F428941

General Info

Members Datasets Scaffolds Average Seq Length
381 195 762 107

Family's Representative Sequence

Representative Sequence 3300006844|Ga0075428_100887617|Ga0075428_1008876172
Length 106
Sequence MPWSLDDWKYLRREVVTDPKGRRWSIALMDVLGQEGDPDMPNAMLELQYASGRYFTILYSGAGMQWERGYTSLTDATTAYDRLLDAVSDGRLDPSQPVFRADLEDD

Samples

Sample ID Description Type Environment
1 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
7 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
13 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
14 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
17 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
22 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
23 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
27 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
28 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
29 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
30 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
31 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
41 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
42 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
43 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
44 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
45 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
46 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
47 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
48 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
49 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
50 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
51 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
52 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
53 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
54 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
55 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
56 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
57 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
58 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
59 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
60 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
61 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
62 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
63 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
64 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
65 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
66 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
67 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
71 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
72 3300012495 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.5.old.040610 Metagenome Rhizosphere
73 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
74 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
75 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
76 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
77 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
78 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
79 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
80 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
81 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
82 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
127 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
128 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
129 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
130 3300033544 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 Metagenome Unclassified
131 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
132 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
133 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
134 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
135 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
136 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
137 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
138 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
139 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
140 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
141 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
142 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
143 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
144 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
145 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
146 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
147 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
148 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
149 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
150 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
151 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
156 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
157 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
158 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
159 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
160 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
161 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
162 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
163 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
164 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
165 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
166 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
167 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
168 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
169 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
170 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
171 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
176 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
186 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
188 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
189 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
190 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
191 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
194 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
195 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 3.67
Rhizosphere 96.06
Stem 0
Stem Tuber 0
Unclassified 33.86

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075428_100887617 3300006844 Bacteria 946
2 LJNas_1001228 3300000546 Bacteria 3861
3 Ga0065715_10499679 3300005293 Unclassified 781
4 Ga0065715_10848202 3300005293 Unclassified 570
5 Ga0070690_100031159 3300005330 Bacteria 3320
6 Ga0070690_100137810 3300005330 Bacteria 1654
7 Ga0070690_100222239 3300005330 Unclassified 1324
8 Ga0070690_101253120 3300005330 Unclassified 593
9 Ga0068869_101712577 3300005334 Unclassified 561
10 Ga0070666_10211182 3300005335 Bacteria 1367
11 Ga0070689_100033472 3300005340 Bacteria 3916
12 Ga0070687_100003245 3300005343 Bacteria 6287
13 Ga0070687_100117939 3300005343 Bacteria 1513
14 Ga0070668_100211993 3300005347 Bacteria 1594
15 Ga0070668_100279586 3300005347 Bacteria 1394
16 Ga0070669_100001386 3300005353 Bacteria 17475
17 Ga0070669_100023607 3300005353 Bacteria 4404
18 Ga0070675_100159636 3300005354 Bacteria 1938
19 Ga0070671_100141348 3300005355 Bacteria 2031
20 Ga0070674_100069504 3300005356 Bacteria 2484
21 Ga0070673_100262505 3300005364 Bacteria 1509
22 Ga0070673_101296361 3300005364 Unclassified 684
23 Ga0070688_100207782 3300005365 Bacteria 1373
24 Ga0070667_100113226 3300005367 Bacteria 2354
25 Ga0070714_101105876 3300005435 Unclassified 772
26 Ga0070713_100009433 3300005436 Bacteria 6988
27 Ga0070713_100041476 3300005436 Bacteria 3750
28 Ga0070710_11200083 3300005437 Unclassified 561
29 Ga0070701_10409095 3300005438 Bacteria 861
30 Ga0070700_100507130 3300005441 Unclassified 929
31 Ga0070700_100985930 3300005441 Unclassified 692
32 Ga0070700_101129671 3300005441 Bacteria 651
33 Ga0070694_100176427 3300005444 Bacteria 1578
34 Ga0070694_100237620 3300005444 Unclassified 1373
35 Ga0070694_101611077 3300005444 Bacteria 551
36 Ga0070708_100255754 3300005445 Unclassified 1646
37 Ga0070708_101171862 3300005445 Bacteria 719
38 Ga0070678_101423077 3300005456 Unclassified 648
39 Ga0070662_100152075 3300005457 Bacteria 1803
40 Ga0070662_100373205 3300005457 Bacteria 1173
41 Ga0070662_100689459 3300005457 Unclassified 863
42 Ga0068867_100030644 3300005459 Bacteria 3880
43 Ga0068867_100247806 3300005459 Unclassified 1447
44 Ga0070685_11403393 3300005466 Bacteria 536
45 Ga0070706_100506549 3300005467 Unclassified 1123
46 Ga0070706_100846830 3300005467 Bacteria 845
47 Ga0070707_100067817 3300005468 Unclassified 3433
48 Ga0070707_100111657 3300005468 Unclassified 2651
49 Ga0070707_100314904 3300005468 Bacteria 1521
50 Ga0070707_100627129 3300005468 Unclassified 1038
51 Ga0070707_100771367 3300005468 Unclassified 925
52 Ga0070698_100246343 3300005471 Bacteria 1720
53 Ga0070698_100819315 3300005471 Archaea 875
54 Ga0070697_100071329 3300005536 Unclassified 2849
55 Ga0070697_100142693 3300005536 Bacteria 2015
56 Ga0070697_100244561 3300005536 Unclassified 1533
57 Ga0070697_100265769 3300005536 Unclassified 1469
58 Ga0070697_100679452 3300005536 Bacteria 908
59 Ga0068853_101541118 3300005539 Unclassified 644
60 Ga0070672_100019642 3300005543 Bacteria 4908
61 Ga0070686_100010326 3300005544 Bacteria 5262
62 Ga0070686_100070486 3300005544 Bacteria 2286
63 Ga0070686_101169526 3300005544 Bacteria 638
64 Ga0070695_100052452 3300005545 Bacteria 2621
65 Ga0070695_100067488 3300005545 Unclassified 2333
66 Ga0070695_100538711 3300005545 Unclassified 908
67 Ga0070696_100208018 3300005546 Unclassified 1463
68 Ga0070696_101236504 3300005546 Unclassified 632
69 Ga0070693_100033743 3300005547 Bacteria 2827
70 Ga0070704_100024532 3300005549 Bacteria 3958
71 Ga0070704_100031793 3300005549 Unclassified 3553
72 Ga0070704_100146853 3300005549 Bacteria 1849
73 Ga0070704_100233593 3300005549 Bacteria 1501
74 Ga0070704_100321421 3300005549 Unclassified 1297
75 Ga0070704_100462197 3300005549 Unclassified 1095
76 Ga0068855_100769917 3300005563 Bacteria 1025
77 Ga0068859_100368370 3300005617 Bacteria 1532
78 Ga0068859_100441248 3300005617 Bacteria 1398
79 Ga0068859_100663343 3300005617 Bacteria 1135
80 Ga0068859_100778496 3300005617 Unclassified 1045
81 Ga0068866_10031911 3300005718 Bacteria 2541
82 Ga0068861_100024352 3300005719 Bacteria 4377
83 Ga0068861_100080794 3300005719 Bacteria 2544
84 Ga0068861_101108323 3300005719 Unclassified 761
85 Ga0068863_100030141 3300005841 Bacteria 5182
86 Ga0068863_100123902 3300005841 Bacteria 2466
87 Ga0068858_100191612 3300005842 Bacteria 1932
88 Ga0068858_100443056 3300005842 Unclassified 1251
89 Ga0068858_100865827 3300005842 Unclassified 883
90 Ga0068858_100885518 3300005842 Unclassified 873
91 Ga0068858_101705895 3300005842 Bacteria 622
92 Ga0068860_100026216 3300005843 Bacteria 5620
93 Ga0068860_100315492 3300005843 Bacteria 1534
94 Ga0068862_100001051 3300005844 Bacteria 26481
95 Ga0068862_100480908 3300005844 Bacteria 1175
96 Ga0068862_100818601 3300005844 Bacteria 910
97 Ga0068862_101149136 3300005844 Bacteria 773
98 Ga0068862_101286176 3300005844 Unclassified 732
99 Ga0081455_10017994 3300005937 Bacteria 6749
100 Ga0081455_10507633 3300005937 Bacteria 808
101 Ga0070717_10047729 3300006028 Bacteria 3509
102 Ga0070717_10071880 3300006028 Unclassified 2887
103 Ga0070715_10258068 3300006163 Bacteria 914
104 Ga0070712_100056387 3300006175 Bacteria 2756
105 Ga0070712_100134039 3300006175 Unclassified 1881
106 Ga0070712_100215974 3300006175 Bacteria 1515
107 Ga0097621_100249859 3300006237 Bacteria 1553
108 Ga0068871_100128149 3300006358 Unclassified 2150
109 Ga0068871_100440122 3300006358 Bacteria 1167
110 Ga0075428_100764616 3300006844 Bacteria 1028
111 Ga0075431_101905195 3300006847 Unclassified 550
112 Ga0075433_10052297 3300006852 Bacteria 3559
113 Ga0075433_10358340 3300006852 Bacteria 1289
114 Ga0075433_10852566 3300006852 Bacteria 795
115 Ga0075433_10865512 3300006852 Bacteria 789
116 Ga0075434_100167291 3300006871 Bacteria 2218
117 Ga0075434_101543127 3300006871 Unclassified 673
118 Ga0075434_101629170 3300006871 Unclassified 654
119 Ga0075429_100208394 3300006880 Bacteria 1713
120 Ga0075429_100261961 3300006880 Bacteria 1514
121 Ga0075429_100803290 3300006880 Bacteria 824
122 Ga0068865_100046808 3300006881 Bacteria 2969
123 Ga0068865_101023605 3300006881 Bacteria 724
124 Ga0075436_100000797 3300006914 Bacteria 20902
125 Ga0075436_100135394 3300006914 Bacteria 1729
126 Ga0075436_100493318 3300006914 Bacteria 895
127 Ga0075436_100871343 3300006914 Bacteria 673
128 Ga0075436_100929636 3300006914 Unclassified 651
129 Ga0097620_100368336 3300006931 Bacteria 1532
130 Ga0097620_100441239 3300006931 Bacteria 1398
131 Ga0097620_100595224 3300006931 Bacteria 1199
132 Ga0097620_100663341 3300006931 Bacteria 1135
133 Ga0097620_100778603 3300006931 Unclassified 1045
134 Ga0075435_100000031 3300007076 Bacteria 77528
135 Ga0075435_100077261 3300007076 Unclassified 2730
136 Ga0075435_100116702 3300007076 Unclassified 2224
137 Ga0075435_100385889 3300007076 Bacteria 1203
138 Ga0075435_100431234 3300007076 Unclassified 1136
139 Ga0099794_10662525 3300007265 Unclassified 555
140 Ga0099795_10022404 3300007788 Bacteria 2085
141 Ga0105240_10251397 3300009093 Bacteria 2044
142 Ga0105240_10434904 3300009093 Unclassified 1471
143 Ga0111539_10139701 3300009094 Bacteria 2836
144 Ga0111539_10685772 3300009094 Unclassified 1193
145 Ga0111539_11800234 3300009094 Bacteria 710
146 Ga0105245_11085159 3300009098 Unclassified 846
147 Ga0105245_11658379 3300009098 Unclassified 691
148 Ga0105245_12076767 3300009098 Unclassified 622
149 Ga0114129_10013707 3300009147 Bacteria 11552
150 Ga0114129_10062895 3300009147 Bacteria 5184
151 Ga0114129_10465726 3300009147 Bacteria 1656
152 Ga0114129_10596796 3300009147 Unclassified 1431
153 Ga0114129_10802178 3300009147 Bacteria 1201
154 Ga0114129_11320102 3300009147 Unclassified 893
155 Ga0114129_12073581 3300009147 Bacteria 686
156 Ga0105243_10010837 3300009148 Bacteria 6897
157 Ga0105243_11268034 3300009148 Bacteria 753
158 Ga0105243_12151966 3300009148 Unclassified 594
159 Ga0105243_12754011 3300009148 Bacteria 532
160 Ga0105243_13093382 3300009148 Unclassified 504
161 Ga0105242_10197043 3300009176 Bacteria 1787
162 Ga0105242_11239899 3300009176 Bacteria 767
163 Ga0105242_12024337 3300009176 Bacteria 618
164 Ga0105248_10088767 3300009177 Bacteria 3480
165 Ga0105248_10126742 3300009177 Bacteria 2880
166 Ga0105248_10651267 3300009177 Bacteria 1189
167 Ga0105248_10728263 3300009177 Bacteria 1119
168 Ga0105248_10816306 3300009177 Bacteria 1053
169 Ga0105248_10834267 3300009177 Bacteria 1040
170 Ga0105249_10561926 3300009553 Bacteria 1193
171 Ga0105249_11679187 3300009553 Unclassified 708
172 Ga0105249_13077576 3300009553 Unclassified 536
173 Ga0099796_10162691 3300010159 Unclassified 885
174 Ga0157323_1015874 3300012495 Bacteria 663
175 Ga0157378_10458195 3300013297 Bacteria 1267
176 Ga0157378_11875261 3300013297 Bacteria 648
177 Ga0163162_10485290 3300013306 Bacteria 1367
178 Ga0163162_10984019 3300013306 Bacteria 953
179 Ga0157375_10733951 3300013308 Bacteria 1140
180 Ga0157380_10094457 3300014326 Bacteria 2475
181 Ga0157380_10717118 3300014326 Unclassified 1007
182 Ga0157379_10046699 3300014968 Bacteria 3863
183 Ga0157376_11802720 3300014969 Unclassified 648
184 Ga0163161_10373219 3300017792 Bacteria 1138
185 Ga0224572_1021003 3300024225 Bacteria 1253
186 Ga0228598_1000071 3300024227 Bacteria 15175
187 Ga0228598_1016098 3300024227 Archaea 1476
188 Ga0228598_1046640 3300024227 Bacteria 858
189 Ga0207692_10232589 3300025898 Bacteria 1097
190 Ga0207692_10914755 3300025898 Bacteria 577
191 Ga0207642_10886529 3300025899 Bacteria 571
192 Ga0207680_10003036 3300025903 Bacteria 7873
193 Ga0207680_10840734 3300025903 Unclassified 658
194 Ga0207680_10895772 3300025903 Unclassified 636
195 Ga0207685_10524054 3300025905 Unclassified 627
196 Ga0207699_10270953 3300025906 Unclassified 1176
197 Ga0207684_10207894 3300025910 Unclassified 1688
198 Ga0207684_11532037 3300025910 Unclassified 542
199 Ga0207695_10342331 3300025913 Bacteria 1383
200 Ga0207693_10771480 3300025915 Bacteria 742
201 Ga0207663_10569880 3300025916 Unclassified 887
202 Ga0207662_10005780 3300025918 Bacteria 6620
203 Ga0207662_10087487 3300025918 Bacteria 1911
204 Ga0207646_10122012 3300025922 Unclassified 2341
205 Ga0207646_10181178 3300025922 Unclassified 1903
206 Ga0207646_10524081 3300025922 Unclassified 1067
207 Ga0207646_10562717 3300025922 Unclassified 1024
208 Ga0207681_10008953 3300025923 Bacteria 6113
209 Ga0207681_10353949 3300025923 Bacteria 1176
210 Ga0207681_10805939 3300025923 Unclassified 784
211 Ga0207700_10015211 3300025928 Bacteria 5065
212 Ga0207700_10697588 3300025928 Unclassified 906
213 Ga0207664_10062289 3300025929 Bacteria 2979
214 Ga0207664_10099510 3300025929 Unclassified 2400
215 Ga0207644_10022640 3300025931 Bacteria 4294
216 Ga0207690_10865631 3300025932 Bacteria 749
217 Ga0207706_10130431 3300025933 Bacteria 2211
218 Ga0207706_10357575 3300025933 Bacteria 1269
219 Ga0207706_10409055 3300025933 Bacteria 1176
220 Ga0207706_10726552 3300025933 Bacteria 847
221 Ga0207686_10057987 3300025934 Bacteria 2440
222 Ga0207686_11445061 3300025934 Bacteria 566
223 Ga0207709_10334540 3300025935 Bacteria 1138
224 Ga0207709_11723334 3300025935 Bacteria 521
225 Ga0207670_10198500 3300025936 Bacteria 1523
226 Ga0207669_10283581 3300025937 Bacteria 1250
227 Ga0207704_10868536 3300025938 Bacteria 757
228 Ga0207665_11033827 3300025939 Bacteria 654
229 Ga0207665_11305070 3300025939 Bacteria 579
230 Ga0207691_10025381 3300025940 Bacteria 5565
231 Ga0207711_10022738 3300025941 Bacteria 5244
232 Ga0207711_10098961 3300025941 Bacteria 2577
233 Ga0207711_10106356 3300025941 Bacteria 2489
234 Ga0207711_10340664 3300025941 Bacteria 1388
235 Ga0207689_11054224 3300025942 Unclassified 686
236 Ga0207689_11414294 3300025942 Unclassified 583
237 Ga0207667_10635578 3300025949 Bacteria 1074
238 Ga0207667_11164533 3300025949 Bacteria 752
239 Ga0207651_10215342 3300025960 Bacteria 1549
240 Ga0207712_10723872 3300025961 Bacteria 870
241 Ga0207712_11181395 3300025961 Unclassified 682
242 Ga0207668_10948998 3300025972 Unclassified 767
243 Ga0207640_10030375 3300025981 Bacteria 3327
244 Ga0207640_11424159 3300025981 Unclassified 621
245 Ga0207658_10128459 3300025986 Bacteria 2032
246 Ga0207677_10096331 3300026023 Bacteria 2165
247 Ga0207703_10190582 3300026035 Bacteria 1816
248 Ga0207703_10329324 3300026035 Bacteria 1401
249 Ga0207703_11252409 3300026035 Bacteria 713
250 Ga0207703_11362182 3300026035 Bacteria 682
251 Ga0207639_10072204 3300026041 Bacteria 2702
252 Ga0207708_10270660 3300026075 Unclassified 1374
253 Ga0207708_10935304 3300026075 Unclassified 751
254 Ga0207641_10080727 3300026088 Bacteria 2822
255 Ga0207648_10367478 3300026089 Bacteria 1299
256 Ga0207648_11638765 3300026089 Unclassified 604
257 Ga0207676_12279519 3300026095 Unclassified 539
258 Ga0207675_100135339 3300026118 Bacteria 2338
259 Ga0207675_100146397 3300026118 Unclassified 2246
260 Ga0207675_100372225 3300026118 Bacteria 1403
261 Ga0207675_100757417 3300026118 Bacteria 983
262 Ga0207675_101029713 3300026118 Bacteria 842
263 Ga0207428_10039333 3300027907 Bacteria 3841
264 Ga0207428_10193422 3300027907 Bacteria 1533
265 Ga0265356_1002114 3300028017 Unclassified 2722
266 Ga0265356_1032918 3300028017 Unclassified 565
267 Ga0268265_10121895 3300028380 Bacteria 2149
268 Ga0268265_11338241 3300028380 Unclassified 717
269 Ga0268264_10834681 3300028381 Bacteria 922
270 Ga0268264_10969844 3300028381 Bacteria 856
271 Ga0268264_11270119 3300028381 Unclassified 746
272 Ga0268264_12162182 3300028381 Unclassified 565
273 Ga0265762_1000189 3300030760 Bacteria 9705
274 Ga0265760_10004377 3300031090 Unclassified 4057
275 Ga0265760_10060226 3300031090 Unclassified 1153
276 Ga0307408_100014378 3300031548 Bacteria 5258
277 Ga0307416_102367893 3300032002 Bacteria 631
278 Ga0316215_1024521 3300033544 Unclassified 618
279 Ga0373930_0000186 3300034816 Bacteria 7447
280 Ga0373948_0002545 3300034817 Unclassified 2709
281 Ga0373948_0062561 3300034817 Unclassified 820
282 Ga0373959_0003342 3300034820 Bacteria 2552
283 Ga0373938_0004405 3300034957 Bacteria 2351
284 Ga0373928_0000253 3300035084 Bacteria 10583
285 Ga0373929_0000671 3300035085 Bacteria 6596
286 Ga0373940_0000431 3300035088 Bacteria 6406
287 Ga0373940_0206346 3300035088 Unclassified 648
288 Ga0373949_0000409 3300035090 Bacteria 14941
289 Ga0373951_0000502 3300035091 Bacteria 11138
290 Ga0373951_0093376 3300035091 Bacteria 792
291 Ga0373952_0000087 3300035092 Bacteria 12383
292 Ga0373932_0004452 3300035112 Bacteria 3311
293 Ga0373939_0000279 3300035114 Bacteria 13565
294 Ga0373939_0048523 3300035114 Bacteria 1309
295 Ga0373939_0326284 3300035114 Unclassified 618
296 Ga0373941_0000107 3300035115 Bacteria 14073
297 Ga0373941_0185709 3300035115 Unclassified 783
298 Ga0373960_0037621 3300035121 Bacteria 1383
299 Ga0373943_0977517 3300035170 Bacteria 507
300 Ga0373955_0227922 3300035172 Bacteria 1114
301 Ga0373942_0000509 3300035207 Bacteria 10928
302 Ga0373961_0001090 3300035241 Bacteria 8646
303 Ga0373962_0139044 3300035242 Bacteria 787
304 Ga0373931_0001618 3300035691 Bacteria 9749
305 Ga0373931_0050758 3300035691 Unclassified 2208
306 Ga0373935_0853948 3300035692 Unclassified 673
307 Ga0373925_0061551 3300037068 Bacteria 2820
308 Ga0453683_0577418 3300044673 Unclassified 732
309 Ga0451576_0025245 3300045051 Bacteria 6404
310 Ga0451576_0280332 3300045051 Bacteria 1743
311 Ga0495592_0075239 3300046454 Unclassified 2452
312 Ga0495651_0000023 3300046462 Bacteria 116915
313 Ga0495653_0367346 3300046463 Unclassified 922
314 Ga0495653_0869240 3300046463 Unclassified 539
315 Ga0495580_0449375 3300046472 Unclassified 865
316 Ga0495608_0626538 3300046511 Unclassified 644
317 Ga0495628_0003234 3300046516 Bacteria 14600
318 Ga0495630_0097801 3300046517 Unclassified 2220
319 Ga0495663_0214072 3300046525 Unclassified 676
320 Ga0495587_0023731 3300046536 Bacteria 3768
321 Ga0495645_0304322 3300046543 Unclassified 1040
322 Ga0495667_0001010 3300046559 Bacteria 18263
323 Ga0495667_0101891 3300046559 Bacteria 1857
324 Ga0495656_0324745 3300046615 Unclassified 793
325 Ga0495657_0009090 3300046675 Bacteria 7552
326 Ga0495623_0079914 3300046679 Unclassified 2025
327 Ga0495646_0107295 3300046680 Unclassified 1593
328 Ga0495669_0535724 3300046684 Unclassified 570
329 Ga0495613_0035462 3300046689 Unclassified 3702
330 Ga0495600_0029182 3300046809 Unclassified 3570
331 Ga0495604_0071520 3300047317 Unclassified 2624
332 Ga0495604_0531418 3300047317 Unclassified 760
333 Ga0495680_0001474 3300047322 Bacteria 25380
334 Ga0495680_0155300 3300047322 Unclassified 1665
335 Ga0495675_0007054 3300047444 Bacteria 6912
336 Ga0495677_0083991 3300047445 Unclassified 1196
337 Ga0495684_0004146 3300047471 Bacteria 11320
338 Ga0495602_0053024 3300048088 Bacteria 3595
339 Ga0496102_0565255 3300048905 Unclassified 1060
340 Ga0496102_0820525 3300048905 Bacteria 852
341 Ga0496103_0322844 3300048906 Unclassified 993
342 Ga0496106_0103794 3300048909 Bacteria 2207
343 Ga0496106_0341779 3300048909 Bacteria 1202
344 Ga0496106_0365620 3300048909 Bacteria 1159
345 Ga0496106_0657937 3300048909 Bacteria 837
346 Ga0496107_0183518 3300048910 Bacteria 1554
347 Ga0496107_0219611 3300048910 Bacteria 1414
348 Ga0496107_0275731 3300048910 Bacteria 1252
349 Ga0496108_0377065 3300048911 Bacteria 1239
350 Ga0496109_0834407 3300048912 Bacteria 860
351 Ga0496112_0248342 3300048915 Archaea 1731
352 Ga0496112_1396050 3300048915 Bacteria 615
353 Ga0501040_0197004 3300049576 Unclassified 1430
354 Ga0501042_0573285 3300049578 Bacteria 820
355 nmdc:mga05p37_1585453_c1 3300050507 Bacteria 646
356 nmdc:mga05p37_1597276_c1 3300050507 Unclassified 643
357 nmdc:mga05p37_19649_c2 3300050507 Bacteria 6564
358 nmdc:mga05p37_211392_c1 3300050507 Bacteria 2345
359 nmdc:mga05p37_42241_c1 3300050507 Bacteria 5601
360 nmdc:mga09592_172112_c1 3300050508 Bacteria 1872
361 nmdc:mga09592_382673_c1 3300050508 Bacteria 1217
362 nmdc:mga09592_730158_c1 3300050508 Bacteria 841
363 nmdc:mga09592_975219_c1 3300050508 Bacteria 709
364 nmdc:mga0qj67_452175_c1 3300050509 Bacteria 1035
365 nmdc:mga08y16_1153038_c1 3300050511 Bacteria 748
366 nmdc:mga08y16_252965_c1 3300050511 Bacteria 1820
367 nmdc:mga08y16_57785_c1 3300050511 Bacteria 4053
368 nmdc:mga0n895_1148_c1 3300050512 Bacteria 19397
369 nmdc:mga0n895_1288004_c1 3300050512 Bacteria 702
370 nmdc:mga0n895_154469_c1 3300050512 Unclassified 2325
371 nmdc:mga0n895_251863_c1 3300050512 Bacteria 1792
372 nmdc:mga0n895_822576_c1 3300050512 Unclassified 918
373 nmdc:mga0rr50_176166_c1 3300050513 Bacteria 1745
374 nmdc:mga0rr50_18907_c1 3300050513 Bacteria 4640
375 nmdc:mga0rr50_21_c1 3300050513 Bacteria 125964
376 nmdc:mga0rr50_59457_c1 3300050513 Unclassified 2870
377 nmdc:mga0rr50_634817_c1 3300050513 Bacteria 911
378 nmdc:mga08x19_26711_c1 3300050514 Bacteria 3604
379 nmdc:mga08x19_568653_c1 3300050514 Bacteria 803
380 nmdc:mga08x19_96_c1 3300050514 Bacteria 77610
381 nmdc:mga0a205_138043_c1 3300050515 Unclassified 2338
382 Ga0075428_100887617
383 LJNas_1001228
384 Ga0065715_10499679
385 Ga0065715_10848202
386 Ga0070690_100031159
387 Ga0070690_100137810
388 Ga0070690_100222239
389 Ga0070690_101253120
390 Ga0068869_101712577
391 Ga0070666_10211182
392 Ga0070689_100033472
393 Ga0070687_100003245
394 Ga0070687_100117939
395 Ga0070668_100211993
396 Ga0070668_100279586
397 Ga0070669_100001386
398 Ga0070669_100023607
399 Ga0070675_100159636
400 Ga0070671_100141348
401 Ga0070674_100069504
402 Ga0070673_100262505
403 Ga0070673_101296361
404 Ga0070688_100207782
405 Ga0070667_100113226
406 Ga0070714_101105876
407 Ga0070713_100009433
408 Ga0070713_100041476
409 Ga0070710_11200083
410 Ga0070701_10409095
411 Ga0070700_100507130
412 Ga0070700_100985930
413 Ga0070700_101129671
414 Ga0070694_100176427
415 Ga0070694_100237620
416 Ga0070694_101611077
417 Ga0070708_100255754
418 Ga0070708_101171862
419 Ga0070678_101423077
420 Ga0070662_100152075
421 Ga0070662_100373205
422 Ga0070662_100689459
423 Ga0068867_100030644
424 Ga0068867_100247806
425 Ga0070685_11403393
426 Ga0070706_100506549
427 Ga0070706_100846830
428 Ga0070707_100067817
429 Ga0070707_100111657
430 Ga0070707_100314904
431 Ga0070707_100627129
432 Ga0070707_100771367
433 Ga0070698_100246343
434 Ga0070698_100819315
435 Ga0070697_100071329
436 Ga0070697_100142693
437 Ga0070697_100244561
438 Ga0070697_100265769
439 Ga0070697_100679452
440 Ga0068853_101541118
441 Ga0070672_100019642
442 Ga0070686_100010326
443 Ga0070686_100070486
444 Ga0070686_101169526
445 Ga0070695_100052452
446 Ga0070695_100067488
447 Ga0070695_100538711
448 Ga0070696_100208018
449 Ga0070696_101236504
450 Ga0070693_100033743
451 Ga0070704_100024532
452 Ga0070704_100031793
453 Ga0070704_100146853
454 Ga0070704_100233593
455 Ga0070704_100321421
456 Ga0070704_100462197
457 Ga0068855_100769917
458 Ga0068859_100368370
459 Ga0068859_100441248
460 Ga0068859_100663343
461 Ga0068859_100778496
462 Ga0068866_10031911
463 Ga0068861_100024352
464 Ga0068861_100080794
465 Ga0068861_101108323
466 Ga0068863_100030141
467 Ga0068863_100123902
468 Ga0068858_100191612
469 Ga0068858_100443056
470 Ga0068858_100865827
471 Ga0068858_100885518
472 Ga0068858_101705895
473 Ga0068860_100026216
474 Ga0068860_100315492
475 Ga0068862_100001051
476 Ga0068862_100480908
477 Ga0068862_100818601
478 Ga0068862_101149136
479 Ga0068862_101286176
480 Ga0081455_10017994
481 Ga0081455_10507633
482 Ga0070717_10047729
483 Ga0070717_10071880
484 Ga0070715_10258068
485 Ga0070712_100056387
486 Ga0070712_100134039
487 Ga0070712_100215974
488 Ga0097621_100249859
489 Ga0068871_100128149
490 Ga0068871_100440122
491 Ga0075428_100764616
492 Ga0075431_101905195
493 Ga0075433_10052297
494 Ga0075433_10358340
495 Ga0075433_10852566
496 Ga0075433_10865512
497 Ga0075434_100167291
498 Ga0075434_101543127
499 Ga0075434_101629170
500 Ga0075429_100208394
501 Ga0075429_100261961
502 Ga0075429_100803290
503 Ga0068865_100046808
504 Ga0068865_101023605
505 Ga0075436_100000797
506 Ga0075436_100135394
507 Ga0075436_100493318
508 Ga0075436_100871343
509 Ga0075436_100929636
510 Ga0097620_100368336
511 Ga0097620_100441239
512 Ga0097620_100595224
513 Ga0097620_100663341
514 Ga0097620_100778603
515 Ga0075435_100000031
516 Ga0075435_100077261
517 Ga0075435_100116702
518 Ga0075435_100385889
519 Ga0075435_100431234
520 Ga0099794_10662525
521 Ga0099795_10022404
522 Ga0105240_10251397
523 Ga0105240_10434904
524 Ga0111539_10139701
525 Ga0111539_10685772
526 Ga0111539_11800234
527 Ga0105245_11085159
528 Ga0105245_11658379
529 Ga0105245_12076767
530 Ga0114129_10013707
531 Ga0114129_10062895
532 Ga0114129_10465726
533 Ga0114129_10596796
534 Ga0114129_10802178
535 Ga0114129_11320102
536 Ga0114129_12073581
537 Ga0105243_10010837
538 Ga0105243_11268034
539 Ga0105243_12151966
540 Ga0105243_12754011
541 Ga0105243_13093382
542 Ga0105242_10197043
543 Ga0105242_11239899
544 Ga0105242_12024337
545 Ga0105248_10088767
546 Ga0105248_10126742
547 Ga0105248_10651267
548 Ga0105248_10728263
549 Ga0105248_10816306
550 Ga0105248_10834267
551 Ga0105249_10561926
552 Ga0105249_11679187
553 Ga0105249_13077576
554 Ga0099796_10162691
555 Ga0157323_1015874
556 Ga0157378_10458195
557 Ga0157378_11875261
558 Ga0163162_10485290
559 Ga0163162_10984019
560 Ga0157375_10733951
561 Ga0157380_10094457
562 Ga0157380_10717118
563 Ga0157379_10046699
564 Ga0157376_11802720
565 Ga0163161_10373219
566 Ga0224572_1021003
567 Ga0228598_1000071
568 Ga0228598_1016098
569 Ga0228598_1046640
570 Ga0207692_10232589
571 Ga0207692_10914755
572 Ga0207642_10886529
573 Ga0207680_10003036
574 Ga0207680_10840734
575 Ga0207680_10895772
576 Ga0207685_10524054
577 Ga0207699_10270953
578 Ga0207684_10207894
579 Ga0207684_11532037
580 Ga0207695_10342331
581 Ga0207693_10771480
582 Ga0207663_10569880
583 Ga0207662_10005780
584 Ga0207662_10087487
585 Ga0207646_10122012
586 Ga0207646_10181178
587 Ga0207646_10524081
588 Ga0207646_10562717
589 Ga0207681_10008953
590 Ga0207681_10353949
591 Ga0207681_10805939
592 Ga0207700_10015211
593 Ga0207700_10697588
594 Ga0207664_10062289
595 Ga0207664_10099510
596 Ga0207644_10022640
597 Ga0207690_10865631
598 Ga0207706_10130431
599 Ga0207706_10357575
600 Ga0207706_10409055
601 Ga0207706_10726552
602 Ga0207686_10057987
603 Ga0207686_11445061
604 Ga0207709_10334540
605 Ga0207709_11723334
606 Ga0207670_10198500
607 Ga0207669_10283581
608 Ga0207704_10868536
609 Ga0207665_11033827
610 Ga0207665_11305070
611 Ga0207691_10025381
612 Ga0207711_10022738
613 Ga0207711_10098961
614 Ga0207711_10106356
615 Ga0207711_10340664
616 Ga0207689_11054224
617 Ga0207689_11414294
618 Ga0207667_10635578
619 Ga0207667_11164533
620 Ga0207651_10215342
621 Ga0207712_10723872
622 Ga0207712_11181395
623 Ga0207668_10948998
624 Ga0207640_10030375
625 Ga0207640_11424159
626 Ga0207658_10128459
627 Ga0207677_10096331
628 Ga0207703_10190582
629 Ga0207703_10329324
630 Ga0207703_11252409
631 Ga0207703_11362182
632 Ga0207639_10072204
633 Ga0207708_10270660
634 Ga0207708_10935304
635 Ga0207641_10080727
636 Ga0207648_10367478
637 Ga0207648_11638765
638 Ga0207676_12279519
639 Ga0207675_100135339
640 Ga0207675_100146397
641 Ga0207675_100372225
642 Ga0207675_100757417
643 Ga0207675_101029713
644 Ga0207428_10039333
645 Ga0207428_10193422
646 Ga0265356_1002114
647 Ga0265356_1032918
648 Ga0268265_10121895
649 Ga0268265_11338241
650 Ga0268264_10834681
651 Ga0268264_10969844
652 Ga0268264_11270119
653 Ga0268264_12162182
654 Ga0265762_1000189
655 Ga0265760_10004377
656 Ga0265760_10060226
657 Ga0307408_100014378
658 Ga0307416_102367893
659 Ga0316215_1024521
660 Ga0373930_0000186
661 Ga0373948_0002545
662 Ga0373948_0062561
663 Ga0373959_0003342
664 Ga0373938_0004405
665 Ga0373928_0000253
666 Ga0373929_0000671
667 Ga0373940_0000431
668 Ga0373940_0206346
669 Ga0373949_0000409
670 Ga0373951_0000502
671 Ga0373951_0093376
672 Ga0373952_0000087
673 Ga0373932_0004452
674 Ga0373939_0000279
675 Ga0373939_0048523
676 Ga0373939_0326284
677 Ga0373941_0000107
678 Ga0373941_0185709
679 Ga0373960_0037621
680 Ga0373943_0977517
681 Ga0373955_0227922
682 Ga0373942_0000509
683 Ga0373961_0001090
684 Ga0373962_0139044
685 Ga0373931_0001618
686 Ga0373931_0050758
687 Ga0373935_0853948
688 Ga0373925_0061551
689 Ga0453683_0577418
690 Ga0451576_0025245
691 Ga0451576_0280332
692 Ga0495592_0075239
693 Ga0495651_0000023
694 Ga0495653_0367346
695 Ga0495653_0869240
696 Ga0495580_0449375
697 Ga0495608_0626538
698 Ga0495628_0003234
699 Ga0495630_0097801
700 Ga0495663_0214072
701 Ga0495587_0023731
702 Ga0495645_0304322
703 Ga0495667_0001010
704 Ga0495667_0101891
705 Ga0495656_0324745
706 Ga0495657_0009090
707 Ga0495623_0079914
708 Ga0495646_0107295
709 Ga0495669_0535724
710 Ga0495613_0035462
711 Ga0495600_0029182
712 Ga0495604_0071520
713 Ga0495604_0531418
714 Ga0495680_0001474
715 Ga0495680_0155300
716 Ga0495675_0007054
717 Ga0495677_0083991
718 Ga0495684_0004146
719 Ga0495602_0053024
720 Ga0496102_0565255
721 Ga0496102_0820525
722 Ga0496103_0322844
723 Ga0496106_0103794
724 Ga0496106_0341779
725 Ga0496106_0365620
726 Ga0496106_0657937
727 Ga0496107_0183518
728 Ga0496107_0219611
729 Ga0496107_0275731
730 Ga0496108_0377065
731 Ga0496109_0834407
732 Ga0496112_0248342
733 Ga0496112_1396050
734 Ga0501040_0197004
735 Ga0501042_0573285
736 nmdc:mga05p37_1585453_c1
737 nmdc:mga05p37_1597276_c1
738 nmdc:mga05p37_19649_c2
739 nmdc:mga05p37_211392_c1
740 nmdc:mga05p37_42241_c1
741 nmdc:mga09592_172112_c1
742 nmdc:mga09592_382673_c1
743 nmdc:mga09592_730158_c1
744 nmdc:mga09592_975219_c1
745 nmdc:mga0qj67_452175_c1
746 nmdc:mga08y16_1153038_c1
747 nmdc:mga08y16_252965_c1
748 nmdc:mga08y16_57785_c1
749 nmdc:mga0n895_1148_c1
750 nmdc:mga0n895_1288004_c1
751 nmdc:mga0n895_154469_c1
752 nmdc:mga0n895_251863_c1
753 nmdc:mga0n895_822576_c1
754 nmdc:mga0rr50_176166_c1
755 nmdc:mga0rr50_18907_c1
756 nmdc:mga0rr50_21_c1
757 nmdc:mga0rr50_59457_c1
758 nmdc:mga0rr50_634817_c1
759 nmdc:mga08x19_26711_c1
760 nmdc:mga08x19_568653_c1
761 nmdc:mga08x19_96_c1
762 nmdc:mga0a205_138043_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
8e06-assembly1.cif.gz_A symmetry expansion of dimeric lrrk1 0.7825 9 68
5unb-assembly1.cif.gz_A crystal structure of putative putative deoxyribonuclease-2 from burkholderia thailandensis in complex with copper 0.7283 8 29
6gug-assembly1.cif.gz_A siderophore hydrolase estb mutant s148a from aspergillus fumigatus 0.7282 11 28
6gur-assembly1.cif.gz_B siderophore hydrolase estb from aspergillus fumigatus in complex with tafc 0.7235 11 28
6gui-assembly1.cif.gz_B siderophore hydrolase estb mutant h267n from aspergillus fumigatus 0.7129 11 28
ID Description Score Start End Superfamily
af_O49316_48_291_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8774 9 26 2.130.10.10
af_F1QVS9_72_265_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8513 11 68 2.130.10.10
af_A0A0R0E3J7_169_305_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8464 12 70 2.130.10.10
af_A0A1D6E1H8_262_490_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8206 12 70 2.130.10.10
af_A0A1D8PQF7_20_323_2.130.10.10 Mainly Beta;7 Propeller;Methylamine Dehydrogenase; Chain H;YVTN repeat-like/Quinoprotein amine dehydrogenase 0.8147 7 67 2.130.10.10
ID Description Score Start End GO Terms
AF-A0A2V8Y5R5-F1-model_v4 Response regulatory domain-containing protein 0.9244 1 105
AF-A0A2V8Y5R5-F1-model_v4 Response regulatory domain-containing protein 0.916 1 105
AF-A0A7X2P8A4-F1-model_v4 Uncharacterized protein 0.8711 8 89
AF-A0A2V8F9F5-F1-model_v4 Uncharacterized protein 0.8274 4 105
AF-A0A0S8KYB8-F1-model_v4 Uncharacterized protein 0.8219 4 88

Map