F428897

General Info

Members Datasets Scaffolds Average Seq Length
381 234 762 201

Family's Representative Sequence

Representative Sequence 3300005456|Ga0070678_100134452|Ga0070678_1001344522
Length 234
Sequence MRRRAAGGTSRAGRRRRTPLEVRPAPYGVVVASTTRRGRRPGSPDTRAAILTEARTLFAAQGYAGTSVRAVAAAAGVDAALVHHYFGTKDDLFLAAMELPFDPRHVIGPALAGGPDGAGERLLRAFLSLWDDPEIAPVLVGIVRSALQPGGERLLTQGFVPVVLLPVGEALGIDRPDLRMPLVISQVAGLILTRYVIGLEPIASMPAETVVSTYAPVIQHFLTGDLSNGTKSVK

Samples

Sample ID Description Type Environment
1 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
9 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
10 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
13 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
23 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
24 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
25 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
26 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
27 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
28 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
29 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
30 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
31 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
32 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
33 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
34 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
36 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
37 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
38 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
39 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
40 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
45 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
48 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
49 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
50 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
51 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
52 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
53 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
54 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
55 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
56 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
57 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
58 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
59 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
60 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
61 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
62 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
63 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
64 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
96 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
97 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
98 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
99 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
100 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
101 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
102 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
103 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
104 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
105 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
106 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
107 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
108 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
109 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
110 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
111 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
112 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
113 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
114 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
115 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
116 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
117 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
118 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
119 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
120 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
121 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
122 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
123 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
124 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
125 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
126 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
127 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
128 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
129 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
130 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
131 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
132 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
133 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
134 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
135 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
136 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
137 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
138 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
139 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
140 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
141 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
142 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
143 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
144 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
145 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
146 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
147 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
148 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
149 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
150 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
151 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
152 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
153 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
154 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
155 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
156 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
157 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
158 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
159 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
160 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
161 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
162 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
163 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
164 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
165 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
166 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
167 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
168 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
169 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
170 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
171 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
172 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
173 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
174 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
175 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
176 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
177 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
178 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
179 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
180 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
181 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
182 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
183 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
184 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
185 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
186 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
187 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
188 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
189 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
190 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
191 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
192 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
193 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
194 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
195 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
196 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
199 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
200 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
201 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
202 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
203 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
204 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
207 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
208 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
209 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
210 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
211 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
214 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
215 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
216 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
217 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
218 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
219 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
220 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
221 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
222 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
223 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
224 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
225 2643221615 Nocardioides sp. Root224 Isolate Unclassified
226 2643221641 Nocardioides sp. Root122 Isolate Unclassified
227 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
228 2738541274 Mycobacterium sp. YR708 Isolate Unclassified
229 2738543028 Mycobacterium sp. YR782 Isolate Unclassified
230 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
231 2808606448 Streptomyces sp. 193411 Isolate Unclassified
232 2862574272 Streptomyces sp. AcE210 Isolate Nodule
233 2867369537 Streptomyces sp. Z26 Isolate Unclassified
234 2902799365 Mycolicibacterium sp. P1-5 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 97.11
Metatranscriptomes 0
Isolates 2.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.5
Nodule 0.26
Rhizoplane 11.02
Rhizosphere 71.39
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070678_100134452 3300005456 Bacteria 1970
2 JGI24739J22299_10066949 3300001989 Bacteria 1124
3 JGI24735J21928_10065173 3300002067 Bacteria 1046
4 Ga0070658_10009812 3300005327 Bacteria 7692
5 Ga0070683_100005185 3300005329 Bacteria 10845
6 Ga0070683_100132879 3300005329 Bacteria 2355
7 Ga0070683_100456708 3300005329 Bacteria 1219
8 Ga0070690_100100049 3300005330 Bacteria 1921
9 Ga0070682_100001202 3300005337 Bacteria 14749
10 Ga0068868_100168278 3300005338 Bacteria 1814
11 Ga0068868_100619047 3300005338 Bacteria 961
12 Ga0070660_100014545 3300005339 Bacteria 5673
13 Ga0070691_10304709 3300005341 Bacteria 871
14 Ga0070661_100195904 3300005344 Bacteria 1542
15 Ga0070692_10181676 3300005345 Bacteria 1219
16 Ga0070668_100171634 3300005347 Bacteria 1766
17 Ga0070675_100206557 3300005354 Bacteria 1706
18 Ga0070673_100381754 3300005364 Bacteria 1256
19 Ga0070659_100004980 3300005366 Bacteria 9509
20 Ga0070667_100146395 3300005367 Bacteria 2072
21 Ga0070667_100316275 3300005367 Bacteria 1408
22 Ga0070667_100709500 3300005367 Bacteria 931
23 Ga0070700_100703348 3300005441 Bacteria 804
24 Ga0070663_100579659 3300005455 Bacteria 941
25 Ga0070678_100332955 3300005456 Bacteria 1300
26 Ga0070684_100008100 3300005535 Bacteria 8204
27 Ga0070684_101215919 3300005535 Bacteria 709
28 Ga0068853_100174750 3300005539 Bacteria 1945
29 Ga0070695_100515021 3300005545 Bacteria 927
30 Ga0070693_100113860 3300005547 Bacteria 1668
31 Ga0070665_100029885 3300005548 Bacteria 5484
32 Ga0070664_100009098 3300005564 Bacteria 8062
33 Ga0068857_100454378 3300005577 Bacteria 1198
34 Ga0068856_100111500 3300005614 Bacteria 2733
35 Ga0068856_100877331 3300005614 Bacteria 916
36 Ga0070702_100294262 3300005615 Bacteria 1120
37 Ga0068859_100176571 3300005617 Bacteria 2218
38 Ga0068859_101429449 3300005617 Bacteria 763
39 Ga0068864_100039240 3300005618 Bacteria 4047
40 Ga0068864_100506921 3300005618 Bacteria 1162
41 Ga0068861_100131848 3300005719 Bacteria 2029
42 Ga0068861_100188684 3300005719 Bacteria 1722
43 Ga0068861_101181760 3300005719 Bacteria 739
44 Ga0068858_100955735 3300005842 Bacteria 839
45 Ga0068860_100000742 3300005843 Bacteria 37185
46 Ga0068860_100033883 3300005843 Bacteria 4899
47 Ga0068860_100625970 3300005843 Bacteria 1083
48 Ga0081455_10080909 3300005937 Bacteria 2662
49 Ga0070717_10450883 3300006028 Bacteria 1159
50 Ga0075365_10027106 3300006038 Bacteria 3642
51 Ga0075365_10041939 3300006038 Bacteria 2990
52 Ga0075365_10103223 3300006038 Bacteria 1954
53 Ga0075365_10138463 3300006038 Bacteria 1688
54 Ga0075365_10193754 3300006038 Bacteria 1423
55 Ga0075365_10301107 3300006038 Bacteria 1128
56 Ga0075368_10000043 3300006042 Bacteria 29599
57 Ga0075368_10062616 3300006042 Bacteria 1491
58 Ga0075363_100143765 3300006048 Bacteria 1344
59 Ga0075364_10023137 3300006051 Bacteria 3931
60 Ga0075364_10049790 3300006051 Bacteria 2733
61 Ga0075364_10394772 3300006051 Bacteria 944
62 Ga0075367_10005681 3300006178 Bacteria 6226
63 Ga0075367_10232327 3300006178 Bacteria 1155
64 Ga0075369_10169891 3300006186 Bacteria 1001
65 Ga0097621_100035959 3300006237 Bacteria 3959
66 Ga0075370_10098362 3300006353 Bacteria 1692
67 Ga0068865_100012674 3300006881 Bacteria 5312
68 Ga0068865_100636743 3300006881 Bacteria 905
69 Ga0097620_100176572 3300006931 Bacteria 2218
70 Ga0097620_101429713 3300006931 Bacteria 763
71 Ga0105245_10001483 3300009098 Bacteria 21204
72 Ga0105245_10386640 3300009098 Bacteria 1395
73 Ga0105245_10604308 3300009098 Bacteria 1124
74 Ga0105245_11057090 3300009098 Bacteria 857
75 Ga0105243_10045080 3300009148 Bacteria 3463
76 Ga0105243_10086643 3300009148 Bacteria 2569
77 Ga0105242_10052882 3300009176 Bacteria 3315
78 Ga0105242_10250347 3300009176 Bacteria 1596
79 Ga0105242_10504836 3300009176 Bacteria 1151
80 Ga0105237_10002337 3300009545 Bacteria 23560
81 Ga0105237_10488004 3300009545 Bacteria 1238
82 Ga0105238_10216671 3300009551 Bacteria 1890
83 Ga0105238_10277581 3300009551 Bacteria 1657
84 Ga0105249_10010362 3300009553 Bacteria 8192
85 Ga0105249_10088241 3300009553 Bacteria 2896
86 Ga0105249_10485378 3300009553 Bacteria 1279
87 Ga0105239_10002737 3300010375 Bacteria 22134
88 Ga0105239_10081102 3300010375 Bacteria 3571
89 Ga0105246_10216556 3300011119 Bacteria 1498
90 Ga0157371_10236241 3300013102 Bacteria 1314
91 Ga0157374_10687832 3300013296 Bacteria 1035
92 Ga0163162_10013741 3300013306 Bacteria 7907
93 Ga0157372_10006340 3300013307 Bacteria 12585
94 Ga0157375_10052930 3300013308 Bacteria 3993
95 Ga0157375_10158827 3300013308 Bacteria 2402
96 Ga0157375_10163372 3300013308 Bacteria 2370
97 Ga0157375_10350873 3300013308 Bacteria 1641
98 Ga0157375_10715483 3300013308 Bacteria 1154
99 Ga0157375_10752389 3300013308 Bacteria 1126
100 Ga0163163_10051423 3300014325 Bacteria 4063
101 Ga0163163_10561366 3300014325 Bacteria 1204
102 Ga0157377_10506065 3300014745 Bacteria 845
103 Ga0157379_10023774 3300014968 Bacteria 5440
104 Ga0157376_10177995 3300014969 Bacteria 1942
105 Ga0157376_10260964 3300014969 Bacteria 1623
106 Ga0163161_10013984 3300017792 Bacteria 5589
107 Ga0207697_10177544 3300025315 Bacteria 933
108 Ga0207688_10110612 3300025901 Bacteria 1594
109 Ga0207647_10123141 3300025904 Bacteria 1528
110 Ga0207705_10072056 3300025909 Bacteria 2505
111 Ga0207657_10018682 3300025919 Bacteria 6608
112 Ga0207649_10138804 3300025920 Bacteria 1660
113 Ga0207687_10024051 3300025927 Bacteria 4065
114 Ga0207687_10553337 3300025927 Bacteria 965
115 Ga0207687_10574992 3300025927 Bacteria 947
116 Ga0207690_10084380 3300025932 Bacteria 2226
117 Ga0207686_10344602 3300025934 Bacteria 1120
118 Ga0207686_10750215 3300025934 Bacteria 779
119 Ga0207709_10145555 3300025935 Bacteria 1634
120 Ga0207669_10449397 3300025937 Bacteria 1021
121 Ga0207704_10283943 3300025938 Bacteria 1260
122 Ga0207711_10411200 3300025941 Bacteria 1258
123 Ga0207661_10008128 3300025944 Bacteria 7486
124 Ga0207679_10023490 3300025945 Bacteria 4218
125 Ga0207712_10025684 3300025961 Bacteria 3916
126 Ga0207712_10081389 3300025961 Bacteria 2358
127 Ga0207668_10335883 3300025972 Bacteria 1259
128 Ga0207658_10310218 3300025986 Bacteria 1362
129 Ga0207658_10375210 3300025986 Bacteria 1244
130 Ga0207677_10105195 3300026023 Bacteria 2088
131 Ga0207677_10157453 3300026023 Bacteria 1761
132 Ga0207703_10031739 3300026035 Bacteria 4178
133 Ga0207639_10268587 3300026041 Bacteria 1495
134 Ga0207678_10271904 3300026067 Bacteria 1453
135 Ga0207678_10505425 3300026067 Bacteria 1054
136 Ga0207708_10689877 3300026075 Bacteria 872
137 Ga0207702_10090415 3300026078 Bacteria 2679
138 Ga0207641_10599670 3300026088 Bacteria 1078
139 Ga0207676_10052082 3300026095 Bacteria 3198
140 Ga0207674_10812195 3300026116 Bacteria 902
141 Ga0207675_100164489 3300026118 Bacteria 2118
142 Ga0207675_100838068 3300026118 Bacteria 934
143 Ga0207683_10048414 3300026121 Bacteria 3722
144 Ga0207683_10160185 3300026121 Bacteria 2034
145 Ga0268266_10007263 3300028379 Bacteria 10015
146 Ga0268266_10118814 3300028379 Bacteria 2350
147 Ga0268264_10000651 3300028381 Bacteria 40986
148 Ga0268264_10100666 3300028381 Bacteria 2510
149 Ga0268264_10546899 3300028381 Bacteria 1135
150 Ga0307515_10188501 3300028794 Bacteria 1982
151 Ga0307512_10135353 3300030522 Bacteria 1528
152 Ga0307513_10094827 3300031456 Bacteria 3027
153 Ga0307508_10096804 3300031616 Bacteria 2543
154 Ga0307413_10405589 3300031824 Bacteria 1069
155 Ga0307518_10018003 3300031838 Bacteria 5063
156 Ga0307406_10261734 3300031901 Bacteria 1309
157 Ga0307406_10638407 3300031901 Bacteria 882
158 Ga0307407_10055709 3300031903 Bacteria 2286
159 Ga0307407_10131917 3300031903 Bacteria 1600
160 Ga0307412_10359375 3300031911 Bacteria 1172
161 Ga0307409_100023211 3300031995 Bacteria 4293
162 Ga0307409_100048434 3300031995 Bacteria 3234
163 Ga0307409_100276025 3300031995 Bacteria 1551
164 Ga0307416_100001543 3300032002 Bacteria 12592
165 Ga0307416_100095447 3300032002 Bacteria 2568
166 Ga0307415_100000142 3300032126 Bacteria 31723
167 Ga0307415_100321442 3300032126 Bacteria 1290
168 Ga0373925_0770513 3300037068 Bacteria 793
169 Ga0436365_0184594 3300039437 Bacteria 2608
170 Ga0451793_0233002 3300041452 Bacteria 747
171 Ga0451793_0726904 3300041452 Bacteria 687
172 Ga0451853_1389941 3300041512 Bacteria 975
173 Ga0466972_0001718 3300044658 Bacteria 10747
174 Ga0466965_0003543 3300044683 Bacteria 6860
175 Ga0466966_0333164 3300044684 Bacteria 912
176 Ga0466961_0008713 3300044693 Bacteria 6465
177 Ga0466961_0023422 3300044693 Bacteria 3973
178 Ga0466963_0011484 3300044694 Bacteria 5395
179 Ga0466963_0047581 3300044694 Bacteria 2831
180 Ga0466970_0009620 3300044765 Bacteria 4890
181 Ga0466970_0142547 3300044765 Bacteria 1320
182 Ga0466960_0044840 3300044901 Bacteria 2110
183 Ga0466967_0019941 3300045976 Bacteria 5405
184 Ga0466967_0020574 3300045976 Bacteria 5338
185 Ga0466967_0129544 3300045976 Bacteria 2340
186 Ga0466967_0750874 3300045976 Bacteria 967
187 Ga0495627_019843 3300046453 Bacteria 2248
188 Ga0495603_0024223 3300046455 Bacteria 3670
189 Ga0495603_0035525 3300046455 Bacteria 2993
190 Ga0495603_0063709 3300046455 Bacteria 2174
191 Ga0495603_0202581 3300046455 Bacteria 1147
192 Ga0495629_0320556 3300046459 Bacteria 1059
193 Ga0495638_0025774 3300046460 Bacteria 3817
194 Ga0495638_0091705 3300046460 Bacteria 1829
195 Ga0495651_0400196 3300046462 Bacteria 897
196 Ga0495605_0016681 3300046474 Bacteria 3971
197 Ga0495605_0072680 3300046474 Bacteria 1621
198 Ga0495662_0070118 3300046476 Bacteria 1698
199 Ga0495664_0115930 3300046477 Bacteria 1619
200 Ga0495594_0090158 3300046499 Bacteria 1717
201 Ga0495596_0016276 3300046500 Bacteria 3092
202 Ga0495607_0077761 3300046501 Bacteria 1832
203 Ga0495607_0094606 3300046501 Bacteria 1611
204 Ga0495607_0100422 3300046501 Bacteria 1551
205 Ga0495606_0021382 3300046507 Bacteria 4739
206 Ga0495610_0062305 3300046512 Bacteria 1769
207 Ga0495620_0009577 3300046515 Bacteria 5142
208 Ga0495620_0190237 3300046515 Bacteria 792
209 Ga0495631_0015336 3300046518 Bacteria 3673
210 Ga0495631_0048639 3300046518 Bacteria 1859
211 Ga0495648_0042869 3300046524 Bacteria 2843
212 Ga0495666_0026601 3300046526 Bacteria 2850
213 Ga0495587_0546794 3300046536 Bacteria 639
214 Ga0495609_0016609 3300046538 Bacteria 3428
215 Ga0495597_0032274 3300046542 Bacteria 2377
216 Ga0495622_0015902 3300046557 Bacteria 3498
217 Ga0495633_0017388 3300046558 Bacteria 3679
218 Ga0495656_0265163 3300046615 Bacteria 871
219 Ga0495668_0045105 3300046616 Bacteria 2449
220 Ga0495611_0029386 3300046648 Bacteria 2410
221 Ga0495625_0081270 3300046660 Bacteria 2256
222 Ga0495625_0207451 3300046660 Bacteria 1289
223 Ga0495625_0342438 3300046660 Bacteria 947
224 Ga0495661_0044283 3300046665 Bacteria 2729
225 Ga0495646_0128440 3300046680 Bacteria 1429
226 Ga0495671_0175616 3300046692 Bacteria 1041
227 Ga0495649_0029944 3300046694 Bacteria 3007
228 Ga0495649_0105480 3300046694 Bacteria 1496
229 Ga0495589_0005815 3300046794 Bacteria 6506
230 Ga0495589_0079942 3300046794 Bacteria 1590
231 Ga0495636_0108960 3300047318 Bacteria 1217
232 Ga0495674_0141343 3300047319 Bacteria 2023
233 Ga0495672_0034621 3300047320 Bacteria 3118
234 Ga0495676_0044257 3300047321 Bacteria 3634
235 Ga0495676_0063684 3300047321 Bacteria 2872
236 Ga0495676_0112439 3300047321 Bacteria 1995
237 Ga0495683_0024170 3300047323 Bacteria 3120
238 Ga0495687_077310 3300047443 Bacteria 1314
239 Ga0495685_005408 3300047447 Bacteria 4168
240 Ga0495685_007596 3300047447 Bacteria 3585
241 Ga0495685_049841 3300047447 Bacteria 1421
242 Ga0495681_0087724 3300047470 Bacteria 1379
243 Ga0495686_0080056 3300047472 Bacteria 1997
244 Ga0495593_0141387 3300047673 Bacteria 1219
245 Ga0495614_0018977 3300048089 Bacteria 2977
246 Ga0495614_0245777 3300048089 Bacteria 817
247 Ga0495626_0018925 3300048091 Bacteria 3447
248 Ga0496100_0002187 3300048903 Bacteria 9867
249 Ga0496100_0259259 3300048903 Bacteria 1289
250 Ga0496100_0319412 3300048903 Bacteria 1166
251 Ga0496101_0000193 3300048904 Bacteria 47493
252 Ga0496102_0000403 3300048905 Bacteria 50292
253 Ga0496102_0003204 3300048905 Bacteria 13877
254 Ga0496102_0029037 3300048905 Bacteria 4945
255 Ga0496102_0049959 3300048905 Bacteria 3807
256 Ga0496102_0055546 3300048905 Bacteria 3611
257 Ga0496102_0460995 3300048905 Bacteria 1192
258 Ga0496103_0000284 3300048906 Bacteria 47531
259 Ga0496104_0000705 3300048907 Bacteria 28693
260 Ga0496104_0733837 3300048907 Bacteria 895
261 Ga0496105_0009575 3300048908 Bacteria 7582
262 Ga0496105_0074817 3300048908 Bacteria 2798
263 Ga0496106_0019037 3300048909 Bacteria 5089
264 Ga0496106_0062632 3300048909 Bacteria 2825
265 Ga0496106_0521251 3300048909 Bacteria 954
266 Ga0496107_0114935 3300048910 Bacteria 1980
267 Ga0496107_0159984 3300048910 Bacteria 1669
268 Ga0496108_0055595 3300048911 Bacteria 3324
269 Ga0496108_0062651 3300048911 Bacteria 3131
270 Ga0496108_0087029 3300048911 Bacteria 2653
271 Ga0496108_0276886 3300048911 Bacteria 1461
272 Ga0496108_0584212 3300048911 Bacteria 974
273 Ga0496109_0001389 3300048912 Bacteria 20085
274 Ga0496109_0012256 3300048912 Bacteria 7400
275 Ga0496109_0198312 3300048912 Bacteria 1887
276 Ga0496109_0235749 3300048912 Bacteria 1722
277 Ga0496110_0000745 3300048913 Bacteria 22477
278 Ga0496110_0015509 3300048913 Bacteria 6344
279 Ga0496111_0000241 3300048914 Bacteria 26160
280 Ga0496111_0001477 3300048914 Bacteria 13451
281 Ga0496112_1076854 3300048915 Bacteria 722
282 Ga0496114_0003495 3300048917 Bacteria 12064
283 Ga0496114_0094288 3300048917 Bacteria 2546
284 Ga0496114_0102137 3300048917 Bacteria 2449
285 Ga0496114_0748698 3300048917 Bacteria 854
286 Ga0496115_0043532 3300048918 Bacteria 3581
287 Ga0496115_0246432 3300048918 Bacteria 1472
288 Ga0496116_0000059 3300048919 Bacteria 274491
289 Ga0496117_0000055 3300048920 Bacteria 274518
290 Ga0496118_0000879 3300048921 Bacteria 47364
291 Ga0496119_0249879 3300048922 Bacteria 894
292 Ga0496120_0009085 3300048923 Bacteria 7094
293 Ga0496121_0001114 3300048924 Bacteria 47347
294 Ga0496124_0114105 3300048927 Bacteria 2170
295 Ga0496126_0004298 3300048929 Bacteria 17126
296 Ga0496126_0005915 3300048929 Bacteria 13791
297 Ga0496126_0068846 3300048929 Bacteria 3159
298 Ga0495678_013273 3300049459 Bacteria 3875
299 Ga0501034_0005274 3300049571 Bacteria 14179
300 Ga0501034_0058854 3300049571 Bacteria 3860
301 Ga0501034_0719391 3300049571 Bacteria 896
302 Ga0501037_0389581 3300049573 Bacteria 957
303 Ga0501039_0646412 3300049575 Bacteria 828
304 Ga0501040_0276485 3300049576 Bacteria 1199
305 Ga0501047_0130543 3300049581 Bacteria 2393
306 Ga0501067_0001497 3300049583 Bacteria 12720
307 Ga0501067_0007884 3300049583 Bacteria 5917
308 Ga0501067_0149349 3300049583 Bacteria 1302
309 Ga0501068_0001751 3300049584 Bacteria 11542
310 Ga0501068_0013942 3300049584 Bacteria 4585
311 Ga0501068_0175418 3300049584 Bacteria 1354
312 Ga0501069_0003548 3300049585 Bacteria 8032
313 Ga0501069_0513934 3300049585 Bacteria 715
314 Ga0501070_0002920 3300049586 Bacteria 14867
315 Ga0501070_0008104 3300049586 Bacteria 8892
316 Ga0501070_0010271 3300049586 Bacteria 7918
317 Ga0501070_0050103 3300049586 Bacteria 3467
318 Ga0501071_0006768 3300049587 Bacteria 7463
319 Ga0501071_0063104 3300049587 Bacteria 2686
320 Ga0501071_0536245 3300049587 Bacteria 898
321 Ga0501072_0006728 3300049588 Bacteria 8738
322 Ga0501072_0026474 3300049588 Bacteria 4522
323 Ga0501072_0903068 3300049588 Bacteria 690
324 Ga0501073_0006581 3300049589 Bacteria 8646
325 Ga0501073_0018193 3300049589 Bacteria 5078
326 Ga0501074_0001941 3300049590 Bacteria 14215
327 Ga0501074_0003472 3300049590 Bacteria 11187
328 Ga0501077_0004838 3300049593 Bacteria 8182
329 Ga0501077_0019728 3300049593 Bacteria 4265
330 Ga0501079_0057169 3300049741 Bacteria 3010
331 Ga0501079_0461685 3300049741 Bacteria 997
332 Ga0501080_0015439 3300049742 Bacteria 7041
333 Ga0501080_0015709 3300049742 Bacteria 6981
334 Ga0501080_0072325 3300049742 Bacteria 3208
335 Ga0501081_0144041 3300049743 Bacteria 1709
336 Ga0501083_0016451 3300049744 Bacteria 5177
337 Ga0501035_0617479 3300049822 Bacteria 882
338 Ga0501044_0303831 3300049823 Bacteria 1524
339 Ga0501045_0293619 3300049824 Bacteria 1210
340 Ga0501045_0413199 3300049824 Bacteria 1004
341 nmdc:mga03n38_227555_c1 3300050490 Bacteria 976
342 nmdc:mga03n38_287365_c1 3300050490 Bacteria 879
343 nmdc:mga03n38_360439_c1 3300050490 Bacteria 793
344 nmdc:mga00v17_301419_c1 3300050491 Bacteria 1041
345 nmdc:mga00v17_92408_c1 3300050491 Bacteria 1902
346 nmdc:mga0yw44_11574_c1 3300050492 Bacteria 4563
347 nmdc:mga0yw44_282609_c1 3300050492 Bacteria 1109
348 nmdc:mga0yw44_300181_c1 3300050492 Bacteria 1076
349 nmdc:mga0yw44_400652_c1 3300050492 Bacteria 928
350 nmdc:mga0yw44_4868_c1 3300050492 Bacteria 6243
351 nmdc:mga0yw44_560878_c1 3300050492 Bacteria 776
352 nmdc:mga06z11_237050_c1 3300050494 Bacteria 1070
353 nmdc:mga06z11_598004_c1 3300050494 Bacteria 671
354 nmdc:mga04h51_139752_c1 3300050495 Bacteria 918
355 nmdc:mga08y16_597796_c1 3300050511 Bacteria 1112
356 nmdc:mga0sz30_233003_c1 3300050516 Bacteria 819
357 Ga0495601_0078949 3300053077 Bacteria 2110
358 Ga0500635_0039170 3300053080 Bacteria 1575
359 Ga0500554_037589 3300053102 Bacteria 1469
360 Ga0500608_069087 3300053122 Bacteria 1681
361 Ga0500652_007107 3300053131 Bacteria 3643
362 Ga0500568_0101379 3300053139 Bacteria 1080
363 Ga0500627_0030649 3300053158 Bacteria 2253
364 Ga0500645_000128 3300053730 Bacteria 59444
365 Ga0500645_021663 3300053730 Bacteria 1982
366 Ga0500645_053240 3300053730 Bacteria 1178
367 Ga0501084_0038893 3300054114 Bacteria 3978
368 Ga0501084_0087596 3300054114 Bacteria 2614
369 Ga0501082_0008985 3300060353 Bacteria 8624
370 Ga0501082_0164554 3300060353 Bacteria 1928
371 2547412980 2547132111 Bacteria 8013147
372 2644093156 2643221615 Bacteria 5487866
373 2644229639 2643221641 Bacteria 4490190
374 2644322767 2643221657 Bacteria 5490246
375 2738708123 2738541274 Bacteria 6909446
376 2739334724 2738543028 Bacteria 6917070
377 2774395823 2773857762 Bacteria 5971770
378 2809233123 2808606448 Bacteria 8656184
379 2862578392 2862574272 Bacteria 10567477
380 2867373031 2867369537 Bacteria 6501581
381 2902803814 2902799365 Bacteria 5419524
382 Ga0070678_100134452
383 JGI24739J22299_10066949
384 JGI24735J21928_10065173
385 Ga0070658_10009812
386 Ga0070683_100005185
387 Ga0070683_100132879
388 Ga0070683_100456708
389 Ga0070690_100100049
390 Ga0070682_100001202
391 Ga0068868_100168278
392 Ga0068868_100619047
393 Ga0070660_100014545
394 Ga0070691_10304709
395 Ga0070661_100195904
396 Ga0070692_10181676
397 Ga0070668_100171634
398 Ga0070675_100206557
399 Ga0070673_100381754
400 Ga0070659_100004980
401 Ga0070667_100146395
402 Ga0070667_100316275
403 Ga0070667_100709500
404 Ga0070700_100703348
405 Ga0070663_100579659
406 Ga0070678_100332955
407 Ga0070684_100008100
408 Ga0070684_101215919
409 Ga0068853_100174750
410 Ga0070695_100515021
411 Ga0070693_100113860
412 Ga0070665_100029885
413 Ga0070664_100009098
414 Ga0068857_100454378
415 Ga0068856_100111500
416 Ga0068856_100877331
417 Ga0070702_100294262
418 Ga0068859_100176571
419 Ga0068859_101429449
420 Ga0068864_100039240
421 Ga0068864_100506921
422 Ga0068861_100131848
423 Ga0068861_100188684
424 Ga0068861_101181760
425 Ga0068858_100955735
426 Ga0068860_100000742
427 Ga0068860_100033883
428 Ga0068860_100625970
429 Ga0081455_10080909
430 Ga0070717_10450883
431 Ga0075365_10027106
432 Ga0075365_10041939
433 Ga0075365_10103223
434 Ga0075365_10138463
435 Ga0075365_10193754
436 Ga0075365_10301107
437 Ga0075368_10000043
438 Ga0075368_10062616
439 Ga0075363_100143765
440 Ga0075364_10023137
441 Ga0075364_10049790
442 Ga0075364_10394772
443 Ga0075367_10005681
444 Ga0075367_10232327
445 Ga0075369_10169891
446 Ga0097621_100035959
447 Ga0075370_10098362
448 Ga0068865_100012674
449 Ga0068865_100636743
450 Ga0097620_100176572
451 Ga0097620_101429713
452 Ga0105245_10001483
453 Ga0105245_10386640
454 Ga0105245_10604308
455 Ga0105245_11057090
456 Ga0105243_10045080
457 Ga0105243_10086643
458 Ga0105242_10052882
459 Ga0105242_10250347
460 Ga0105242_10504836
461 Ga0105237_10002337
462 Ga0105237_10488004
463 Ga0105238_10216671
464 Ga0105238_10277581
465 Ga0105249_10010362
466 Ga0105249_10088241
467 Ga0105249_10485378
468 Ga0105239_10002737
469 Ga0105239_10081102
470 Ga0105246_10216556
471 Ga0157371_10236241
472 Ga0157374_10687832
473 Ga0163162_10013741
474 Ga0157372_10006340
475 Ga0157375_10052930
476 Ga0157375_10158827
477 Ga0157375_10163372
478 Ga0157375_10350873
479 Ga0157375_10715483
480 Ga0157375_10752389
481 Ga0163163_10051423
482 Ga0163163_10561366
483 Ga0157377_10506065
484 Ga0157379_10023774
485 Ga0157376_10177995
486 Ga0157376_10260964
487 Ga0163161_10013984
488 Ga0207697_10177544
489 Ga0207688_10110612
490 Ga0207647_10123141
491 Ga0207705_10072056
492 Ga0207657_10018682
493 Ga0207649_10138804
494 Ga0207687_10024051
495 Ga0207687_10553337
496 Ga0207687_10574992
497 Ga0207690_10084380
498 Ga0207686_10344602
499 Ga0207686_10750215
500 Ga0207709_10145555
501 Ga0207669_10449397
502 Ga0207704_10283943
503 Ga0207711_10411200
504 Ga0207661_10008128
505 Ga0207679_10023490
506 Ga0207712_10025684
507 Ga0207712_10081389
508 Ga0207668_10335883
509 Ga0207658_10310218
510 Ga0207658_10375210
511 Ga0207677_10105195
512 Ga0207677_10157453
513 Ga0207703_10031739
514 Ga0207639_10268587
515 Ga0207678_10271904
516 Ga0207678_10505425
517 Ga0207708_10689877
518 Ga0207702_10090415
519 Ga0207641_10599670
520 Ga0207676_10052082
521 Ga0207674_10812195
522 Ga0207675_100164489
523 Ga0207675_100838068
524 Ga0207683_10048414
525 Ga0207683_10160185
526 Ga0268266_10007263
527 Ga0268266_10118814
528 Ga0268264_10000651
529 Ga0268264_10100666
530 Ga0268264_10546899
531 Ga0307515_10188501
532 Ga0307512_10135353
533 Ga0307513_10094827
534 Ga0307508_10096804
535 Ga0307413_10405589
536 Ga0307518_10018003
537 Ga0307406_10261734
538 Ga0307406_10638407
539 Ga0307407_10055709
540 Ga0307407_10131917
541 Ga0307412_10359375
542 Ga0307409_100023211
543 Ga0307409_100048434
544 Ga0307409_100276025
545 Ga0307416_100001543
546 Ga0307416_100095447
547 Ga0307415_100000142
548 Ga0307415_100321442
549 Ga0373925_0770513
550 Ga0436365_0184594
551 Ga0451793_0233002
552 Ga0451793_0726904
553 Ga0451853_1389941
554 Ga0466972_0001718
555 Ga0466965_0003543
556 Ga0466966_0333164
557 Ga0466961_0008713
558 Ga0466961_0023422
559 Ga0466963_0011484
560 Ga0466963_0047581
561 Ga0466970_0009620
562 Ga0466970_0142547
563 Ga0466960_0044840
564 Ga0466967_0019941
565 Ga0466967_0020574
566 Ga0466967_0129544
567 Ga0466967_0750874
568 Ga0495627_019843
569 Ga0495603_0024223
570 Ga0495603_0035525
571 Ga0495603_0063709
572 Ga0495603_0202581
573 Ga0495629_0320556
574 Ga0495638_0025774
575 Ga0495638_0091705
576 Ga0495651_0400196
577 Ga0495605_0016681
578 Ga0495605_0072680
579 Ga0495662_0070118
580 Ga0495664_0115930
581 Ga0495594_0090158
582 Ga0495596_0016276
583 Ga0495607_0077761
584 Ga0495607_0094606
585 Ga0495607_0100422
586 Ga0495606_0021382
587 Ga0495610_0062305
588 Ga0495620_0009577
589 Ga0495620_0190237
590 Ga0495631_0015336
591 Ga0495631_0048639
592 Ga0495648_0042869
593 Ga0495666_0026601
594 Ga0495587_0546794
595 Ga0495609_0016609
596 Ga0495597_0032274
597 Ga0495622_0015902
598 Ga0495633_0017388
599 Ga0495656_0265163
600 Ga0495668_0045105
601 Ga0495611_0029386
602 Ga0495625_0081270
603 Ga0495625_0207451
604 Ga0495625_0342438
605 Ga0495661_0044283
606 Ga0495646_0128440
607 Ga0495671_0175616
608 Ga0495649_0029944
609 Ga0495649_0105480
610 Ga0495589_0005815
611 Ga0495589_0079942
612 Ga0495636_0108960
613 Ga0495674_0141343
614 Ga0495672_0034621
615 Ga0495676_0044257
616 Ga0495676_0063684
617 Ga0495676_0112439
618 Ga0495683_0024170
619 Ga0495687_077310
620 Ga0495685_005408
621 Ga0495685_007596
622 Ga0495685_049841
623 Ga0495681_0087724
624 Ga0495686_0080056
625 Ga0495593_0141387
626 Ga0495614_0018977
627 Ga0495614_0245777
628 Ga0495626_0018925
629 Ga0496100_0002187
630 Ga0496100_0259259
631 Ga0496100_0319412
632 Ga0496101_0000193
633 Ga0496102_0000403
634 Ga0496102_0003204
635 Ga0496102_0029037
636 Ga0496102_0049959
637 Ga0496102_0055546
638 Ga0496102_0460995
639 Ga0496103_0000284
640 Ga0496104_0000705
641 Ga0496104_0733837
642 Ga0496105_0009575
643 Ga0496105_0074817
644 Ga0496106_0019037
645 Ga0496106_0062632
646 Ga0496106_0521251
647 Ga0496107_0114935
648 Ga0496107_0159984
649 Ga0496108_0055595
650 Ga0496108_0062651
651 Ga0496108_0087029
652 Ga0496108_0276886
653 Ga0496108_0584212
654 Ga0496109_0001389
655 Ga0496109_0012256
656 Ga0496109_0198312
657 Ga0496109_0235749
658 Ga0496110_0000745
659 Ga0496110_0015509
660 Ga0496111_0000241
661 Ga0496111_0001477
662 Ga0496112_1076854
663 Ga0496114_0003495
664 Ga0496114_0094288
665 Ga0496114_0102137
666 Ga0496114_0748698
667 Ga0496115_0043532
668 Ga0496115_0246432
669 Ga0496116_0000059
670 Ga0496117_0000055
671 Ga0496118_0000879
672 Ga0496119_0249879
673 Ga0496120_0009085
674 Ga0496121_0001114
675 Ga0496124_0114105
676 Ga0496126_0004298
677 Ga0496126_0005915
678 Ga0496126_0068846
679 Ga0495678_013273
680 Ga0501034_0005274
681 Ga0501034_0058854
682 Ga0501034_0719391
683 Ga0501037_0389581
684 Ga0501039_0646412
685 Ga0501040_0276485
686 Ga0501047_0130543
687 Ga0501067_0001497
688 Ga0501067_0007884
689 Ga0501067_0149349
690 Ga0501068_0001751
691 Ga0501068_0013942
692 Ga0501068_0175418
693 Ga0501069_0003548
694 Ga0501069_0513934
695 Ga0501070_0002920
696 Ga0501070_0008104
697 Ga0501070_0010271
698 Ga0501070_0050103
699 Ga0501071_0006768
700 Ga0501071_0063104
701 Ga0501071_0536245
702 Ga0501072_0006728
703 Ga0501072_0026474
704 Ga0501072_0903068
705 Ga0501073_0006581
706 Ga0501073_0018193
707 Ga0501074_0001941
708 Ga0501074_0003472
709 Ga0501077_0004838
710 Ga0501077_0019728
711 Ga0501079_0057169
712 Ga0501079_0461685
713 Ga0501080_0015439
714 Ga0501080_0015709
715 Ga0501080_0072325
716 Ga0501081_0144041
717 Ga0501083_0016451
718 Ga0501035_0617479
719 Ga0501044_0303831
720 Ga0501045_0293619
721 Ga0501045_0413199
722 nmdc:mga03n38_227555_c1
723 nmdc:mga03n38_287365_c1
724 nmdc:mga03n38_360439_c1
725 nmdc:mga00v17_301419_c1
726 nmdc:mga00v17_92408_c1
727 nmdc:mga0yw44_11574_c1
728 nmdc:mga0yw44_282609_c1
729 nmdc:mga0yw44_300181_c1
730 nmdc:mga0yw44_400652_c1
731 nmdc:mga0yw44_4868_c1
732 nmdc:mga0yw44_560878_c1
733 nmdc:mga06z11_237050_c1
734 nmdc:mga06z11_598004_c1
735 nmdc:mga04h51_139752_c1
736 nmdc:mga08y16_597796_c1
737 nmdc:mga0sz30_233003_c1
738 Ga0495601_0078949
739 Ga0500635_0039170
740 Ga0500554_037589
741 Ga0500608_069087
742 Ga0500652_007107
743 Ga0500568_0101379
744 Ga0500627_0030649
745 Ga0500645_000128
746 Ga0500645_021663
747 Ga0500645_053240
748 Ga0501084_0038893
749 Ga0501084_0087596
750 Ga0501082_0008985
751 Ga0501082_0164554
752 2547412980
753 2644093156
754 2644229639
755 2644322767
756 2738708123
757 2739334724
758 2774395823
759 2809233123
760 2862578392
761 2867373031
762 2902803814

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00440

TetR_N

Bacterial regulatory proteins, tetR family

50

96

0.98

PF17920

TetR_C_16

Tetracyclin repressor-like, C-terminal domain

116

222

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
2np3-assembly1.cif.gz_A crystal structure of tetr-family regulator (sco0857) from streptomyces coelicolor a3. 0.6958 58 195
2obp-assembly2.cif.gz_B crystal structure of a putative dna-binding protein (reut_b4095) from ralstonia eutropha jmp134 at 1.70 a resolution 0.6845 15 60
2np3-assembly1.cif.gz_A crystal structure of tetr-family regulator (sco0857) from streptomyces coelicolor a3. 0.6501 58 195
6zui-assembly1.cif.gz_A crystal structure of the cys-ser mutant of the cpyfp-based biosensor for hypochlorous acid 0.6264 18 96
2dk5-assembly1.cif.gz_A solution structure of winged-helix domain in rna polymerase iii 39kda polypeptide 0.5876 1 60
ID Description Score Start End Superfamily
2wv1B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9998 19 61 1.10.10.60
4x1eB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9943 22 68 1.10.10.60
4jykB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9943 19 68 1.10.10.60
3locA01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9927 19 68 1.10.10.60
4xk4B01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9914 19 68 1.10.10.60
ID Description Score Start End GO Terms
AF-A0A2E8YU65-F1-model_v4 TetR family transcriptional regulator 0.9358 1 199 GO:0000976
GO:0003700
AF-A0A6B2U2F6-F1-model_v4 deleted 0.9188 24 196
AF-A0A7W1RTD4-F1-model_v4 TetR family transcriptional regulator 0.9103 24 200 GO:0000976
GO:0003700
AF-A0A7J9WVP2-F1-model_v4 TetR family transcriptional regulator 0.9093 3 200 GO:0000976
GO:0003700
AF-A0A7V9R7L5-F1-model_v4 TetR/AcrR family transcriptional regulator 0.9074 1 198 GO:0000976
GO:0003700

Map