10041015 3300025925 Bacteria 3389
225 Ga0207650_10044063 3300025925 Bacteria 3278
226 Ga0207659_10238404 3300025926 Bacteria 1470
227 Ga0207687_10587273 3300025927 Unclassified 938
228 Ga0207690_10001089 3300025932 Bacteria 17317
229 Ga0207686_10000764 3300025934 Bacteria 19790
230 Ga0207670_10017672 3300025936 Bacteria 4314
231 Ga0207670_10100696 3300025936 Bacteria 2063
232 Ga0207670_10368404 3300025936 Bacteria 1141
233 Ga0207704_10137966 3300025938 Bacteria 1701
234 Ga0207704_10143669 3300025938 Bacteria 1673
235 Ga0207691_10016625 3300025940 Bacteria 6985
236 Ga0207691_10625167 3300025940 Bacteria 911
237 Ga0207689_10004743 3300025942 Bacteria 12259
238 Ga0207689_10018458 3300025942 Bacteria 5886
239 Ga0207689_10019310 3300025942 Bacteria 5745
240 Ga0207689_10269313 3300025942 Bacteria 1410
241 Ga0207661_10040456 3300025944 Bacteria 3664
242 Ga0207667_10000279 3300025949 Bacteria 70460
243 Ga0207651_10022281 3300025960 Unclassified 3870
244 Ga0207651_10537836 3300025960 Bacteria 1014
245 Ga0207651_10822149 3300025960 Bacteria 824
246 Ga0207712_10013894 3300025961 Bacteria 5164
247 Ga0207712_10116801 3300025961 Bacteria 2011
248 Ga0207640_10029184 3300025981 Bacteria 3383
249 Ga0207658_10010201 3300025986 Bacteria 6383
250 Ga0207658_10014921 3300025986 Bacteria 5325
251 Ga0207658_10038163 3300025986 Bacteria 3458
252 Ga0207677_10463910 3300026023 Bacteria 1088
253 Ga0207703_10005646 3300026035 Bacteria 10045
254 Ga0207639_10015699 3300026041 Bacteria 5342
255 Ga0207639_10035550 3300026041 Bacteria 3687
256 Ga0207639_10513626 3300026041 Unclassified 1096
257 Ga0207639_10563999 3300026041 Bacteria 1047
258 Ga0207708_10204730 3300026075 Bacteria 1575
259 Ga0207708_10274478 3300026075 Unclassified 1364
260 Ga0207702_10025359 3300026078 Bacteria 4920
261 Ga0207641_10000058 3300026088 Bacteria 166385
262 Ga0207641_10009677 3300026088 Bacteria 7940
263 Ga0207641_10235635 3300026088 Unclassified 1703
264 Ga0207648_10003197 3300026089 Bacteria 17252
265 Ga0207648_10199834 3300026089 Bacteria 1773
266 Ga0207648_10266984 3300026089 Bacteria 1528
267 Ga0207676_10004562 3300026095 Bacteria 9810
268 Ga0207676_10053354 3300026095 Bacteria 3164
269 Ga0207676_10104736 3300026095 Bacteria 2354
270 Ga0207675_100055983 3300026118 Unclassified 3679
271 Ga0207675_100338265 3300026118 Unclassified 1473
272 Ga0207683_10001428 3300026121 Bacteria 21608
273 Ga0207683_10047314 3300026121 Bacteria 3767
274 Ga0207698_10003938 3300026142 Bacteria 8990
275 Ga0207698_10020484 3300026142 Bacteria 4554
276 Ga0209968_1040720 3300027526 Bacteria 794
277 Ga0268266_10000068 3300028379 Bacteria 241100
278 Ga0268266_10084742 3300028379 Bacteria 2768
279 Ga0268265_10124617 3300028380 Bacteria 2129
280 Ga0268264_10000079 3300028381 Bacteria 249516
281 Ga0268264_10003074 3300028381 Bacteria 14443
282 Ga0268264_10458182 3300028381 Bacteria 1237
283 Ga0307517_10001481 3300028786 Bacteria 39285
284 Ga0307517_10113112 3300028786 Unclassified 2051
285 Ga0307515_10000059 3300028794 Bacteria 257520
286 Ga0307511_10000201 3300030521 Bacteria 60079
287 Ga0316182_1163057 3300030745 Bacteria 798
288 Ga0265327_10000030 3300031251 Bacteria 333531
289 Ga0307509_10090525 3300031507 Bacteria 3135
290 Ga0307509_10265102 3300031507 Bacteria 1489
291 Ga0307516_10003458 3300031730 Bacteria 20249
292 Ga0307410_10042226 3300031852 Bacteria 3013
293 Ga0307415_100305612 3300032126 Bacteria 1320
294 Ga0307507_10000034 3300033179 Bacteria 188697
295 Ga0307510_10087169 3300033180 Bacteria 2989
296 Ga0373927_0049047 3300035695 Bacteria 2731
297 Ga0373937_0515749 3300036401 Bacteria 1136
298 Ga0451797_0794945 3300041453 Bacteria 940
299 Ga0439449_0004451 3300042007 Bacteria 5406
300 Ga0439449_0056892 3300042007 Bacteria 1444
301 Ga0439449_0155340 3300042007 Bacteria 854
302 Ga0439457_000748 3300042014 Bacteria 9679
303 Ga0439462_0011837 3300042015 Bacteria 2224
304 Ga0439462_0028167 3300042015 Bacteria 1485
305 Ga0466965_0015215 3300044683 Bacteria 3655
306 Ga0466961_0009575 3300044693 Bacteria 6169
307 Ga0466968_0145164 3300044735 Bacteria 1088
308 Ga0466970_0045416 3300044765 Bacteria 2339
309 Ga0466970_0340267 3300044765 Unclassified 850
310 Ga0466957_0043245 3300044842 Bacteria 2728
311 Ga0466960_0002992 3300044901 Bacteria 6445
312 Ga0466959_0080462 3300045049 Bacteria 2348
313 Ga0466958_0026150 3300045836 Bacteria 3448
314 Ga0495638_0077294 3300046460 Bacteria 2027
315 Ga0495583_0078247 3300046506 Bacteria 1441
316 Ga0495648_0003375 3300046524 Bacteria 14060
317 Ga0495598_0147003 3300046537 Bacteria 820
318 Ga0495633_0000116 3300046558 Bacteria 108667
319 Ga0495668_0002655 3300046616 Bacteria 14375
320 Ga0495611_0000026 3300046648 Bacteria 118428
321 Ga0495625_0229515 3300046660 Bacteria 1213
322 Ga0495635_0157080 3300046663 Unclassified 1548
323 Ga0495670_0055992 3300046691 Unclassified 1978
324 Ga0495687_043322 3300047443 Bacteria 1961
325 Ga0495686_0000005 3300047472 Bacteria 827143
326 Ga0501033_0001685 3300049570 Bacteria 19341
327 Ga0501033_0008636 3300049570 Bacteria 7884
328 Ga0501033_0374596 3300049570 Bacteria 995
329 Ga0501034_0078671 3300049571 Bacteria 3301
330 Ga0501034_0110134 3300049571 Bacteria 2745
331 Ga0501034_0119069 3300049571 Unclassified 2627
332 Ga0501034_0646107 3300049571 Bacteria 960
333 Ga0501037_0405840 3300049573 Bacteria 934
334 Ga0501043_0021545 3300049579 Bacteria 5054
335 Ga0501043_0034982 3300049579 Bacteria 3951
336 Ga0501043_0398368 3300049579 Unclassified 1040
337 Ga0501046_0013771 3300049580 Bacteria 6837
338 Ga0501047_0110766 3300049581 Unclassified 2628
339 Ga0501072_0137819 3300049588 Bacteria 1946
340 Ga0501074_0068956 3300049590 Bacteria 2542
341 Ga0501219_000178 3300049703 Bacteria 11731
342 Ga0501225_0008601 3300049705 Bacteria 2925
343 Ga0501080_0294662 3300049742 Bacteria 1472
344 Ga0501083_0029149 3300049744 Bacteria 3799
345 Ga0501241_006845 3300049758 Bacteria 2096
346 Ga0501044_0001506 3300049823 Bacteria 27312
347 Ga0501044_0009390 3300049823 Bacteria 10656
348 Ga0501044_0029803 3300049823 Bacteria 5753
349 Ga0501044_0144898 3300049823 Bacteria 2362
350 Ga0501044_0201861 3300049823 Unclassified 1946
351 Ga0501044_0204390 3300049823 Unclassified 1932
352 Ga0501284_00036 3300050005 Bacteria 57905
353 nmdc:mga0k408_295626_c1 3300050493 Bacteria 966
354 nmdc:mga0k408_44352_c1 3300050493 Bacteria 2564
355 nmdc:mga09592_7231_c1 3300050508 Bacteria 9020
356 nmdc:mga0qj67_44695_c1 3300050509 Bacteria 3492
357 nmdc:mga08y16_190638_c1 3300050511 Bacteria 2126
358 nmdc:mga08y16_831145_c1 3300050511 Bacteria 914
359 Ga0500644_0107820 3300053088 Bacteria 1068
360 Ga0500583_0000076 3300053092 Bacteria 59162
361 Ga0500583_0000662 3300053092 Bacteria 10175
362 Ga0500583_0054041 3300053092 Bacteria 1874
363 Ga0500556_0026985 3300053104 Bacteria 1913
364 Ga0500556_0083918 3300053104 Bacteria 1208
365 Ga0500594_0020266 3300053118 Bacteria 1657
366 Ga0500642_0018750 3300053130 Bacteria 2684
367 Ga0500652_025832 3300053131 Unclassified 2255
368 Ga0500658_0141414 3300053134 Unclassified 1080
369 Ga0500559_0095612 3300053136 Bacteria 1364
370 Ga0500568_0050904 3300053139 Bacteria 1631
371 Ga0500573_0061891 3300053140 Bacteria 2144
372 Ga0500616_0013304 3300053153 Bacteria 4784
373 Ga0500622_0001733 3300053156 Bacteria 16854
374 Ga0500622_0048613 3300053156 Bacteria 2188
375 Ga0500611_000060 3300053727 Bacteria 47744
376 Ga0500645_028407 3300053730 Bacteria 1693
377 Ga0501084_0244924 3300054114 Bacteria 1513
378 Ga0466962_0042543 3300061719 Bacteria 2174

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003320 rootH2_10001613 rootH2_1000161319 217
2 3300003320 rootH2_10023604 rootH2_100236044 217
3 3300013296 Ga0157374_10000011 Ga0157374_10000011331 217
4 3300014969 Ga0157376_10002332 Ga0157376_100023322 217
5 3300044693 Ga0466961_0009575 Ga0466961_0009575_81_737 217
6 3300044735 Ga0466968_0145164 Ga0466968_0145164_400_1056 217
7 3300044765 Ga0466970_0045416 Ga0466970_0045416_975_1631 217
8 3300045049 Ga0466959_0080462 Ga0466959_0080462_237_893 217
9 3300045836 Ga0466958_0026150 Ga0466958_0026150_251_907 217
10 3300061719 Ga0466962_0042543 Ga0466962_0042543_1326_1982 217
11 3300047443 Ga0495687_043322 Ga0495687_043322_480_1145 220
12 3300005548 Ga0070665_100000014 Ga0070665_100000014220 221
13 3300028379 Ga0268266_10000068 Ga0268266_10000068213 221
14 3300053156 Ga0500622_0048613 Ga0500622_0048613_1497_2165 221
15 3300049570 Ga0501033_0001685 Ga0501033_0001685_456_1166 226
16 3300041453 Ga0451797_0794945 Ga0451797_0794945_205_897 227
17 3300049570 Ga0501033_0374596 Ga0501033_0374596_191_895 227
18 3300049571 Ga0501034_0110134 Ga0501034_0110134_1314_2018 227
19 iso_pu_bacteria 2738541278 2738725626 228
20 iso_pu_bacteria 2929154850 2929159696 228
21 3300010375 Ga0105239_10001405 Ga0105239_1000140529 229
22 3300031251 Ga0265327_10000030 Ga0265327_10000030172 229
23 iso_pu_bacteria 2929921140 2929921732 229
24 iso_pu_bacteria 8003151029 8003154279 229
25 3300026041 Ga0207639_10035550 Ga0207639_100355502 230
26 3300003323 rootH1_10161708 rootH1_101617083 231
27 3300002459 JGI24751J29686_10019815 JGI24751J29686_100198152 232
28 3300003320 rootH2_10001614 rootH2_1000161419 232
29 3300003322 rootL2_10011803 rootL2_100118033 232
30 3300003322 rootL2_10129454 rootL2_101294544 232
31 3300003323 rootH1_10007189 rootH1_100071898 232
32 3300003354 JGI25160J50197_1000765 JGI25160J50197_100076514 232
33 3300005290 Ga0065712_10016751 Ga0065712_100167512 232
34 3300005290 Ga0065712_10076530 Ga0065712_100765303 232
35 3300005293 Ga0065715_10130693 Ga0065715_101306932 232
36 3300005327 Ga0070658_10087832 Ga0070658_100878322 232
37 3300005328 Ga0070676_10316934 Ga0070676_103169341 232
38 3300005329 Ga0070683_100002723 Ga0070683_10000272311 232
39 3300005331 Ga0070670_100019080 Ga0070670_1000190805 232
40 3300005331 Ga0070670_100027025 Ga0070670_1000270257 232
41 3300005334 Ga0068869_100020539 Ga0068869_1000205395 232
42 3300005334 Ga0068869_100058799 Ga0068869_1000587992 232
43 3300005334 Ga0068869_100427485 Ga0068869_1004274851 232
44 3300005335 Ga0070666_10000072 Ga0070666_1000007227 232
45 3300005335 Ga0070666_10096849 Ga0070666_100968491 232
46 3300005337 Ga0070682_100000019 Ga0070682_100000019166 232
47 3300005338 Ga0068868_100751094 Ga0068868_1007510941 232
48 3300005340 Ga0070689_100178554 Ga0070689_1001785542 232
49 3300005340 Ga0070689_100182379 Ga0070689_1001823791 232
50 3300005353 Ga0070669_100156634 Ga0070669_1001566341 232
51 3300005353 Ga0070669_100216889 Ga0070669_1002168891 232
52 3300005355 Ga0070671_100014066 Ga0070671_1000140663 232
53 3300005364 Ga0070673_100017881 Ga0070673_1000178815 232
54 3300005364 Ga0070673_100296906 Ga0070673_1002969061 232
55 3300005367 Ga0070667_100005066 Ga0070667_1000050669 232
56 3300005367 Ga0070667_100007874 Ga0070667_1000078744 232
57 3300005367 Ga0070667_100021229 Ga0070667_1000212295 232
58 3300005441 Ga0070700_100109981 Ga0070700_1001099812 232
59 3300005459 Ga0068867_100181776 Ga0068867_1001817762 232
60 3300005459 Ga0068867_100424682 Ga0068867_1004246822 232
61 3300005466 Ga0070685_10009945 Ga0070685_100099455 232
62 3300005466 Ga0070685_10015240 Ga0070685_100152402 232
63 3300005468 Ga0070707_100544870 Ga0070707_1005448702 232
64 3300005471 Ga0070698_100008121 Ga0070698_1000081212 232
65 3300005471 Ga0070698_100219728 Ga0070698_1002197282 232
66 3300005539 Ga0068853_100112208 Ga0068853_1001122084 232
67 3300005543 Ga0070672_100050456 Ga0070672_1000504564 232
68 3300005563 Ga0068855_100010998 Ga0068855_1000109986 232
69 3300005614 Ga0068856_100048679 Ga0068856_1000486795 232
70 3300005616 Ga0068852_100005115 Ga0068852_1000051158 232
71 3300005616 Ga0068852_100031863 Ga0068852_1000318632 232
72 3300005617 Ga0068859_100000006 Ga0068859_10000000625 232
73 3300005617 Ga0068859_100285774 Ga0068859_1002857742 232
74 3300005617 Ga0068859_100629552 Ga0068859_1006295521 232
75 3300005618 Ga0068864_100023261 Ga0068864_1000232617 232
76 3300005618 Ga0068864_100065898 Ga0068864_1000658983 232
77 3300005834 Ga0068851_10053118 Ga0068851_100531182 232
78 3300005840 Ga0068870_10082814 Ga0068870_100828141 232
79 3300005841 Ga0068863_100033537 Ga0068863_1000335372 232
80 3300005841 Ga0068863_100236855 Ga0068863_1002368553 232
81 3300005842 Ga0068858_100004205 Ga0068858_10000420511 232
82 3300005842 Ga0068858_100103960 Ga0068858_1001039602 232
83 3300005843 Ga0068860_100000061 Ga0068860_10000006123 232
84 3300005843 Ga0068860_100001096 Ga0068860_10000109615 232
85 3300005843 Ga0068860_100002430 Ga0068860_10000243014 232
86 3300006195 Ga0075366_10015481 Ga0075366_100154812 232
87 3300006237 Ga0097621_100002080 Ga0097621_1000020807 232
88 3300006237 Ga0097621_100124415 Ga0097621_1001244152 232
89 3300006237 Ga0097621_100164824 Ga0097621_1001648242 232
90 3300006237 Ga0097621_100175087 Ga0097621_1001750871 232
91 3300006358 Ga0068871_100040598 Ga0068871_1000405982 232
92 3300006358 Ga0068871_100185708 Ga0068871_1001857081 232
93 3300006358 Ga0068871_100529080 Ga0068871_1005290802 232
94 3300006844 Ga0075428_100010088 Ga0075428_1000100885 232
95 3300006844 Ga0075428_100021474 Ga0075428_1000214745 232
96 3300006844 Ga0075428_100259270 Ga0075428_1002592702 232
97 3300006880 Ga0075429_100005982 Ga0075429_10000598210 232
98 3300006881 Ga0068865_100042785 Ga0068865_1000427853 232
99 3300006881 Ga0068865_100094096 Ga0068865_1000940962 232
100 3300006931 Ga0097620_100000006 Ga0097620_10000000625 232
101 3300006931 Ga0097620_100285772 Ga0097620_1002857722 232
102 3300006931 Ga0097620_100629559 Ga0097620_1006295591 232
103 3300009093 Ga0105240_10000800 Ga0105240_1000080041 232
104 3300009093 Ga0105240_10001787 Ga0105240_1000178733 232
105 3300009093 Ga0105240_10004358 Ga0105240_1000435810 232
106 3300009093 Ga0105240_10320055 Ga0105240_103200552 232
107 3300009093 Ga0105240_10436249 Ga0105240_104362492 232
108 3300009094 Ga0111539_10179329 Ga0111539_101793293 232
109 3300009098 Ga0105245_10116422 Ga0105245_101164222 232
110 3300009098 Ga0105245_10193788 Ga0105245_101937882 232
111 3300009098 Ga0105245_10717955 Ga0105245_107179551 232
112 3300009098 Ga0105245_10758420 Ga0105245_107584202 232
113 3300009101 Ga0105247_10004545 Ga0105247_100045452 232
114 3300009174 Ga0105241_10002863 Ga0105241_1000286310 232
115 3300009176 Ga0105242_10014250 Ga0105242_100142503 232
116 3300009176 Ga0105242_10362748 Ga0105242_103627482 232
117 3300009177 Ga0105248_11107997 Ga0105248_111079972 232
118 3300009545 Ga0105237_10005526 Ga0105237_1000552612 232
119 3300009545 Ga0105237_10006018 Ga0105237_100060187 232
120 3300009545 Ga0105237_10641995 Ga0105237_106419952 232
121 3300009545 Ga0105237_11034522 Ga0105237_110345221 232
122 3300009551 Ga0105238_10000592 Ga0105238_100005924 232
123 3300009551 Ga0105238_10041703 Ga0105238_100417035 232
124 3300009553 Ga0105249_10003608 Ga0105249_100036088 232
125 3300009553 Ga0105249_10412863 Ga0105249_104128632 232
126 3300009553 Ga0105249_10631445 Ga0105249_106314452 232
127 3300010375 Ga0105239_10000019 Ga0105239_1000001977 232
128 3300010375 Ga0105239_10043095 Ga0105239_100430952 232
129 3300010375 Ga0105239_10048779 Ga0105239_100487794 232
130 3300010375 Ga0105239_10086497 Ga0105239_100864974 232
131 3300011119 Ga0105246_10442471 Ga0105246_104424712 232
132 3300013296 Ga0157374_10209207 Ga0157374_102092072 232
133 3300013297 Ga0157378_10138632 Ga0157378_101386322 232
134 3300013306 Ga0163162_10002714 Ga0163162_1000271411 232
135 3300013306 Ga0163162_10004708 Ga0163162_100047087 232
136 3300013306 Ga0163162_10511533 Ga0163162_105115332 232
137 3300013306 Ga0163162_10617355 Ga0163162_106173551 232
138 3300013307 Ga0157372_10124972 Ga0157372_101249725 232
139 3300013307 Ga0157372_10196266 Ga0157372_101962662 232
140 3300013307 Ga0157372_10577664 Ga0157372_105776641 232
141 3300013307 Ga0157372_10737128 Ga0157372_107371282 232
142 3300013308 Ga0157375_10060457 Ga0157375_100604574 232
143 3300014325 Ga0163163_10085587 Ga0163163_100855872 232
144 3300014326 Ga0157380_10041582 Ga0157380_100415824 232
145 3300014326 Ga0157380_10081707 Ga0157380_100817073 232
146 3300014326 Ga0157380_10132928 Ga0157380_101329282 232
147 3300014326 Ga0157380_10421280 Ga0157380_104212802 232
148 3300014745 Ga0157377_10028355 Ga0157377_100283552 232
149 3300014745 Ga0157377_10085024 Ga0157377_100850243 232
150 3300014969 Ga0157376_10067562 Ga0157376_100675623 232
151 3300017792 Ga0163161_10074668 Ga0163161_100746681 232
152 3300017792 Ga0163161_10110470 Ga0163161_101104702 232
153 3300021384 Ga0213876_10000680 Ga0213876_1000068025 232
154 3300025271 Ga0207666_1000677 Ga0207666_10006775 232
155 3300025302 Ga0207426_1000211 Ga0207426_100021155 232
156 3300025315 Ga0207697_10156673 Ga0207697_101566732 232
157 3300025321 Ga0207656_10093788 Ga0207656_100937882 232
158 3300025893 Ga0207682_10057034 Ga0207682_100570342 232
159 3300025903 Ga0207680_10000137 Ga0207680_100001372 232
160 3300025903 Ga0207680_10080124 Ga0207680_100801241 232
161 3300025908 Ga0207643_10025235 Ga0207643_100252352 232
162 3300025909 Ga0207705_10127002 Ga0207705_101270022 232
163 3300025911 Ga0207654_10006854 Ga0207654_100068545 232
164 3300025911 Ga0207654_10011213 Ga0207654_100112132 232
165 3300025913 Ga0207695_10000087 Ga0207695_1000008754 232
166 3300025913 Ga0207695_10000863 Ga0207695_1000086334 232
167 3300025913 Ga0207695_10001230 Ga0207695_1000123027 232
168 3300025913 Ga0207695_10067464 Ga0207695_100674642 232
169 3300025914 Ga0207671_10000311 Ga0207671_100003117 232
170 3300025914 Ga0207671_10000931 Ga0207671_1000093110 232
171 3300025914 Ga0207671_10022697 Ga0207671_100226974 232
172 3300025914 Ga0207671_10036310 Ga0207671_100363102 232
173 3300025914 Ga0207671_10263900 Ga0207671_102639002 232
174 3300025918 Ga0207662_10016699 Ga0207662_100166992 232
175 3300025925 Ga0207650_10041015 Ga0207650_100410154 232
176 3300025925 Ga0207650_10044063 Ga0207650_100440632 232
177 3300025926 Ga0207659_10238404 Ga0207659_102384042 232
178 3300025927 Ga0207687_10587273 Ga0207687_105872731 232
179 3300025934 Ga0207686_10000764 Ga0207686_1000076411 232
180 3300025936 Ga0207670_10017672 Ga0207670_100176722 232
181 3300025936 Ga0207670_10100696 Ga0207670_101006962 232
182 3300025938 Ga0207704_10137966 Ga0207704_101379662 232
183 3300025940 Ga0207691_10016625 Ga0207691_100166255 232
184 3300025940 Ga0207691_10625167 Ga0207691_106251671 232
185 3300025942 Ga0207689_10004743 Ga0207689_100047438 232
186 3300025942 Ga0207689_10018458 Ga0207689_100184585 232
187 3300025942 Ga0207689_10269313 Ga0207689_102693132 232
188 3300025944 Ga0207661_10040456 Ga0207661_100404562 232
189 3300025949 Ga0207667_10000279 Ga0207667_1000027954 232
190 3300025960 Ga0207651_10022281 Ga0207651_100222813 232
191 3300025960 Ga0207651_10537836 Ga0207651_105378361 232
192 3300025961 Ga0207712_10013894 Ga0207712_100138945 232
193 3300025961 Ga0207712_10116801 Ga0207712_101168012 232
194 3300025986 Ga0207658_10010201 Ga0207658_100102018 232
195 3300025986 Ga0207658_10014921 Ga0207658_100149213 232
196 3300025986 Ga0207658_10038163 Ga0207658_100381632 232
197 3300026023 Ga0207677_10463910 Ga0207677_104639102 232
198 3300026035 Ga0207703_10005646 Ga0207703_100056466 232
199 3300026041 Ga0207639_10563999 Ga0207639_105639992 232
200 3300026075 Ga0207708_10204730 Ga0207708_102047302 232
201 3300026075 Ga0207708_10274478 Ga0207708_102744782 232
202 3300026078 Ga0207702_10025359 Ga0207702_100253594 232
203 3300026088 Ga0207641_10000058 Ga0207641_1000005847 232
204 3300026088 Ga0207641_10009677 Ga0207641_100096775 232
205 3300026088 Ga0207641_10235635 Ga0207641_102356352 232
206 3300026089 Ga0207648_10199834 Ga0207648_101998341 232
207 3300026089 Ga0207648_10266984 Ga0207648_102669841 232
208 3300026095 Ga0207676_10004562 Ga0207676_100045626 232
209 3300026095 Ga0207676_10053354 Ga0207676_100533543 232
210 3300026118 Ga0207675_100338265 Ga0207675_1003382652 232
211 3300026121 Ga0207683_10047314 Ga0207683_100473144 232
212 3300026142 Ga0207698_10003938 Ga0207698_100039388 232
213 3300026142 Ga0207698_10020484 Ga0207698_100204845 232
214 3300027526 Ga0209968_1040720 Ga0209968_10407201 232
215 3300028380 Ga0268265_10124617 Ga0268265_101246172 232
216 3300028381 Ga0268264_10000079 Ga0268264_10000079160 232
217 3300028381 Ga0268264_10003074 Ga0268264_100030744 232
218 3300028381 Ga0268264_10458182 Ga0268264_104581821 232
219 3300028786 Ga0307517_10001481 Ga0307517_1000148138 232
220 3300028786 Ga0307517_10113112 Ga0307517_101131121 232
221 3300028794 Ga0307515_10000059 Ga0307515_10000059174 232
222 3300030521 Ga0307511_10000201 Ga0307511_1000020148 232
223 3300030745 Ga0316182_1163057 Ga0316182_11630571 232
224 3300031507 Ga0307509_10090525 Ga0307509_100905252 232
225 3300031507 Ga0307509_10265102 Ga0307509_102651022 232
226 3300031730 Ga0307516_10003458 Ga0307516_1000345821 232
227 3300031852 Ga0307410_10042226 Ga0307410_100422263 232
228 3300032126 Ga0307415_100305612 Ga0307415_1003056122 232
229 3300033180 Ga0307510_10087169 Ga0307510_100871692 232
230 3300035695 Ga0373927_0049047 Ga0373927_0049047_205_906 232
231 3300036401 Ga0373937_0515749 Ga0373937_0515749_95_796 232
232 3300042007 Ga0439449_0004451 Ga0439449_0004451_1100_1801 232
233 3300042007 Ga0439449_0056892 Ga0439449_0056892_344_1045 232
234 3300042014 Ga0439457_000748 Ga0439457_000748_6269_6970 232
235 3300042015 Ga0439462_0011837 Ga0439462_0011837_611_1312 232
236 3300042015 Ga0439462_0028167 Ga0439462_0028167_75_776 232
237 3300044683 Ga0466965_0015215 Ga0466965_0015215_24_725 232
238 3300044765 Ga0466970_0340267 Ga0466970_0340267_73_774 232
239 3300044842 Ga0466957_0043245 Ga0466957_0043245_581_1282 232
240 3300044901 Ga0466960_0002992 Ga0466960_0002992_2225_2926 232
241 3300046460 Ga0495638_0077294 Ga0495638_0077294_603_1304 232
242 3300046524 Ga0495648_0003375 Ga0495648_0003375_1749_2450 232
243 3300046537 Ga0495598_0147003 Ga0495598_0147003_36_734 232
244 3300046616 Ga0495668_0002655 Ga0495668_0002655_4159_4860 232
245 3300046648 Ga0495611_0000026 Ga0495611_0000026_599_1300 232
246 3300046660 Ga0495625_0229515 Ga0495625_0229515_89_790 232
247 3300046663 Ga0495635_0157080 Ga0495635_0157080_32_733 232
248 3300046691 Ga0495670_0055992 Ga0495670_0055992_126_824 232
249 3300047472 Ga0495686_0000005 Ga0495686_0000005_522343_523044 232
250 3300049570 Ga0501033_0008636 Ga0501033_0008636_22_720 232
251 3300049571 Ga0501034_0078671 Ga0501034_0078671_1173_1871 232
252 3300049571 Ga0501034_0119069 Ga0501034_0119069_1870_2568 232
253 3300049571 Ga0501034_0646107 Ga0501034_0646107_144_842 232
254 3300049573 Ga0501037_0405840 Ga0501037_0405840_117_845 232
255 3300049579 Ga0501043_0021545 Ga0501043_0021545_3108_3809 232
256 3300049579 Ga0501043_0034982 Ga0501043_0034982_2434_3135 232
257 3300049579 Ga0501043_0398368 Ga0501043_0398368_114_815 232
258 3300049580 Ga0501046_0013771 Ga0501046_0013771_1923_2624 232
259 3300049581 Ga0501047_0110766 Ga0501047_0110766_1431_2132 232
260 3300049588 Ga0501072_0137819 Ga0501072_0137819_196_897 232
261 3300049590 Ga0501074_0068956 Ga0501074_0068956_29_730 232
262 3300049703 Ga0501219_000178 Ga0501219_000178_8710_9411 232
263 3300049705 Ga0501225_0008601 Ga0501225_0008601_1582_2283 232
264 3300049742 Ga0501080_0294662 Ga0501080_0294662_108_809 232
265 3300049744 Ga0501083_0029149 Ga0501083_0029149_493_1194 232
266 3300049758 Ga0501241_006845 Ga0501241_006845_1244_1945 232
267 3300049823 Ga0501044_0001506 Ga0501044_0001506_4076_4804 232
268 3300049823 Ga0501044_0009390 Ga0501044_0009390_824_1525 232
269 3300049823 Ga0501044_0029803 Ga0501044_0029803_3591_4289 232
270 3300049823 Ga0501044_0144898 Ga0501044_0144898_1651_2352 232
271 3300049823 Ga0501044_0201861 Ga0501044_0201861_563_1264 232
272 3300049823 Ga0501044_0204390 Ga0501044_0204390_1129_1827 232
273 3300050005 Ga0501284_00036 Ga0501284_00036_44037_44738 232
274 3300050493 nmdc:mga0k408_44352_c1 nmdc:mga0k408_44352_c1_1675_2376 232
275 3300050508 nmdc:mga09592_7231_c1 nmdc:mga09592_7231_c1_1114_1863 232
276 3300050509 nmdc:mga0qj67_44695_c1 nmdc:mga0qj67_44695_c1_1267_2016 232
277 3300050511 nmdc:mga08y16_190638_c1 nmdc:mga08y16_190638_c1_759_1508 232
278 3300050511 nmdc:mga08y16_831145_c1 nmdc:mga08y16_831145_c1_177_875 232
279 3300053088 Ga0500644_0107820 Ga0500644_0107820_344_1045 232
280 3300053092 Ga0500583_0000076 Ga0500583_0000076_33385_34086 232
281 3300053092 Ga0500583_0000662 Ga0500583_0000662_2417_3118 232
282 3300053092 Ga0500583_0054041 Ga0500583_0054041_758_1459 232
283 3300053104 Ga0500556_0026985 Ga0500556_0026985_471_1172 232
284 3300053104 Ga0500556_0083918 Ga0500556_0083918_228_929 232
285 3300053118 Ga0500594_0020266 Ga0500594_0020266_680_1387 232
286 3300053130 Ga0500642_0018750 Ga0500642_0018750_512_1213 232
287 3300053131 Ga0500652_025832 Ga0500652_025832_196_897 232
288 3300053134 Ga0500658_0141414 Ga0500658_0141414_268_969 232
289 3300053136 Ga0500559_0095612 Ga0500559_0095612_296_997 232
290 3300053139 Ga0500568_0050904 Ga0500568_0050904_160_882 232
291 3300053140 Ga0500573_0061891 Ga0500573_0061891_666_1367 232
292 3300053153 Ga0500616_0013304 Ga0500616_0013304_2951_3652 232
293 3300053156 Ga0500622_0001733 Ga0500622_0001733_1191_1892 232
294 3300053727 Ga0500611_000060 Ga0500611_000060_46983_47681 232
295 3300053730 Ga0500645_028407 Ga0500645_028407_217_918 232
296 3300054114 Ga0501084_0244924 Ga0501084_0244924_13_714 232
297 3300002738 JGI25154J39366_1000023 JGI25154J39366_10000234 233
298 3300002741 JGI25157J39369_1017172 JGI25157J39369_10171721 233
299 3300003316 rootH1_10108546 rootH1_101085462 233
300 3300003320 rootH2_10045482 rootH2_100454824 233
301 3300003322 rootL2_10008865 rootL2_100088659 233
302 3300003322 rootL2_10026021 rootL2_1002602113 233
303 3300003323 rootH1_10141599 rootH1_101415991 233
304 3300005339 Ga0070660_100366946 Ga0070660_1003669462 233
305 3300005353 Ga0070669_100073359 Ga0070669_1000733592 233
306 3300005366 Ga0070659_100001406 Ga0070659_1000014066 233
307 3300005535 Ga0070684_100098957 Ga0070684_1000989573 233
308 3300005539 Ga0068853_100101327 Ga0068853_1001013274 233
309 3300005834 Ga0068851_10013185 Ga0068851_100131856 233
310 3300006195 Ga0075366_10319332 Ga0075366_103193321 233
311 3300010375 Ga0105239_10047892 Ga0105239_100478923 233
312 3300013100 Ga0157373_10000115 Ga0157373_1000011519 233
313 3300013296 Ga0157374_10814220 Ga0157374_108142201 233
314 3300013297 Ga0157378_10098503 Ga0157378_100985031 233
315 3300013307 Ga0157372_10091688 Ga0157372_100916884 233
316 3300025246 Ga0209646_1000004 Ga0209646_1000004591 233
317 3300025250 Ga0209026_1000136 Ga0209026_100013668 233
318 3300025250 Ga0209026_1000478 Ga0209026_100047817 233
319 3300025258 Ga0209129_1023329 Ga0209129_10233292 233
320 3300025302 Ga0207426_1001807 Ga0207426_100180711 233
321 3300025321 Ga0207656_10130713 Ga0207656_101307131 233
322 3300025919 Ga0207657_10338837 Ga0207657_103388371 233
323 3300025923 Ga0207681_10027603 Ga0207681_100276033 233
324 3300025932 Ga0207690_10001089 Ga0207690_1000108913 233
325 3300026041 Ga0207639_10015699 Ga0207639_100156995 233
326 3300033179 Ga0307507_10000034 Ga0307507_1000003488 233
327 3300042007 Ga0439449_0155340 Ga0439449_0155340_138_842 233
328 3300046506 Ga0495583_0078247 Ga0495583_0078247_362_1066 233
329 3300046558 Ga0495633_0000116 Ga0495633_0000116_60999_61703 233
330 3300050493 nmdc:mga0k408_295626_c1 nmdc:mga0k408_295626_c1_50_754 233
331 3300002077 JGI24744J21845_10012468 JGI24744J21845_100124682 238
332 3300005331 Ga0070670_100497562 Ga0070670_1004975622 238
333 3300005334 Ga0068869_100015968 Ga0068869_1000159682 238
334 3300005335 Ga0070666_10019589 Ga0070666_100195892 238
335 3300005338 Ga0068868_100031884 Ga0068868_1000318843 238
336 3300005340 Ga0070689_100451335 Ga0070689_1004513352 238
337 3300005353 Ga0070669_100001473 Ga0070669_1000014736 238
338 3300005354 Ga0070675_100168112 Ga0070675_1001681122 238
339 3300005356 Ga0070674_100026200 Ga0070674_1000262003 238
340 3300005364 Ga0070673_100091330 Ga0070673_1000913302 238
341 3300005365 Ga0070688_100432157 Ga0070688_1004321572 238
342 3300005367 Ga0070667_100064204 Ga0070667_1000642042 238
343 3300005456 Ga0070678_100027845 Ga0070678_1000278454 238
344 3300005459 Ga0068867_100068349 Ga0068867_1000683493 238
345 3300005539 Ga0068853_100252424 Ga0068853_1002524242 238
346 3300005548 Ga0070665_100073080 Ga0070665_1000730802 238
347 3300005578 Ga0068854_100023108 Ga0068854_1000231084 238
348 3300005617 Ga0068859_100337782 Ga0068859_1003377822 238
349 3300005618 Ga0068864_100095234 Ga0068864_1000952343 238
350 3300005719 Ga0068861_100220778 Ga0068861_1002207782 238
351 3300006237 Ga0097621_100128518 Ga0097621_1001285183 238
352 3300006358 Ga0068871_100011294 Ga0068871_1000112944 238
353 3300006881 Ga0068865_100029896 Ga0068865_1000298964 238
354 3300006931 Ga0097620_100337784 Ga0097620_1003377842 238
355 3300009093 Ga0105240_10001808 Ga0105240_1000180833 238
356 3300009174 Ga0105241_10024166 Ga0105241_100241663 238
357 3300009176 Ga0105242_10033301 Ga0105242_100333013 238
358 3300009553 Ga0105249_10110038 Ga0105249_101100382 238
359 3300011119 Ga0105246_10044999 Ga0105246_100449992 238
360 3300013297 Ga0157378_10053579 Ga0157378_100535793 238
361 3300013308 Ga0157375_10218726 Ga0157375_102187262 238
362 3300017792 Ga0163161_10415329 Ga0163161_104153292 238
363 3300025315 Ga0207697_10028303 Ga0207697_100283032 238
364 3300025899 Ga0207642_10068365 Ga0207642_100683652 238
365 3300025901 Ga0207688_10014553 Ga0207688_100145532 238
366 3300025907 Ga0207645_10002012 Ga0207645_1000201218 238
367 3300025911 Ga0207654_10067014 Ga0207654_100670143 238
368 3300025913 Ga0207695_10001645 Ga0207695_1000164533 238
369 3300025923 Ga0207681_10074799 Ga0207681_100747993 238
370 3300025925 Ga0207650_10026266 Ga0207650_100262663 238
371 3300025936 Ga0207670_10368404 Ga0207670_103684042 238
372 3300025938 Ga0207704_10143669 Ga0207704_101436692 238
373 3300025942 Ga0207689_10019310 Ga0207689_100193102 238
374 3300025960 Ga0207651_10822149 Ga0207651_108221491 238
375 3300025981 Ga0207640_10029184 Ga0207640_100291843 238
376 3300026041 Ga0207639_10513626 Ga0207639_105136261 238
377 3300026089 Ga0207648_10003197 Ga0207648_1000319711 238
378 3300026095 Ga0207676_10104736 Ga0207676_101047362 238
379 3300026118 Ga0207675_100055983 Ga0207675_1000559832 238
380 3300026121 Ga0207683_10001428 Ga0207683_100014286 238
381 3300028379 Ga0268266_10084742 Ga0268266_100847424 238

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

33

227

0.98

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

39

253

0.91

PF08659

KR

KR domain

34

211

0.88

Structural Annotation

Top 5 Hits

ID Description Score Start End
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9583 2 234
3tfo-assembly1.cif.gz_D crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9486 2 236
3tfo-assembly1.cif.gz_C crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9393 2 235
3tfo-assembly1.cif.gz_B crystal structure of a putative 3-oxoacyl-(acyl-carrier-protein) reductase from sinorhizobium meliloti 0.9368 2 234
3p19-assembly1.cif.gz_B improved nadph-dependent blue fluorescent protein 0.935 2 234
ID Description Score Start End Superfamily
af_A0A0R0HUJ2_8_65_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9634 2 49 3.40.50.720
af_F4J128_251_373_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9586 93 187 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9583 2 234 3.40.50.720
af_Q2FVD5_4_231_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9387 3 233 3.40.50.720
3tfoB00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9368 2 234 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4Q5Y4M5-F1-model_v4 deleted 0.9905 39 238
AF-A0A2S7T0A5-F1-model_v4 Short-chain dehydrogenase 0.9865 2 238 GO:0016020
GO:0016491
AF-A0A364XWP1-F1-model_v4 Short-chain dehydrogenase 0.9862 2 238 GO:0016491
AF-A0A355BVG1-F1-model_v4 Short-chain dehydrogenase 0.986 2 238 GO:0016020
GO:0016491
AF-A0A381RBC3-F1-model_v4 Short-chain dehydrogenase 0.9847 2 238 GO:0016491

Feature Viewer

pLDDT pTM Quality
92.99 0.92 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map