F428955

General Info

Members Datasets Scaffolds Average Seq Length
381 229 762 328

Family's Representative Sequence

Representative Sequence 3300009545|Ga0105237_10020447|Ga0105237_100204473
Length 346
Sequence VLKTAYHQAAVSRAGQAMKRRKFIKLLGGTAVLPLAVRAQQSERLKRIVMIQALESSDPEAQLRAKAFQQRLVELGWIEGRNVRIDYRWIGSNPDRIRSNVAEVASLKPDVIFAAATPVVAALRDETRAVPIVFVQVVDPVAAGLVASLGRPGGNITGVTNFEYAMGGKWLEALKEVSPSLVRVAVIYSPKTAPYAKSLLRSIADAAPSFSIEPIDTPYHEASEINLVIDNFAQTPNGGLVVLPDTSTLAHRDRIIEGAARHRLPAIYPFRYFVASGGLMSYGTDSIGAVKQATSYVDRILRGAHPDELPVQAPNNFDLVLNLKTAKALGVDLPPTLLARADDVIE

Samples

Sample ID Description Type Environment
1 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
2 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
3 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
4 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
5 3300000043 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere Metagenome Rhizosphere
6 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
7 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
8 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
12 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
13 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
16 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
34 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
42 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
43 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
44 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
45 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
46 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
47 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
48 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
49 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
50 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
51 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
52 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
53 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
54 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
55 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
56 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
65 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
71 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
72 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
75 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
76 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
80 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
81 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
82 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
83 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
84 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
85 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
86 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
87 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
88 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
89 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
90 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
91 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
92 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
93 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
137 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
138 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
139 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
140 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
143 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
144 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
145 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
146 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
147 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
148 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
149 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
150 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
151 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
152 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
156 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
157 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
159 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
160 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
161 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
163 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
164 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
165 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
166 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
167 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
168 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
169 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
170 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
171 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
172 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
173 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
174 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
175 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
176 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
179 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
180 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
181 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
182 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
183 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
184 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
185 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
186 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
187 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
188 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
191 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
192 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
193 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
194 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
195 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
196 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
197 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
198 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
199 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
200 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
201 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
202 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
203 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
204 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
205 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
206 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
207 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
208 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
209 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
210 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
211 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
212 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
213 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
214 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
215 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
216 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
217 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
218 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
219 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
220 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
221 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
222 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
223 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
224 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
225 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
226 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
227 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
228 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
229 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.26
Nodule 0
Rhizoplane 11.55
Rhizosphere 88.19
Stem 0
Stem Tuber 0
Unclassified 9.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0105237_10020447 3300009545 Bacteria 6822
2 2214736892 2209111006 Bacteria 4025
3 ARcpr5oldR_c000405 3300000041 Bacteria 5944
4 ARcpr5oldR_c000596 3300000041 Bacteria 4431
5 ARSoilYngRDRAFT_c00585 3300000042 Bacteria 3911
6 ARcpr5yngRDRAFT_c000599 3300000043 Bacteria 4527
7 ARSoilOldRDRAFT_c000515 3300000044 Bacteria 4336
8 ARCol0yngRDRAFT_1000486 3300000652 Bacteria 4724
9 JGI24746J21847_1001737 3300001977 Bacteria 3493
10 JGI24737J22298_10026115 3300001990 Bacteria 1845
11 JGI24743J22301_10006619 3300001991 Bacteria 1982
12 JGI24750J21931_1001012 3300002070 Bacteria 3689
13 JGI24745J21846_1000511 3300002073 Bacteria 3446
14 JGI24744J21845_10001310 3300002077 Bacteria 4912
15 JGI24034J26672_10004194 3300002239 Bacteria 2033
16 JGI25404J52841_10006041 3300003659 Bacteria 2519
17 Ga0065715_10128869 3300005293 Bacteria 2041
18 Ga0070676_10049990 3300005328 Bacteria 2449
19 Ga0070670_100006844 3300005331 Bacteria 9659
20 Ga0068869_100008278 3300005334 Bacteria 6699
21 Ga0068869_100039849 3300005334 Bacteria 3356
22 Ga0070682_100209450 3300005337 Bacteria 1381
23 Ga0068868_100011030 3300005338 Bacteria 6569
24 Ga0070689_100109416 3300005340 Bacteria 2196
25 Ga0070687_100006758 3300005343 Bacteria 4726
26 Ga0070668_100280907 3300005347 Bacteria 1390
27 Ga0070671_100045484 3300005355 Bacteria 3649
28 Ga0070674_100267547 3300005356 Bacteria 1349
29 Ga0070673_100050098 3300005364 Bacteria 3263
30 Ga0070688_100124445 3300005365 Unclassified 1731
31 Ga0070667_100145429 3300005367 Bacteria 2079
32 Ga0070713_100364369 3300005436 Bacteria 1343
33 Ga0070710_10016809 3300005437 Bacteria 3731
34 Ga0070711_100132104 3300005439 Bacteria 1860
35 Ga0070705_100007601 3300005440 Bacteria 5340
36 Ga0070708_100201635 3300005445 Bacteria 1863
37 Ga0070708_100535784 3300005445 Bacteria 1105
38 Ga0070663_100078286 3300005455 Bacteria 2423
39 Ga0070663_100136430 3300005455 Bacteria 1868
40 Ga0070678_100038416 3300005456 Bacteria 3370
41 Ga0070662_100026553 3300005457 Bacteria 4012
42 Ga0070662_100206344 3300005457 Bacteria 1561
43 Ga0068867_100113305 3300005459 Bacteria 2086
44 Ga0070706_100191954 3300005467 Bacteria 1908
45 Ga0070707_100111237 3300005468 Bacteria 2656
46 Ga0070707_100130269 3300005468 Bacteria 2446
47 Ga0070699_100414684 3300005518 Unclassified 1219
48 Ga0070697_100132138 3300005536 Bacteria 2094
49 Ga0070697_100327780 3300005536 Unclassified 1319
50 Ga0068853_100021037 3300005539 Bacteria 5430
51 Ga0070672_100123579 3300005543 Unclassified 2121
52 Ga0070686_100029319 3300005544 Bacteria 3346
53 Ga0068857_100074223 3300005577 Bacteria 3031
54 Ga0070702_100183690 3300005615 Bacteria 1370
55 Ga0068852_100079987 3300005616 Bacteria 2896
56 Ga0068859_100128135 3300005617 Bacteria 2609
57 Ga0068864_100040061 3300005618 Bacteria 4007
58 Ga0068866_10016734 3300005718 Bacteria 3285
59 Ga0068861_100045929 3300005719 Bacteria 3291
60 Ga0068858_100011172 3300005842 Bacteria 8489
61 Ga0068860_100133790 3300005843 Bacteria 2380
62 Ga0068862_100042405 3300005844 Bacteria 3876
63 Ga0081455_10176929 3300005937 Bacteria 1619
64 Ga0081455_10213335 3300005937 Bacteria 1437
65 Ga0081455_10237341 3300005937 Bacteria 1342
66 Ga0081540_1000005 3300005983 Bacteria 227052
67 Ga0081540_1024662 3300005983 Bacteria 3484
68 Ga0081540_1093281 3300005983 Bacteria 1319
69 Ga0070717_10404625 3300006028 Bacteria 1226
70 Ga0070717_10410336 3300006028 Unclassified 1217
71 Ga0075432_10047834 3300006058 Bacteria 1504
72 Ga0070715_10033637 3300006163 Bacteria 2097
73 Ga0097621_100159784 3300006237 Bacteria 1936
74 Ga0068871_100236055 3300006358 Bacteria 1588
75 Ga0075428_100071733 3300006844 Bacteria 3785
76 Ga0075428_100115838 3300006844 Bacteria 2919
77 Ga0075428_100211206 3300006844 Bacteria 2097
78 Ga0075428_100226429 3300006844 Bacteria 2018
79 Ga0075428_100650135 3300006844 Bacteria 1124
80 Ga0075430_100025621 3300006846 Bacteria 5019
81 Ga0075430_100077543 3300006846 Bacteria 2785
82 Ga0075430_100077853 3300006846 Bacteria 2779
83 Ga0075430_100138089 3300006846 Bacteria 2030
84 Ga0075430_100187113 3300006846 Bacteria 1722
85 Ga0075430_100268793 3300006846 Unclassified 1411
86 Ga0075431_100056301 3300006847 Bacteria 4056
87 Ga0075431_100112311 3300006847 Unclassified 2812
88 Ga0075431_100143187 3300006847 Bacteria 2464
89 Ga0075431_100381070 3300006847 Bacteria 1414
90 Ga0075431_100540492 3300006847 Bacteria 1153
91 Ga0075433_10003524 3300006852 Bacteria 12089
92 Ga0075433_10003839 3300006852 Bacteria 11632
93 Ga0075433_10071128 3300006852 Bacteria 3058
94 Ga0075433_10246241 3300006852 Unclassified 1586
95 Ga0075434_100020798 3300006871 Bacteria 6370
96 Ga0075434_100036112 3300006871 Bacteria 4887
97 Ga0075434_100224469 3300006871 Unclassified 1898
98 Ga0075434_100328269 3300006871 Unclassified 1550
99 Ga0075429_100053054 3300006880 Unclassified 3528
100 Ga0075429_100137244 3300006880 Bacteria 2140
101 Ga0075429_100220746 3300006880 Unclassified 1660
102 Ga0075429_100228612 3300006880 Bacteria 1629
103 Ga0075429_100282225 3300006880 Bacteria 1454
104 Ga0068865_100015153 3300006881 Bacteria 4912
105 Ga0075436_100207113 3300006914 Bacteria 1390
106 Ga0097620_100128131 3300006931 Bacteria 2609
107 Ga0075435_100169481 3300007076 Bacteria 1842
108 Ga0111539_10021352 3300009094 Bacteria 7970
109 Ga0111539_10048304 3300009094 Bacteria 5082
110 Ga0111539_10118372 3300009094 Bacteria 3105
111 Ga0111539_10146829 3300009094 Bacteria 2761
112 Ga0111539_10572451 3300009094 Bacteria 1316
113 Ga0111539_10641591 3300009094 Bacteria 1236
114 Ga0105247_10114010 3300009101 Bacteria 1743
115 Ga0114129_10139502 3300009147 Bacteria 3324
116 Ga0114129_10162240 3300009147 Bacteria 3052
117 Ga0114129_10213864 3300009147 Bacteria 2605
118 Ga0114129_10303475 3300009147 Bacteria 2127
119 Ga0114129_10313925 3300009147 Unclassified 2086
120 Ga0114129_10390142 3300009147 Bacteria 1837
121 Ga0114129_10565551 3300009147 Bacteria 1477
122 Ga0114129_10629607 3300009147 Bacteria 1387
123 Ga0114129_10775253 3300009147 Unclassified 1225
124 Ga0114129_10858261 3300009147 Bacteria 1153
125 Ga0105243_10042798 3300009148 Bacteria 3547
126 Ga0105242_10147382 3300009176 Bacteria 2049
127 Ga0105248_10207692 3300009177 Bacteria 2206
128 Ga0105238_10378185 3300009551 Bacteria 1407
129 Ga0105249_10320080 3300009553 Bacteria 1562
130 Ga0105239_10031779 3300010375 Bacteria 5801
131 Ga0105239_10381798 3300010375 Bacteria 1593
132 Ga0105246_10058844 3300011119 Bacteria 2663
133 Ga0157374_10250660 3300013296 Bacteria 1742
134 Ga0157378_10343093 3300013297 Bacteria 1457
135 Ga0163162_10247884 3300013306 Bacteria 1913
136 Ga0163162_10273453 3300013306 Bacteria 1821
137 Ga0157375_10137023 3300013308 Bacteria 2573
138 Ga0163163_10094115 3300014325 Bacteria 3013
139 Ga0157380_10070194 3300014326 Bacteria 2830
140 Ga0157377_10007390 3300014745 Bacteria 5303
141 Ga0157379_10183405 3300014968 Bacteria 1891
142 Ga0157376_10123533 3300014969 Bacteria 2298
143 Ga0163161_10026297 3300017792 Bacteria 4122
144 Ga0207692_10057845 3300025898 Bacteria 1995
145 Ga0207710_10114906 3300025900 Bacteria 1281
146 Ga0207688_10019347 3300025901 Bacteria 3708
147 Ga0207680_10066155 3300025903 Bacteria 2222
148 Ga0207685_10080752 3300025905 Bacteria 1345
149 Ga0207699_10271550 3300025906 Bacteria 1175
150 Ga0207645_10015155 3300025907 Bacteria 5133
151 Ga0207645_10068507 3300025907 Bacteria 2269
152 Ga0207643_10008969 3300025908 Bacteria 5369
153 Ga0207643_10073958 3300025908 Bacteria 1965
154 Ga0207684_10068857 3300025910 Bacteria 3008
155 Ga0207671_10002280 3300025914 Bacteria 20756
156 Ga0207693_10170817 3300025915 Bacteria 1712
157 Ga0207663_10041878 3300025916 Bacteria 2794
158 Ga0207663_10290217 3300025916 Bacteria 1218
159 Ga0207662_10035942 3300025918 Bacteria 2895
160 Ga0207657_10081894 3300025919 Bacteria 2710
161 Ga0207649_10075528 3300025920 Bacteria 2166
162 Ga0207646_10153857 3300025922 Bacteria 2074
163 Ga0207650_10099534 3300025925 Bacteria 2235
164 Ga0207659_10124112 3300025926 Bacteria 1983
165 Ga0207644_10068446 3300025931 Bacteria 2590
166 Ga0207706_10122925 3300025933 Bacteria 2283
167 Ga0207706_10295295 3300025933 Bacteria 1412
168 Ga0207686_10083018 3300025934 Bacteria 2096
169 Ga0207670_10099492 3300025936 Bacteria 2074
170 Ga0207670_10186129 3300025936 Bacteria 1567
171 Ga0207669_10050121 3300025937 Bacteria 2493
172 Ga0207704_10159689 3300025938 Bacteria 1602
173 Ga0207665_10260539 3300025939 Bacteria 1284
174 Ga0207711_10128523 3300025941 Bacteria 2269
175 Ga0207689_10127121 3300025942 Bacteria 2097
176 Ga0207679_10104346 3300025945 Bacteria 2224
177 Ga0207651_10043619 3300025960 Bacteria 2995
178 Ga0207712_10009993 3300025961 Bacteria 6016
179 Ga0207668_10344833 3300025972 Bacteria 1243
180 Ga0207658_10188970 3300025986 Bacteria 1710
181 Ga0207677_10102143 3300026023 Bacteria 2113
182 Ga0207703_10022135 3300026035 Bacteria 4982
183 Ga0207678_10014593 3300026067 Bacteria 6914
184 Ga0207708_10040975 3300026075 Bacteria 3532
185 Ga0207641_10051231 3300026088 Bacteria 3496
186 Ga0207648_10157588 3300026089 Bacteria 2004
187 Ga0207676_10162094 3300026095 Bacteria 1938
188 Ga0207674_10049195 3300026116 Bacteria 4313
189 Ga0207675_100026558 3300026118 Bacteria 5390
190 Ga0207683_10065141 3300026121 Bacteria 3212
191 Ga0207698_10043623 3300026142 Bacteria 3362
192 Ga0209966_1002856 3300027695 Bacteria 2896
193 Ga0209998_10003408 3300027717 Bacteria 3479
194 Ga0209974_10038605 3300027876 Bacteria 1587
195 Ga0207428_10001522 3300027907 Bacteria 24210
196 Ga0207428_10005922 3300027907 Bacteria 11320
197 Ga0207428_10007370 3300027907 Bacteria 10036
198 Ga0207428_10046456 3300027907 Bacteria 3492
199 Ga0207428_10052353 3300027907 Bacteria 3260
200 Ga0207428_10090306 3300027907 Unclassified 2380
201 Ga0207428_10117674 3300027907 Bacteria 2040
202 Ga0268265_10020129 3300028380 Bacteria 4653
203 Ga0268264_10054100 3300028381 Bacteria 3351
204 Ga0265763_1000062 3300030763 Bacteria 4422
205 Ga0373930_0009385 3300034816 Bacteria 1730
206 Ga0373958_0003188 3300034819 Bacteria 2352
207 Ga0373928_0000134 3300035084 Bacteria 14013
208 Ga0373949_0006133 3300035090 Bacteria 2657
209 Ga0373951_0005808 3300035091 Bacteria 2851
210 Ga0373932_0007269 3300035112 Bacteria 2634
211 Ga0373939_0043105 3300035114 Bacteria 1367
212 Ga0373941_0011508 3300035115 Bacteria 2287
213 Ga0373954_0112617 3300035118 Bacteria 1317
214 Ga0373960_0022741 3300035121 Bacteria 1682
215 Ga0373942_0001883 3300035207 Bacteria 5269
216 Ga0373961_0006229 3300035241 Bacteria 2868
217 Ga0373962_0001989 3300035242 Bacteria 4876
218 Ga0373931_0001007 3300035691 Bacteria 11924
219 Ga0373935_0081717 3300035692 Bacteria 2101
220 Ga0373927_0250326 3300035695 Bacteria 1165
221 Ga0373933_0071551 3300035724 Bacteria 2112
222 Ga0373947_0127604 3300035725 Bacteria 1621
223 Ga0373947_0151507 3300035725 Bacteria 1494
224 Ga0373937_0147832 3300036401 Bacteria 2200
225 Ga0373937_0353180 3300036401 Bacteria 1393
226 Ga0395900_0385504 3300037418 Bacteria 1369
227 Ga0451576_0130723 3300045051 Bacteria 2617
228 Ga0495592_0142193 3300046454 Bacteria 1668
229 Ga0495603_0079744 3300046455 Bacteria 1919
230 Ga0495629_0007226 3300046459 Bacteria 8178
231 Ga0495629_0045252 3300046459 Bacteria 3088
232 Ga0495651_0019983 3300046462 Bacteria 5196
233 Ga0495653_0092562 3300046463 Unclassified 2207
234 Ga0495582_0016943 3300046473 Bacteria 3990
235 Ga0495639_0014882 3300046475 Bacteria 3371
236 Ga0495664_0013537 3300046477 Bacteria 4627
237 Ga0495585_0138281 3300046492 Bacteria 1277
238 Ga0495594_0215536 3300046499 Bacteria 1095
239 Ga0495607_0146520 3300046501 Bacteria 1213
240 Ga0495618_0018411 3300046514 Bacteria 4288
241 Ga0495618_0145801 3300046514 Bacteria 1513
242 Ga0495630_0091464 3300046517 Bacteria 2299
243 Ga0495652_0066138 3300046529 Bacteria 3035
244 Ga0495665_0031556 3300046531 Unclassified 2835
245 Ga0495640_0013938 3300046533 Bacteria 6099
246 Ga0495633_0088619 3300046558 Bacteria 1439
247 Ga0495667_0157799 3300046559 Bacteria 1459
248 Ga0495656_0133288 3300046615 Bacteria 1184
249 Ga0495634_0006407 3300046642 Bacteria 8945
250 Ga0495634_0017662 3300046642 Bacteria 5088
251 Ga0495634_0076134 3300046642 Unclassified 2203
252 Ga0495611_0091174 3300046648 Bacteria 1409
253 Ga0495635_0035774 3300046663 Bacteria 3443
254 Ga0495635_0229309 3300046663 Unclassified 1255
255 Ga0495635_0256947 3300046663 Unclassified 1177
256 Ga0495659_0075861 3300046664 Bacteria 1267
257 Ga0495661_0177104 3300046665 Unclassified 1133
258 Ga0495647_0091700 3300046681 Bacteria 1247
259 Ga0495658_0032619 3300046683 Bacteria 2845
260 Ga0495658_0137474 3300046683 Bacteria 1492
261 Ga0495613_0206698 3300046689 Bacteria 1382
262 Ga0495600_0035839 3300046809 Bacteria 3224
263 Ga0495581_0016686 3300047315 Bacteria 4269
264 Ga0495674_0008061 3300047319 Bacteria 10055
265 Ga0495674_0083598 3300047319 Unclassified 2736
266 Ga0495674_0248967 3300047319 Bacteria 1463
267 Ga0495676_0105817 3300047321 Unclassified 2074
268 Ga0495680_0046197 3300047322 Bacteria 3435
269 Ga0495680_0122684 3300047322 Bacteria 1917
270 Ga0495684_0019698 3300047471 Bacteria 5198
271 Ga0495684_0061408 3300047471 Bacteria 2859
272 Ga0495593_0131258 3300047673 Bacteria 1271
273 Ga0496100_0050524 3300048903 Bacteria 2694
274 Ga0496100_0242010 3300048903 Bacteria 1332
275 Ga0496100_0320686 3300048903 Bacteria 1164
276 Ga0496101_0153673 3300048904 Bacteria 1761
277 Ga0496101_0352885 3300048904 Bacteria 1156
278 Ga0496101_0422990 3300048904 Bacteria 1050
279 Ga0496102_0041807 3300048905 Bacteria 4152
280 Ga0496102_0311225 3300048905 Bacteria 1484
281 Ga0496102_0402831 3300048905 Bacteria 1286
282 Ga0496103_0017326 3300048906 Bacteria 4311
283 Ga0496104_0000696 3300048907 Bacteria 28932
284 Ga0496104_0003907 3300048907 Bacteria 12904
285 Ga0496104_0019415 3300048907 Bacteria 6218
286 Ga0496104_0030199 3300048907 Bacteria 5035
287 Ga0496104_0042608 3300048907 Bacteria 4260
288 Ga0496105_0047091 3300048908 Bacteria 3558
289 Ga0496105_0164775 3300048908 Bacteria 1819
290 Ga0496105_0172000 3300048908 Bacteria 1775
291 Ga0496106_0026424 3300048909 Bacteria 4323
292 Ga0496106_0242499 3300048909 Bacteria 1440
293 Ga0496107_0222114 3300048910 Bacteria 1405
294 Ga0496107_0226056 3300048910 Bacteria 1392
295 Ga0496107_0426965 3300048910 Unclassified 985
296 Ga0496108_0022418 3300048911 Bacteria 5190
297 Ga0496108_0126392 3300048911 Bacteria 2195
298 Ga0496109_0011660 3300048912 Bacteria 7558
299 Ga0496109_0061077 3300048912 Bacteria 3445
300 Ga0496109_0226219 3300048912 Unclassified 1760
301 Ga0496109_0466669 3300048912 Bacteria 1192
302 Ga0496110_0088666 3300048913 Bacteria 2763
303 Ga0496110_0157479 3300048913 Unclassified 2058
304 Ga0496110_0532312 3300048913 Bacteria 1068
305 Ga0496111_0158580 3300048914 Bacteria 1679
306 Ga0496111_0226929 3300048914 Bacteria 1387
307 Ga0496112_0092556 3300048915 Bacteria 2993
308 Ga0496112_0118732 3300048915 Bacteria 2614
309 Ga0496113_0013217 3300048916 Bacteria 5582
310 Ga0496113_0221726 3300048916 Bacteria 1507
311 Ga0496113_0284768 3300048916 Bacteria 1322
312 Ga0496113_0348840 3300048916 Bacteria 1187
313 Ga0496114_0128621 3300048917 Bacteria 2185
314 Ga0496115_0029026 3300048918 Bacteria 4341
315 Ga0496115_0035568 3300048918 Bacteria 3941
316 Ga0496115_0105687 3300048918 Bacteria 2311
317 Ga0501076_0140086 3300049592 Unclassified 1965
318 Ga0501045_0322872 3300049824 Bacteria 1149
319 nmdc:mga00v17_161778_c1 3300050491 Bacteria 1441
320 nmdc:mga05p37_134135_c1 3300050507 Bacteria 3037
321 nmdc:mga05p37_151539_c1 3300050507 Bacteria 2836
322 nmdc:mga05p37_171851_c1 3300050507 Bacteria 2643
323 nmdc:mga05p37_233177_c1 3300050507 Unclassified 2217
324 nmdc:mga05p37_42568_c1 3300050507 Bacteria 5367
325 nmdc:mga05p37_42709_c1 3300050507 Bacteria 5573
326 nmdc:mga05p37_453906_c1 3300050507 Bacteria 1483
327 nmdc:mga09592_114802_c1 3300050508 Bacteria 2311
328 nmdc:mga09592_232719_c1 3300050508 Unclassified 1597
329 nmdc:mga09592_37912_c1 3300050508 Bacteria 4045
330 nmdc:mga09592_45682_c1 3300050508 Bacteria 3690
331 nmdc:mga09592_67285_c1 3300050508 Bacteria 3038
332 nmdc:mga09592_83084_c1 3300050508 Bacteria 2730
333 nmdc:mga0qj67_14931_c1 3300050509 Bacteria 5874
334 nmdc:mga0qj67_19922_c1 3300050509 Bacteria 5133
335 nmdc:mga0qj67_27616_c1 3300050509 Unclassified 4401
336 nmdc:mga0qj67_72060_c1 3300050509 Bacteria 2758
337 nmdc:mga06r32_14686_c2 3300050510 Bacteria 4706
338 nmdc:mga06r32_306459_c1 3300050510 Unclassified 1574
339 nmdc:mga06r32_341793_c1 3300050510 Bacteria 1481
340 nmdc:mga06r32_342391_c1 3300050510 Bacteria 1480
341 nmdc:mga06r32_441981_c1 3300050510 Bacteria 1281
342 nmdc:mga06r32_47450_c1 3300050510 Bacteria 4102
343 nmdc:mga06r32_61320_c1 3300050510 Bacteria 3620
344 nmdc:mga06r32_66247_c1 3300050510 Bacteria 3485
345 nmdc:mga08y16_124513_c1 3300050511 Unclassified 2682
346 nmdc:mga08y16_155721_c1 3300050511 Unclassified 2375
347 nmdc:mga08y16_158597_c1 3300050511 Bacteria 2351
348 nmdc:mga08y16_171558_c1 3300050511 Bacteria 2253
349 nmdc:mga08y16_248998_c1 3300050511 Bacteria 1836
350 nmdc:mga08y16_2619_c1 3300050511 Bacteria 18484
351 nmdc:mga08y16_86871_c1 3300050511 Bacteria 3259
352 nmdc:mga08y16_97979_c1 3300050511 Bacteria 3054
353 nmdc:mga0n895_143691_c1 3300050512 Bacteria 2415
354 nmdc:mga0n895_144835_c1 3300050512 Bacteria 2405
355 nmdc:mga0n895_189583_c1 3300050512 Bacteria 2087
356 nmdc:mga0n895_3513_c1 3300050512 Bacteria 12665
357 nmdc:mga0n895_35224_c1 3300050512 Bacteria 4824
358 nmdc:mga0n895_479162_c1 3300050512 Bacteria 1255
359 nmdc:mga0n895_709750_c1 3300050512 Bacteria 1001
360 nmdc:mga0n895_93596_c1 3300050512 Bacteria 3009
361 nmdc:mga0rr50_144916_c1 3300050513 Bacteria 1914
362 nmdc:mga0rr50_387717_c1 3300050513 Bacteria 1179
363 nmdc:mga0rr50_62890_c1 3300050513 Bacteria 2802
364 nmdc:mga08x19_312469_c1 3300050514 Bacteria 1093
365 nmdc:mga08x19_39684_c1 3300050514 Unclassified 2993
366 nmdc:mga0a205_17111_c1 3300050515 Bacteria 6789
367 nmdc:mga0a205_180170_c1 3300050515 Bacteria 2007
368 nmdc:mga0a205_235312_c1 3300050515 Bacteria 1714
369 nmdc:mga0a205_314001_c1 3300050515 Bacteria 1439
370 nmdc:mga0a205_342289_c1 3300050515 Bacteria 1364
371 nmdc:mga0a205_65410_c1 3300050515 Bacteria 3513
372 nmdc:mga0a205_923_c1 3300050515 Bacteria 24235
373 Ga0495601_0005065 3300053077 Bacteria 7647
374 Ga0495601_0005870 3300053077 Bacteria 7157
375 Ga0495601_0162801 3300053077 Bacteria 1458
376 Ga0495612_0013162 3300053078 Bacteria 3332
377 Ga0495595_0005759 3300053084 Bacteria 5017
378 Ga0495595_0011558 3300053084 Bacteria 3693
379 Ga0495619_0009119 3300053085 Bacteria 6263
380 Ga0495619_0013623 3300053085 Bacteria 5125
381 Ga0495619_0233490 3300053085 Unclassified 1274
382 Ga0105237_10020447
383 2214736892
384 ARcpr5oldR_c000405
385 ARcpr5oldR_c000596
386 ARSoilYngRDRAFT_c00585
387 ARcpr5yngRDRAFT_c000599
388 ARSoilOldRDRAFT_c000515
389 ARCol0yngRDRAFT_1000486
390 JGI24746J21847_1001737
391 JGI24737J22298_10026115
392 JGI24743J22301_10006619
393 JGI24750J21931_1001012
394 JGI24745J21846_1000511
395 JGI24744J21845_10001310
396 JGI24034J26672_10004194
397 JGI25404J52841_10006041
398 Ga0065715_10128869
399 Ga0070676_10049990
400 Ga0070670_100006844
401 Ga0068869_100008278
402 Ga0068869_100039849
403 Ga0070682_100209450
404 Ga0068868_100011030
405 Ga0070689_100109416
406 Ga0070687_100006758
407 Ga0070668_100280907
408 Ga0070671_100045484
409 Ga0070674_100267547
410 Ga0070673_100050098
411 Ga0070688_100124445
412 Ga0070667_100145429
413 Ga0070713_100364369
414 Ga0070710_10016809
415 Ga0070711_100132104
416 Ga0070705_100007601
417 Ga0070708_100201635
418 Ga0070708_100535784
419 Ga0070663_100078286
420 Ga0070663_100136430
421 Ga0070678_100038416
422 Ga0070662_100026553
423 Ga0070662_100206344
424 Ga0068867_100113305
425 Ga0070706_100191954
426 Ga0070707_100111237
427 Ga0070707_100130269
428 Ga0070699_100414684
429 Ga0070697_100132138
430 Ga0070697_100327780
431 Ga0068853_100021037
432 Ga0070672_100123579
433 Ga0070686_100029319
434 Ga0068857_100074223
435 Ga0070702_100183690
436 Ga0068852_100079987
437 Ga0068859_100128135
438 Ga0068864_100040061
439 Ga0068866_10016734
440 Ga0068861_100045929
441 Ga0068858_100011172
442 Ga0068860_100133790
443 Ga0068862_100042405
444 Ga0081455_10176929
445 Ga0081455_10213335
446 Ga0081455_10237341
447 Ga0081540_1000005
448 Ga0081540_1024662
449 Ga0081540_1093281
450 Ga0070717_10404625
451 Ga0070717_10410336
452 Ga0075432_10047834
453 Ga0070715_10033637
454 Ga0097621_100159784
455 Ga0068871_100236055
456 Ga0075428_100071733
457 Ga0075428_100115838
458 Ga0075428_100211206
459 Ga0075428_100226429
460 Ga0075428_100650135
461 Ga0075430_100025621
462 Ga0075430_100077543
463 Ga0075430_100077853
464 Ga0075430_100138089
465 Ga0075430_100187113
466 Ga0075430_100268793
467 Ga0075431_100056301
468 Ga0075431_100112311
469 Ga0075431_100143187
470 Ga0075431_100381070
471 Ga0075431_100540492
472 Ga0075433_10003524
473 Ga0075433_10003839
474 Ga0075433_10071128
475 Ga0075433_10246241
476 Ga0075434_100020798
477 Ga0075434_100036112
478 Ga0075434_100224469
479 Ga0075434_100328269
480 Ga0075429_100053054
481 Ga0075429_100137244
482 Ga0075429_100220746
483 Ga0075429_100228612
484 Ga0075429_100282225
485 Ga0068865_100015153
486 Ga0075436_100207113
487 Ga0097620_100128131
488 Ga0075435_100169481
489 Ga0111539_10021352
490 Ga0111539_10048304
491 Ga0111539_10118372
492 Ga0111539_10146829
493 Ga0111539_10572451
494 Ga0111539_10641591
495 Ga0105247_10114010
496 Ga0114129_10139502
497 Ga0114129_10162240
498 Ga0114129_10213864
499 Ga0114129_10303475
500 Ga0114129_10313925
501 Ga0114129_10390142
502 Ga0114129_10565551
503 Ga0114129_10629607
504 Ga0114129_10775253
505 Ga0114129_10858261
506 Ga0105243_10042798
507 Ga0105242_10147382
508 Ga0105248_10207692
509 Ga0105238_10378185
510 Ga0105249_10320080
511 Ga0105239_10031779
512 Ga0105239_10381798
513 Ga0105246_10058844
514 Ga0157374_10250660
515 Ga0157378_10343093
516 Ga0163162_10247884
517 Ga0163162_10273453
518 Ga0157375_10137023
519 Ga0163163_10094115
520 Ga0157380_10070194
521 Ga0157377_10007390
522 Ga0157379_10183405
523 Ga0157376_10123533
524 Ga0163161_10026297
525 Ga0207692_10057845
526 Ga0207710_10114906
527 Ga0207688_10019347
528 Ga0207680_10066155
529 Ga0207685_10080752
530 Ga0207699_10271550
531 Ga0207645_10015155
532 Ga0207645_10068507
533 Ga0207643_10008969
534 Ga0207643_10073958
535 Ga0207684_10068857
536 Ga0207671_10002280
537 Ga0207693_10170817
538 Ga0207663_10041878
539 Ga0207663_10290217
540 Ga0207662_10035942
541 Ga0207657_10081894
542 Ga0207649_10075528
543 Ga0207646_10153857
544 Ga0207650_10099534
545 Ga0207659_10124112
546 Ga0207644_10068446
547 Ga0207706_10122925
548 Ga0207706_10295295
549 Ga0207686_10083018
550 Ga0207670_10099492
551 Ga0207670_10186129
552 Ga0207669_10050121
553 Ga0207704_10159689
554 Ga0207665_10260539
555 Ga0207711_10128523
556 Ga0207689_10127121
557 Ga0207679_10104346
558 Ga0207651_10043619
559 Ga0207712_10009993
560 Ga0207668_10344833
561 Ga0207658_10188970
562 Ga0207677_10102143
563 Ga0207703_10022135
564 Ga0207678_10014593
565 Ga0207708_10040975
566 Ga0207641_10051231
567 Ga0207648_10157588
568 Ga0207676_10162094
569 Ga0207674_10049195
570 Ga0207675_100026558
571 Ga0207683_10065141
572 Ga0207698_10043623
573 Ga0209966_1002856
574 Ga0209998_10003408
575 Ga0209974_10038605
576 Ga0207428_10001522
577 Ga0207428_10005922
578 Ga0207428_10007370
579 Ga0207428_10046456
580 Ga0207428_10052353
581 Ga0207428_10090306
582 Ga0207428_10117674
583 Ga0268265_10020129
584 Ga0268264_10054100
585 Ga0265763_1000062
586 Ga0373930_0009385
587 Ga0373958_0003188
588 Ga0373928_0000134
589 Ga0373949_0006133
590 Ga0373951_0005808
591 Ga0373932_0007269
592 Ga0373939_0043105
593 Ga0373941_0011508
594 Ga0373954_0112617
595 Ga0373960_0022741
596 Ga0373942_0001883
597 Ga0373961_0006229
598 Ga0373962_0001989
599 Ga0373931_0001007
600 Ga0373935_0081717
601 Ga0373927_0250326
602 Ga0373933_0071551
603 Ga0373947_0127604
604 Ga0373947_0151507
605 Ga0373937_0147832
606 Ga0373937_0353180
607 Ga0395900_0385504
608 Ga0451576_0130723
609 Ga0495592_0142193
610 Ga0495603_0079744
611 Ga0495629_0007226
612 Ga0495629_0045252
613 Ga0495651_0019983
614 Ga0495653_0092562
615 Ga0495582_0016943
616 Ga0495639_0014882
617 Ga0495664_0013537
618 Ga0495585_0138281
619 Ga0495594_0215536
620 Ga0495607_0146520
621 Ga0495618_0018411
622 Ga0495618_0145801
623 Ga0495630_0091464
624 Ga0495652_0066138
625 Ga0495665_0031556
626 Ga0495640_0013938
627 Ga0495633_0088619
628 Ga0495667_0157799
629 Ga0495656_0133288
630 Ga0495634_0006407
631 Ga0495634_0017662
632 Ga0495634_0076134
633 Ga0495611_0091174
634 Ga0495635_0035774
635 Ga0495635_0229309
636 Ga0495635_0256947
637 Ga0495659_0075861
638 Ga0495661_0177104
639 Ga0495647_0091700
640 Ga0495658_0032619
641 Ga0495658_0137474
642 Ga0495613_0206698
643 Ga0495600_0035839
644 Ga0495581_0016686
645 Ga0495674_0008061
646 Ga0495674_0083598
647 Ga0495674_0248967
648 Ga0495676_0105817
649 Ga0495680_0046197
650 Ga0495680_0122684
651 Ga0495684_0019698
652 Ga0495684_0061408
653 Ga0495593_0131258
654 Ga0496100_0050524
655 Ga0496100_0242010
656 Ga0496100_0320686
657 Ga0496101_0153673
658 Ga0496101_0352885
659 Ga0496101_0422990
660 Ga0496102_0041807
661 Ga0496102_0311225
662 Ga0496102_0402831
663 Ga0496103_0017326
664 Ga0496104_0000696
665 Ga0496104_0003907
666 Ga0496104_0019415
667 Ga0496104_0030199
668 Ga0496104_0042608
669 Ga0496105_0047091
670 Ga0496105_0164775
671 Ga0496105_0172000
672 Ga0496106_0026424
673 Ga0496106_0242499
674 Ga0496107_0222114
675 Ga0496107_0226056
676 Ga0496107_0426965
677 Ga0496108_0022418
678 Ga0496108_0126392
679 Ga0496109_0011660
680 Ga0496109_0061077
681 Ga0496109_0226219
682 Ga0496109_0466669
683 Ga0496110_0088666
684 Ga0496110_0157479
685 Ga0496110_0532312
686 Ga0496111_0158580
687 Ga0496111_0226929
688 Ga0496112_0092556
689 Ga0496112_0118732
690 Ga0496113_0013217
691 Ga0496113_0221726
692 Ga0496113_0284768
693 Ga0496113_0348840
694 Ga0496114_0128621
695 Ga0496115_0029026
696 Ga0496115_0035568
697 Ga0496115_0105687
698 Ga0501076_0140086
699 Ga0501045_0322872
700 nmdc:mga00v17_161778_c1
701 nmdc:mga05p37_134135_c1
702 nmdc:mga05p37_151539_c1
703 nmdc:mga05p37_171851_c1
704 nmdc:mga05p37_233177_c1
705 nmdc:mga05p37_42568_c1
706 nmdc:mga05p37_42709_c1
707 nmdc:mga05p37_453906_c1
708 nmdc:mga09592_114802_c1
709 nmdc:mga09592_232719_c1
710 nmdc:mga09592_37912_c1
711 nmdc:mga09592_45682_c1
712 nmdc:mga09592_67285_c1
713 nmdc:mga09592_83084_c1
714 nmdc:mga0qj67_14931_c1
715 nmdc:mga0qj67_19922_c1
716 nmdc:mga0qj67_27616_c1
717 nmdc:mga0qj67_72060_c1
718 nmdc:mga06r32_14686_c2
719 nmdc:mga06r32_306459_c1
720 nmdc:mga06r32_341793_c1
721 nmdc:mga06r32_342391_c1
722 nmdc:mga06r32_441981_c1
723 nmdc:mga06r32_47450_c1
724 nmdc:mga06r32_61320_c1
725 nmdc:mga06r32_66247_c1
726 nmdc:mga08y16_124513_c1
727 nmdc:mga08y16_155721_c1
728 nmdc:mga08y16_158597_c1
729 nmdc:mga08y16_171558_c1
730 nmdc:mga08y16_248998_c1
731 nmdc:mga08y16_2619_c1
732 nmdc:mga08y16_86871_c1
733 nmdc:mga08y16_97979_c1
734 nmdc:mga0n895_143691_c1
735 nmdc:mga0n895_144835_c1
736 nmdc:mga0n895_189583_c1
737 nmdc:mga0n895_3513_c1
738 nmdc:mga0n895_35224_c1
739 nmdc:mga0n895_479162_c1
740 nmdc:mga0n895_709750_c1
741 nmdc:mga0n895_93596_c1
742 nmdc:mga0rr50_144916_c1
743 nmdc:mga0rr50_387717_c1
744 nmdc:mga0rr50_62890_c1
745 nmdc:mga08x19_312469_c1
746 nmdc:mga08x19_39684_c1
747 nmdc:mga0a205_17111_c1
748 nmdc:mga0a205_180170_c1
749 nmdc:mga0a205_235312_c1
750 nmdc:mga0a205_314001_c1
751 nmdc:mga0a205_342289_c1
752 nmdc:mga0a205_65410_c1
753 nmdc:mga0a205_923_c1
754 Ga0495601_0005065
755 Ga0495601_0005870
756 Ga0495601_0162801
757 Ga0495612_0013162
758 Ga0495595_0005759
759 Ga0495595_0011558
760 Ga0495619_0009119
761 Ga0495619_0013623
762 Ga0495619_0233490

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04392

ABC_sub_bind

ABC transporter substrate binding protein

48

345

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.9046 30 329
3lft-assembly1.cif.gz_A the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.896 30 329
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.888 28 328
3lkv-assembly1.cif.gz_A-2 crystal structure of conserved domain protein from vibrio cholerae o1 biovar eltor str. n16961 0.8825 28 328
3lft-assembly2.cif.gz_B the crystal structure of the abc domain in complex with l-trp from streptococcus pneumonia to 1.35a 0.8732 32 329
ID Description Score Start End Superfamily
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8825 151 329 3.40.50.2300
3lftA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8653 151 329 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8391 151 328 3.40.50.2300
3lkvA02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8179 151 328 3.40.50.2300
6i3gA03 Alpha Beta;Roll;Dipeptide-binding Protein; domain 3;Dipeptide-binding Protein; Domain 3 0.8081 165 203 3.10.105.10
ID Description Score Start End GO Terms
AF-A0A537H7S6-F1-model_v4 ABC transporter substrate-binding protein 0.9675 224 330
AF-A0A534TVN5-F1-model_v4 ABC transporter substrate-binding protein 0.96 235 330
AF-A0A536Z3T8-F1-model_v4 ABC transporter substrate-binding protein 0.9595 232 330
AF-A0A0X8CID4-F1-model_v4 ABC transporter substrate-binding protein 0.9561 33 330
AF-A0A4V1KUC4-F1-model_v4 ABC transporter substrate-binding protein 0.9549 226 330

Map