F428817

General Info

Members Datasets Scaffolds Average Seq Length
380 232 380 318

Family's Representative Sequence

Representative Sequence 3300053178|Ga0500637_0070764|Ga0500637_0070764_730_1821
Length 345
Sequence MRVARLLQNFLEGRALRCPALISARTYPMPQFTQHSSPSTRRPLISYPTHPIRLVVPFSAGAGVVDIMARLLSQRLGTALGQPIVIENRPGAGGISGTEVAAQAAPDGYTLLITNVSLVVSTYLYTKLPFDAARDFIPISMINSAPLMLVVHPSVQAKTAKELITYARAHPAELNYGSGGVGSTPHLCVELFKSMAGIEATHVPYKGGAPALADLVGGQLSFMIENMPGTMPFVKTGKLRALAITSAQRSPLAPELPTLAEAGVPGYEVVGWNGLFAMKGTPPEIITRVNGEMAKILRAPEVRQQMAVLGAEPIGNTPEEFGAFLKAENARWGKVIKEKGIRSES

Samples

Sample ID Description Type Environment
1 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
5 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
6 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
9 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
10 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
11 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
14 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
15 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
16 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
17 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
18 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
19 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
20 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
21 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
22 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
23 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
24 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
25 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
26 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
27 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
28 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
29 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
30 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
31 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
32 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
33 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
34 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
35 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
36 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
37 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
38 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
39 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
43 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
44 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
45 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
46 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
47 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
48 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
49 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
50 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
51 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
52 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
53 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
54 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
55 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
60 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
61 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
62 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
63 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
65 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
70 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
71 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
72 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
73 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
74 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
75 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
76 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
80 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
81 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
129 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
132 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
133 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
134 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
135 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
136 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
137 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
138 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
139 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
140 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
141 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
142 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
143 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
144 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
145 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
146 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
149 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
150 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
151 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
152 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
155 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
156 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
157 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
158 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
159 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
160 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
161 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
162 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
163 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
164 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
165 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
166 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
167 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
168 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
169 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
170 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
171 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
172 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
173 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
174 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
175 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
176 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
177 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
180 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
181 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
182 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
183 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
184 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
185 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
186 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
187 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
188 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
189 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
190 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
191 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
192 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
193 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
194 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
195 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
196 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
197 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
198 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
199 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
200 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
201 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
202 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
203 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
204 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
205 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
206 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
207 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
208 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
209 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
210 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
211 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
212 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
213 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
214 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
215 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
216 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
217 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
218 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
219 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
220 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
221 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
222 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
223 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
224 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
225 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
226 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
227 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
228 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
229 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
230 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
231 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
232 3300053733 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.21
Nodule 0
Rhizoplane 1.05
Rhizosphere 94.21
Stem 0
Stem Tuber 0
Unclassified 0.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070658_10004552 3300005327 Bacteria 11270
2 Ga0070683_100035374 3300005329 Bacteria 4567
3 Ga0070690_100000357 3300005330 Bacteria 23358
4 Ga0070690_100003371 3300005330 Bacteria 8721
5 Ga0070690_100027148 3300005330 Bacteria 3538
6 Ga0068869_100000520 3300005334 Bacteria 21514
7 Ga0068869_100019915 3300005334 Bacteria 4594
8 Ga0068869_100095305 3300005334 Bacteria 2246
9 Ga0070680_100010887 3300005336 Bacteria 7026
10 Ga0070680_100012192 3300005336 Bacteria 6677
11 Ga0070682_100043710 3300005337 Bacteria 2771
12 Ga0068868_100000484 3300005338 Bacteria 26446
13 Ga0070689_100000576 3300005340 Bacteria 22068
14 Ga0070689_100076117 3300005340 Bacteria 2629
15 Ga0070691_10000164 3300005341 Bacteria 21575
16 Ga0070691_10003736 3300005341 Bacteria 6873
17 Ga0070691_10006622 3300005341 Bacteria 5300
18 Ga0070687_100000111 3300005343 Bacteria 27592
19 Ga0070687_100102305 3300005343 Bacteria 1606
20 Ga0070692_10013233 3300005345 Bacteria 3842
21 Ga0070668_100235827 3300005347 Bacteria 1514
22 Ga0070669_100038680 3300005353 Bacteria 3464
23 Ga0070669_100303091 3300005353 Bacteria 1285
24 Ga0070675_100022663 3300005354 Bacteria 5017
25 Ga0070675_100044481 3300005354 Bacteria 3631
26 Ga0070671_100050324 3300005355 Bacteria 3465
27 Ga0070671_100118008 3300005355 Bacteria 2231
28 Ga0070671_100171788 3300005355 Bacteria 1833
29 Ga0070673_100046530 3300005364 Bacteria 3371
30 Ga0070673_100207972 3300005364 Bacteria 1688
31 Ga0070688_100081134 3300005365 Bacteria 2100
32 Ga0070667_100117589 3300005367 Bacteria 2309
33 Ga0070714_100122048 3300005435 Bacteria 2319
34 Ga0070701_10000124 3300005438 Bacteria 22615
35 Ga0070705_100000690 3300005440 Bacteria 19256
36 Ga0070700_100000756 3300005441 Bacteria 15955
37 Ga0070700_100002462 3300005441 Bacteria 9415
38 Ga0070694_100000476 3300005444 Bacteria 21973
39 Ga0070694_100022908 3300005444 Unclassified 4009
40 Ga0070694_100092168 3300005444 Bacteria 2128
41 Ga0070694_100122398 3300005444 Bacteria 1868
42 Ga0070694_100127353 3300005444 Bacteria 1835
43 Ga0070678_100061692 3300005456 Bacteria 2764
44 Ga0070662_100038408 3300005457 Bacteria 3401
45 Ga0070662_100333767 3300005457 Bacteria 1239
46 Ga0070681_10014067 3300005458 Bacteria 7963
47 Ga0070681_10020775 3300005458 Bacteria 6577
48 Ga0070681_10081090 3300005458 Bacteria 3200
49 Ga0068867_100000433 3300005459 Bacteria 27996
50 Ga0068867_100003815 3300005459 Bacteria 10601
51 Ga0070698_100004802 3300005471 Bacteria 14835
52 Ga0070699_100247074 3300005518 Bacteria 1594
53 Ga0070679_100006386 3300005530 Bacteria 10981
54 Ga0070679_100007255 3300005530 Bacteria 10347
55 Ga0070679_100057076 3300005530 Bacteria 3891
56 Ga0070684_100035445 3300005535 Bacteria 4270
57 Ga0068853_100130859 3300005539 Bacteria 2246
58 Ga0070672_100115684 3300005543 Bacteria 2190
59 Ga0070686_100000385 3300005544 Bacteria 28213
60 Ga0070686_100002491 3300005544 Bacteria 10135
61 Ga0070695_100000228 3300005545 Bacteria 27712
62 Ga0070695_100023240 3300005545 Bacteria 3807
63 Ga0070695_100047649 3300005545 Bacteria 2738
64 Ga0070695_100058855 3300005545 Bacteria 2486
65 Ga0070696_100000052 3300005546 Bacteria 53820
66 Ga0070696_100024656 3300005546 Bacteria 4089
67 Ga0070693_100000236 3300005547 Bacteria 25789
68 Ga0070704_100000314 3300005549 Bacteria 21710
69 Ga0070704_100004103 3300005549 Bacteria 8409
70 Ga0070704_100056080 3300005549 Bacteria 2797
71 Ga0070704_100068626 3300005549 Bacteria 2566
72 Ga0068855_100002153 3300005563 Bacteria 24336
73 Ga0068855_100085712 3300005563 Bacteria 3644
74 Ga0068855_100149550 3300005563 Bacteria 2655
75 Ga0068856_100057053 3300005614 Bacteria 3855
76 Ga0070702_100000142 3300005615 Bacteria 22352
77 Ga0070702_100052482 3300005615 Bacteria 2338
78 Ga0070702_100095798 3300005615 Bacteria 1810
79 Ga0068859_100000605 3300005617 Bacteria 35884
80 Ga0068859_100106720 3300005617 Bacteria 2860
81 Ga0068864_100044703 3300005618 Bacteria 3798
82 Ga0068866_10001279 3300005718 Bacteria 10904
83 Ga0068861_100000164 3300005719 Bacteria 34852
84 Ga0068861_100000293 3300005719 Bacteria 28120
85 Ga0068858_100010944 3300005842 Bacteria 8575
86 Ga0068858_100044336 3300005842 Bacteria 4123
87 Ga0068860_100002655 3300005843 Bacteria 18611
88 Ga0068860_100170201 3300005843 Bacteria 2104
89 Ga0068862_100001004 3300005844 Bacteria 27039
90 Ga0068862_100003943 3300005844 Bacteria 12620
91 Ga0081455_10027558 3300005937 Bacteria 5206
92 Ga0081455_10127061 3300005937 Bacteria 1999
93 Ga0081539_10000805 3300005985 Bacteria 61020
94 Ga0081539_10016034 3300005985 Bacteria 5389
95 Ga0075365_10088125 3300006038 Bacteria 2111
96 Ga0070712_100178258 3300006175 Unclassified 1654
97 Ga0075362_10004886 3300006177 Bacteria 4847
98 Ga0075362_10011835 3300006177 Bacteria 3446
99 Ga0075369_10000948 3300006186 Bacteria 9658
100 Ga0075369_10031769 3300006186 Bacteria 2231
101 Ga0075366_10066557 3300006195 Bacteria 2144
102 Ga0097621_100011858 3300006237 Bacteria 6443
103 Ga0097621_100183315 3300006237 Bacteria 1810
104 Ga0068871_100000751 3300006358 Bacteria 21875
105 Ga0068871_100000765 3300006358 Bacteria 21675
106 Ga0068871_100002204 3300006358 Bacteria 13240
107 Ga0068871_100045206 3300006358 Bacteria 3543
108 Ga0068871_100150624 3300006358 Bacteria 1984
109 Ga0075428_100026384 3300006844 Bacteria 6431
110 Ga0075434_100000071 3300006871 Bacteria 53243
111 Ga0075434_100000484 3300006871 Bacteria 29868
112 Ga0075429_100003966 3300006880 Bacteria 12658
113 Ga0068865_100000130 3300006881 Bacteria 38946
114 Ga0068865_100272885 3300006881 Bacteria 1343
115 Ga0075436_100000205 3300006914 Bacteria 36621
116 Ga0075436_100000538 3300006914 Bacteria 24703
117 Ga0075436_100002507 3300006914 Bacteria 12628
118 Ga0075436_100009750 3300006914 Bacteria 6571
119 Ga0075436_100028529 3300006914 Bacteria 3839
120 Ga0075436_100040302 3300006914 Bacteria 3223
121 Ga0097620_100000605 3300006931 Bacteria 35884
122 Ga0097620_100106717 3300006931 Bacteria 2860
123 Ga0075435_100001818 3300007076 Bacteria 13870
124 Ga0075435_100032223 3300007076 Bacteria 4137
125 Ga0099794_10100023 3300007265 Bacteria 1447
126 Ga0105240_10019564 3300009093 Bacteria 9043
127 Ga0111539_10006154 3300009094 Bacteria 15494
128 Ga0111539_10021942 3300009094 Bacteria 7848
129 Ga0105245_10000704 3300009098 Bacteria 30127
130 Ga0105245_10062770 3300009098 Bacteria 3353
131 Ga0105243_10000889 3300009148 Bacteria 28135
132 Ga0105243_10002986 3300009148 Bacteria 13979
133 Ga0105241_10009322 3300009174 Bacteria 7216
134 Ga0105242_10000432 3300009176 Bacteria 33401
135 Ga0105242_10019302 3300009176 Bacteria 5340
136 Ga0105248_10281574 3300009177 Bacteria 1872
137 Ga0105248_10314301 3300009177 Bacteria 1764
138 Ga0105237_10436810 3300009545 Bacteria 1314
139 Ga0105238_10123541 3300009551 Bacteria 2568
140 Ga0105249_10001318 3300009553 Bacteria 21719
141 Ga0105239_10083882 3300010375 Bacteria 3509
142 Ga0157369_10461787 3300013105 Bacteria 1315
143 Ga0157378_10000467 3300013297 Bacteria 38541
144 Ga0157372_10227385 3300013307 Bacteria 2163
145 Ga0157380_10006105 3300014326 Bacteria 8444
146 Ga0157380_10011899 3300014326 Bacteria 6294
147 Ga0157380_10035234 3300014326 Bacteria 3865
148 Ga0157377_10051891 3300014745 Bacteria 2314
149 Ga0157377_10133860 3300014745 Bacteria 1517
150 Ga0157379_10226243 3300014968 Bacteria 1695
151 Ga0157379_10228332 3300014968 Bacteria 1687
152 Ga0157376_10070818 3300014969 Bacteria 2961
153 Ga0157376_10213660 3300014969 Bacteria 1782
154 Ga0163161_10033979 3300017792 Bacteria 3647
155 Ga0207697_10060222 3300025315 Bacteria 1578
156 Ga0207682_10003726 3300025893 Bacteria 6561
157 Ga0207642_10002671 3300025899 Bacteria 5557
158 Ga0207688_10011774 3300025901 Bacteria 4759
159 Ga0207680_10211090 3300025903 Bacteria 1327
160 Ga0207645_10013737 3300025907 Bacteria 5438
161 Ga0207643_10007966 3300025908 Bacteria 5686
162 Ga0207643_10059851 3300025908 Bacteria 2174
163 Ga0207705_10007445 3300025909 Bacteria 8050
164 Ga0207684_10047916 3300025910 Bacteria 3624
165 Ga0207707_10006672 3300025912 Bacteria 10068
166 Ga0207707_10015917 3300025912 Bacteria 6559
167 Ga0207707_10064202 3300025912 Bacteria 3196
168 Ga0207695_10039875 3300025913 Bacteria 5044
169 Ga0207695_10065213 3300025913 Bacteria 3745
170 Ga0207660_10016611 3300025917 Bacteria 4876
171 Ga0207660_10044224 3300025917 Bacteria 3133
172 Ga0207660_10050368 3300025917 Bacteria 2956
173 Ga0207660_10204586 3300025917 Bacteria 1543
174 Ga0207662_10000085 3300025918 Bacteria 43688
175 Ga0207662_10006328 3300025918 Bacteria 6382
176 Ga0207662_10114114 3300025918 Bacteria 1687
177 Ga0207652_10004867 3300025921 Bacteria 10879
178 Ga0207652_10044087 3300025921 Bacteria 3799
179 Ga0207652_10101921 3300025921 Bacteria 2536
180 Ga0207681_10020995 3300025923 Bacteria 4145
181 Ga0207694_10057985 3300025924 Bacteria 3012
182 Ga0207650_10012754 3300025925 Bacteria 5806
183 Ga0207659_10017177 3300025926 Bacteria 4724
184 Ga0207659_10170716 3300025926 Bacteria 1716
185 Ga0207687_10005370 3300025927 Bacteria 8476
186 Ga0207664_10043596 3300025929 Bacteria 3510
187 Ga0207644_10049941 3300025931 Bacteria 2997
188 Ga0207644_10120375 3300025931 Bacteria 1998
189 Ga0207644_10156264 3300025931 Bacteria 1769
190 Ga0207706_10013885 3300025933 Bacteria 7305
191 Ga0207706_10371291 3300025933 Bacteria 1242
192 Ga0207686_10005085 3300025934 Bacteria 7075
193 Ga0207709_10002937 3300025935 Bacteria 10412
194 Ga0207709_10003247 3300025935 Bacteria 9749
195 Ga0207670_10003760 3300025936 Bacteria 8065
196 Ga0207670_10053886 3300025936 Bacteria 2711
197 Ga0207704_10000432 3300025938 Bacteria 18717
198 Ga0207704_10002757 3300025938 Bacteria 7927
199 Ga0207689_10000453 3300025942 Bacteria 38540
200 Ga0207689_10010051 3300025942 Bacteria 8156
201 Ga0207689_10130970 3300025942 Bacteria 2064
202 Ga0207661_10145965 3300025944 Bacteria 2041
203 Ga0207667_10013693 3300025949 Bacteria 9268
204 Ga0207667_10076078 3300025949 Bacteria 3484
205 Ga0207667_10087146 3300025949 Bacteria 3230
206 Ga0207651_10221637 3300025960 Bacteria 1529
207 Ga0207668_10245768 3300025972 Bacteria 1450
208 Ga0207640_10222616 3300025981 Bacteria 1446
209 Ga0207658_10179509 3300025986 Bacteria 1751
210 Ga0207677_10001292 3300026023 Bacteria 13426
211 Ga0207703_10110094 3300026035 Bacteria 2349
212 Ga0207703_10110792 3300026035 Bacteria 2342
213 Ga0207639_10187702 3300026041 Bacteria 1763
214 Ga0207708_10000264 3300026075 Bacteria 41201
215 Ga0207708_10000727 3300026075 Bacteria 24747
216 Ga0207708_10012092 3300026075 Bacteria 6434
217 Ga0207702_10010843 3300026078 Bacteria 7601
218 Ga0207702_10063576 3300026078 Bacteria 3156
219 Ga0207702_10375339 3300026078 Bacteria 1366
220 Ga0207641_10064435 3300026088 Bacteria 3132
221 Ga0207648_10000398 3300026089 Bacteria 48319
222 Ga0207648_10000863 3300026089 Bacteria 34150
223 Ga0207648_10008635 3300026089 Bacteria 9843
224 Ga0207676_10001836 3300026095 Bacteria 15555
225 Ga0207676_10122558 3300026095 Bacteria 2195
226 Ga0207674_10370703 3300026116 Bacteria 1384
227 Ga0207675_100000474 3300026118 Bacteria 39052
228 Ga0207428_10030322 3300027907 Bacteria 4472
229 Ga0207428_10094512 3300027907 Bacteria 2317
230 Ga0207428_10230288 3300027907 Bacteria 1387
231 Ga0268265_10003037 3300028380 Bacteria 12235
232 Ga0268265_10003440 3300028380 Bacteria 11388
233 Ga0268264_10002862 3300028381 Bacteria 15030
234 Ga0268264_10083406 3300028381 Bacteria 2738
235 Ga0265334_10031002 3300028573 Bacteria 2138
236 Ga0265327_10065506 3300031251 Bacteria 1837
237 Ga0307412_10079043 3300031911 Bacteria 2268
238 Ga0307416_100009063 3300032002 Bacteria 6478
239 Ga0307510_10002158 3300033180 Bacteria 22205
240 Ga0373958_0001239 3300034819 Bacteria 3419
241 Ga0373928_0008432 3300035084 Bacteria 2002
242 Ga0373934_0006482 3300035086 Bacteria 4344
243 Ga0373949_0003396 3300035090 Bacteria 3809
244 Ga0373951_0005482 3300035091 Bacteria 2947
245 Ga0373952_0003990 3300035092 Bacteria 2668
246 Ga0373923_0022648 3300035111 Bacteria 2466
247 Ga0373932_0000211 3300035112 Bacteria 17163
248 Ga0373936_0062568 3300035113 Bacteria 1522
249 Ga0373939_0013758 3300035114 Bacteria 2088
250 Ga0373941_0007944 3300035115 Bacteria 2617
251 Ga0373953_0026747 3300035117 Bacteria 2212
252 Ga0373953_0061926 3300035117 Bacteria 1531
253 Ga0373954_0000001 3300035118 Bacteria 158201
254 Ga0373956_0038192 3300035119 Bacteria 2124
255 Ga0373960_0026534 3300035121 Bacteria 1584
256 Ga0373943_0054679 3300035170 Bacteria 1975
257 Ga0373946_0006980 3300035171 Bacteria 4115
258 Ga0373942_0002189 3300035207 Bacteria 4811
259 Ga0373961_0046736 3300035241 Bacteria 1269
260 Ga0373931_0000137 3300035691 Bacteria 33227
261 Ga0373931_0002972 3300035691 Bacteria 7572
262 Ga0373931_0005650 3300035691 Bacteria 5804
263 Ga0373931_0044751 3300035691 Bacteria 2335
264 Ga0373935_0002419 3300035692 Bacteria 10687
265 Ga0373935_0230800 3300035692 Bacteria 1289
266 Ga0373927_0078165 3300035695 Bacteria 2143
267 Ga0373933_0008350 3300035724 Bacteria 5655
268 Ga0373933_0016343 3300035724 Bacteria 4147
269 Ga0373933_0025905 3300035724 Bacteria 3364
270 Ga0373947_0017383 3300035725 Bacteria 4137
271 Ga0373937_0003140 3300036401 Bacteria 13824
272 Ga0373937_0009214 3300036401 Bacteria 8568
273 Ga0373937_0024351 3300036401 Bacteria 5458
274 Ga0373937_0060506 3300036401 Bacteria 3480
275 Ga0373937_0117288 3300036401 Bacteria 2479
276 Ga0373925_0022983 3300037068 Bacteria 4549
277 Ga0373925_0074148 3300037068 Bacteria 2577
278 Ga0395899_0011178 3300037312 Bacteria 6878
279 Ga0395900_0058485 3300037418 Bacteria 3968
280 Ga0395898_0007037 3300037466 Bacteria 11955
281 Ga0395901_0007035 3300038443 Bacteria 11371
282 Ga0395901_0031563 3300038443 Bacteria 5461
283 Ga0436360_0549693 3300039438 Bacteria 10325
284 Ga0436361_0689478 3300039447 Bacteria 2368
285 Ga0451839_1561726 3300041496 Bacteria 1841
286 Ga0451577_0047030 3300042876 Bacteria 3858
287 Ga0466964_0022905 3300044706 Bacteria 2426
288 Ga0466957_0177474 3300044842 Bacteria 1390
289 Ga0451576_0001414 3300045051 Bacteria 41151
290 Ga0451576_0009202 3300045051 Bacteria 11478
291 Ga0451576_0018034 3300045051 Bacteria 7745
292 Ga0466967_0012686 3300045976 Bacteria 6466
293 Ga0495592_0000480 3300046454 Bacteria 29229
294 Ga0495592_0009566 3300046454 Bacteria 7293
295 Ga0495603_0108422 3300046455 Bacteria 1620
296 Ga0495641_0025216 3300046461 Bacteria 2920
297 Ga0495653_0048235 3300046463 Bacteria 3289
298 Ga0495580_0002339 3300046472 Bacteria 16536
299 Ga0495639_0008859 3300046475 Bacteria 4312
300 Ga0495662_0061419 3300046476 Bacteria 1815
301 Ga0495594_0046867 3300046499 Bacteria 2374
302 Ga0495608_0000927 3300046511 Bacteria 20600
303 Ga0495628_0001549 3300046516 Bacteria 21056
304 Ga0495628_0005055 3300046516 Bacteria 11595
305 Ga0495630_0041513 3300046517 Bacteria 3435
306 Ga0495630_0064960 3300046517 Bacteria 2742
307 Ga0495648_0143496 3300046524 Bacteria 1254
308 Ga0495652_0044175 3300046529 Bacteria 3838
309 Ga0495652_0067697 3300046529 Bacteria 2993
310 Ga0495640_0000451 3300046533 Bacteria 29992
311 Ga0495586_0000742 3300046535 Bacteria 18700
312 Ga0495586_0081230 3300046535 Bacteria 1781
313 Ga0495645_0127879 3300046543 Bacteria 1784
314 Ga0495622_0083024 3300046557 Bacteria 1474
315 Ga0495667_0011791 3300046559 Bacteria 5921
316 Ga0495667_0072303 3300046559 Bacteria 2248
317 Ga0495634_0005311 3300046642 Bacteria 9938
318 Ga0495634_0275706 3300046642 Bacteria 1023
319 Ga0495635_0056448 3300046663 Bacteria 2703
320 Ga0495659_0057426 3300046664 Bacteria 1430
321 Ga0495657_0108872 3300046675 Bacteria 1758
322 Ga0495599_0028837 3300046678 Bacteria 3478
323 Ga0495647_0014396 3300046681 Bacteria 2755
324 Ga0495658_0002414 3300046683 Bacteria 9419
325 Ga0495658_0027184 3300046683 Bacteria 3075
326 Ga0495669_0044796 3300046684 Bacteria 1971
327 Ga0495669_0114513 3300046684 Bacteria 1261
328 Ga0495613_0002166 3300046689 Bacteria 14893
329 Ga0495624_0053420 3300046690 Bacteria 2551
330 Ga0495600_0002385 3300046809 Bacteria 10754
331 Ga0495581_0111242 3300047315 Bacteria 1593
332 Ga0495604_0001344 3300047317 Bacteria 20123
333 Ga0495636_0002552 3300047318 Bacteria 6997
334 Ga0495674_0059322 3300047319 Bacteria 3342
335 Ga0495676_0054135 3300047321 Bacteria 3191
336 Ga0495680_0000202 3300047322 Bacteria 64368
337 Ga0495680_0213774 3300047322 Bacteria 1379
338 Ga0495680_0312494 3300047322 Bacteria 1101
339 Ga0495684_0053792 3300047471 Bacteria 3071
340 Ga0495593_0066531 3300047673 Bacteria 1878
341 Ga0496101_0175604 3300048904 Bacteria 1648
342 Ga0496105_0200013 3300048908 Bacteria 1631
343 Ga0496114_0230330 3300048917 Bacteria 1628
344 Ga0496114_0296995 3300048917 Bacteria 1426
345 Ga0501034_0038395 3300049571 Bacteria 4849
346 Ga0501034_0253235 3300049571 Bacteria 1705
347 Ga0501080_0110402 3300049742 Bacteria 2549
348 nmdc:mga03683_9275_c1 3300050489 Bacteria 3491
349 nmdc:mga0yw44_78649_c1 3300050492 Bacteria 2063
350 nmdc:mga06z11_121440_c1 3300050494 Bacteria 1458
351 nmdc:mga05p37_3420_c1 3300050507 Bacteria 18525
352 nmdc:mga09592_1997_c1 3300050508 Bacteria 16459
353 nmdc:mga0qj67_317970_c1 3300050509 Bacteria 1260
354 nmdc:mga08y16_128036_c1 3300050511 Bacteria 2641
355 nmdc:mga08y16_3948_c1 3300050511 Bacteria 15438
356 nmdc:mga08y16_48966_c1 3300050511 Bacteria 4422
357 nmdc:mga0n895_367_c1 3300050512 Bacteria 30485
358 nmdc:mga0n895_369711_c1 3300050512 Bacteria 1452
359 nmdc:mga0n895_59333_c1 3300050512 Bacteria 3775
360 nmdc:mga0rr50_13254_c1 3300050513 Bacteria 5361
361 nmdc:mga0rr50_275636_c1 3300050513 Bacteria 1403
362 nmdc:mga0rr50_362369_c1 3300050513 Unclassified 1220
363 nmdc:mga08x19_2433_c1 3300050514 Bacteria 11304
364 nmdc:mga08x19_2761_c2 3300050514 Bacteria 4221
365 nmdc:mga08x19_27918_c1 3300050514 Bacteria 3532
366 nmdc:mga08x19_41363_c1 3300050514 Bacteria 2935
367 nmdc:mga08x19_52572_c1 3300050514 Bacteria 2620
368 nmdc:mga08x19_5304_c1 3300050514 Bacteria 7621
369 nmdc:mga08x19_84853_c1 3300050514 Bacteria 2084
370 nmdc:mga0a205_123_c1 3300050515 Bacteria 47084
371 nmdc:mga0a205_146878_c1 3300050515 Bacteria 2258
372 nmdc:mga0sz30_3853_c1 3300050516 Bacteria 5404
373 nmdc:mga0sz30_54781_c1 3300050516 Bacteria 1696
374 nmdc:mga0sz30_6187_c1 3300050516 Bacteria 4434
375 Ga0495601_0000653 3300053077 Bacteria 18484
376 Ga0495601_0012669 3300053077 Bacteria 5057
377 Ga0500651_0069195 3300053093 Bacteria 2198
378 Ga0500616_0002553 3300053153 Bacteria 15006
379 Ga0500637_0070764 3300053178 Bacteria 2006
380 Ga0500552_001854 3300053733 Bacteria 2028

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046642 Ga0495634_0275706 Ga0495634_0275706_15_890 290
2 3300050509 nmdc:mga0qj67_317970_c1 nmdc:mga0qj67_317970_c1_184_1056 290
3 3300035170 Ga0373943_0054679 Ga0373943_0054679_15_893 291
4 3300035692 Ga0373935_0002419 Ga0373935_0002419_6342_7298 298
5 3300035695 Ga0373927_0078165 Ga0373927_0078165_336_1292 298
6 3300037068 Ga0373925_0074148 Ga0373925_0074148_481_1437 298
7 3300005330 Ga0070690_100000357 Ga0070690_10000035723 301
8 3300005334 Ga0068869_100000520 Ga0068869_10000052017 301
9 3300005336 Ga0070680_100010887 Ga0070680_1000108874 301
10 3300005337 Ga0070682_100043710 Ga0070682_1000437104 301
11 3300005338 Ga0068868_100000484 Ga0068868_10000048410 301
12 3300005340 Ga0070689_100000576 Ga0070689_10000057621 301
13 3300005341 Ga0070691_10000164 Ga0070691_1000016417 301
14 3300005343 Ga0070687_100000111 Ga0070687_10000011110 301
15 3300005438 Ga0070701_10000124 Ga0070701_1000012420 301
16 3300005440 Ga0070705_100000690 Ga0070705_10000069013 301
17 3300005441 Ga0070700_100000756 Ga0070700_1000007564 301
18 3300005444 Ga0070694_100000476 Ga0070694_10000047619 301
19 3300005458 Ga0070681_10081090 Ga0070681_100810904 301
20 3300005459 Ga0068867_100000433 Ga0068867_10000043327 301
21 3300005530 Ga0070679_100007255 Ga0070679_1000072557 301
22 3300005544 Ga0070686_100000385 Ga0070686_10000038511 301
23 3300005545 Ga0070695_100000228 Ga0070695_10000022810 301
24 3300005546 Ga0070696_100000052 Ga0070696_10000005232 301
25 3300005547 Ga0070693_100000236 Ga0070693_10000023623 301
26 3300005549 Ga0070704_100000314 Ga0070704_10000031419 301
27 3300005563 Ga0068855_100002153 Ga0068855_10000215323 301
28 3300005615 Ga0070702_100000142 Ga0070702_10000014212 301
29 3300005617 Ga0068859_100000605 Ga0068859_10000060539 301
30 3300005718 Ga0068866_10001279 Ga0068866_100012797 301
31 3300005719 Ga0068861_100000164 Ga0068861_10000016427 301
32 3300005842 Ga0068858_100010944 Ga0068858_1000109448 301
33 3300005843 Ga0068860_100002655 Ga0068860_10000265516 301
34 3300005844 Ga0068862_100003943 Ga0068862_1000039437 301
35 3300006358 Ga0068871_100000751 Ga0068871_1000007514 301
36 3300006881 Ga0068865_100000130 Ga0068865_10000013027 301
37 3300006931 Ga0097620_100000605 Ga0097620_10000060510 301
38 3300009098 Ga0105245_10000704 Ga0105245_1000070426 301
39 3300009148 Ga0105243_10000889 Ga0105243_1000088910 301
40 3300009174 Ga0105241_10009322 Ga0105241_100093222 301
41 3300009176 Ga0105242_10000432 Ga0105242_1000043221 301
42 3300009553 Ga0105249_10001318 Ga0105249_1000131820 301
43 3300013297 Ga0157378_10000467 Ga0157378_1000046726 301
44 3300014745 Ga0157377_10051891 Ga0157377_100518912 301
45 3300025912 Ga0207707_10064202 Ga0207707_100642022 301
46 3300025917 Ga0207660_10016611 Ga0207660_100166112 301
47 3300025918 Ga0207662_10000085 Ga0207662_1000008510 301
48 3300025921 Ga0207652_10004867 Ga0207652_100048677 301
49 3300025927 Ga0207687_10005370 Ga0207687_100053702 301
50 3300025931 Ga0207644_10120375 Ga0207644_101203752 301
51 3300025934 Ga0207686_10005085 Ga0207686_100050852 301
52 3300025935 Ga0207709_10003247 Ga0207709_100032477 301
53 3300025936 Ga0207670_10003760 Ga0207670_1000376010 301
54 3300025938 Ga0207704_10002757 Ga0207704_100027577 301
55 3300025942 Ga0207689_10000453 Ga0207689_1000045326 301
56 3300025949 Ga0207667_10013693 Ga0207667_1001369312 301
57 3300026023 Ga0207677_10001292 Ga0207677_100012927 301
58 3300026035 Ga0207703_10110792 Ga0207703_101107922 301
59 3300026075 Ga0207708_10000727 Ga0207708_1000072718 301
60 3300026078 Ga0207702_10010843 Ga0207702_1001084310 301
61 3300026089 Ga0207648_10000398 Ga0207648_1000039853 301
62 3300026118 Ga0207675_100000474 Ga0207675_10000047426 301
63 3300028380 Ga0268265_10003440 Ga0268265_100034407 301
64 3300028381 Ga0268264_10002862 Ga0268264_100028628 301
65 3300035691 Ga0373931_0002972 Ga0373931_0002972_6083_7036 301
66 3300035691 Ga0373931_0044751 Ga0373931_0044751_993_1958 301
67 3300005539 Ga0068853_100130859 Ga0068853_1001308592 302
68 3300025899 Ga0207642_10002671 Ga0207642_100026716 302
69 3300026041 Ga0207639_10187702 Ga0207639_101877022 302
70 3300035092 Ga0373952_0003990 Ga0373952_0003990_10_924 302
71 3300014326 Ga0157380_10006105 Ga0157380_100061057 303
72 3300035084 Ga0373928_0008432 Ga0373928_0008432_12_980 303
73 3300035090 Ga0373949_0003396 Ga0373949_0003396_182_1156 303
74 3300035091 Ga0373951_0005482 Ga0373951_0005482_1685_2659 303
75 3300035112 Ga0373932_0000211 Ga0373932_0000211_5186_6160 303
76 3300035115 Ga0373941_0007944 Ga0373941_0007944_636_1610 303
77 3300035207 Ga0373942_0002189 Ga0373942_0002189_1008_1982 303
78 3300035241 Ga0373961_0046736 Ga0373961_0046736_211_1164 303
79 3300035691 Ga0373931_0000137 Ga0373931_0000137_24303_25277 303
80 3300045051 Ga0451576_0009202 Ga0451576_0009202_8830_9804 303
81 3300050512 nmdc:mga0n895_369711_c1 nmdc:mga0n895_369711_c1_423_1385 303
82 3300050513 nmdc:mga0rr50_275636_c1 nmdc:mga0rr50_275636_c1_61_1023 303
83 3300006844 Ga0075428_100026384 Ga0075428_1000263843 304
84 3300006880 Ga0075429_100003966 Ga0075429_10000396613 304
85 3300044706 Ga0466964_0022905 Ga0466964_0022905_95_1069 306
86 3300044842 Ga0466957_0177474 Ga0466957_0177474_61_1035 306
87 3300045976 Ga0466967_0012686 Ga0466967_0012686_1010_1984 306
88 3300050507 nmdc:mga05p37_3420_c1 nmdc:mga05p37_3420_c1_5151_6104 306
89 3300050508 nmdc:mga09592_1997_c1 nmdc:mga09592_1997_c1_6938_7891 306
90 3300025921 Ga0207652_10044087 Ga0207652_100440875 307
91 3300025929 Ga0207664_10043596 Ga0207664_100435965 307
92 3300042876 Ga0451577_0047030 Ga0451577_0047030_1141_2106 307
93 3300045051 Ga0451576_0001414 Ga0451576_0001414_20351_21316 307
94 3300049742 Ga0501080_0110402 Ga0501080_0110402_29_976 308
95 3300009094 Ga0111539_10021942 Ga0111539_100219423 311
96 3300009177 Ga0105248_10314301 Ga0105248_103143012 311
97 3300025931 Ga0207644_10049941 Ga0207644_100499412 311
98 3300027907 Ga0207428_10094512 Ga0207428_100945121 311
99 3300031911 Ga0307412_10079043 Ga0307412_100790433 311
100 3300032002 Ga0307416_100009063 Ga0307416_1000090635 311
101 3300035111 Ga0373923_0022648 Ga0373923_0022648_390_1343 311
102 3300035117 Ga0373953_0061926 Ga0373953_0061926_271_1224 311
103 3300035119 Ga0373956_0038192 Ga0373956_0038192_113_1066 311
104 3300035724 Ga0373933_0025905 Ga0373933_0025905_1850_2803 311
105 3300036401 Ga0373937_0117288 Ga0373937_0117288_320_1273 311
106 3300041496 Ga0451839_1561726 Ga0451839_1561726_545_1501 311
107 3300046664 Ga0495659_0057426 Ga0495659_0057426_175_1122 311
108 3300047322 Ga0495680_0312494 Ga0495680_0312494_22_975 311
109 3300050511 nmdc:mga08y16_48966_c1 nmdc:mga08y16_48966_c1_26_973 311
110 3300005330 Ga0070690_100003371 Ga0070690_1000033715 312
111 3300005340 Ga0070689_100076117 Ga0070689_1000761173 312
112 3300005341 Ga0070691_10006622 Ga0070691_100066225 312
113 3300005343 Ga0070687_100102305 Ga0070687_1001023051 312
114 3300005444 Ga0070694_100092168 Ga0070694_1000921682 312
115 3300005545 Ga0070695_100023240 Ga0070695_1000232402 312
116 3300006237 Ga0097621_100011858 Ga0097621_1000118585 312
117 3300006358 Ga0068871_100000765 Ga0068871_10000076515 312
118 3300006871 Ga0075434_100000484 Ga0075434_10000048416 312
119 3300006914 Ga0075436_100040302 Ga0075436_1000403022 312
120 3300007076 Ga0075435_100032223 Ga0075435_1000322232 312
121 3300014968 Ga0157379_10226243 Ga0157379_102262432 312
122 3300014969 Ga0157376_10070818 Ga0157376_100708182 312
123 3300025918 Ga0207662_10114114 Ga0207662_101141142 312
124 3300025936 Ga0207670_10053886 Ga0207670_100538863 312
125 3300025981 Ga0207640_10222616 Ga0207640_102226162 312
126 3300033180 Ga0307510_10002158 Ga0307510_1000215810 312
127 3300035113 Ga0373936_0062568 Ga0373936_0062568_506_1462 312
128 3300035117 Ga0373953_0026747 Ga0373953_0026747_472_1428 312
129 3300035121 Ga0373960_0026534 Ga0373960_0026534_405_1361 312
130 3300035724 Ga0373933_0008350 Ga0373933_0008350_2315_3271 312
131 3300036401 Ga0373937_0009214 Ga0373937_0009214_4120_5070 312
132 3300036401 Ga0373937_0024351 Ga0373937_0024351_342_1298 312
133 3300046454 Ga0495592_0000480 Ga0495592_0000480_17635_18585 312
134 3300046463 Ga0495653_0048235 Ga0495653_0048235_1281_2231 312
135 3300046476 Ga0495662_0061419 Ga0495662_0061419_396_1346 312
136 3300046511 Ga0495608_0000927 Ga0495608_0000927_3923_4873 312
137 3300046516 Ga0495628_0005055 Ga0495628_0005055_3081_4031 312
138 3300046517 Ga0495630_0041513 Ga0495630_0041513_2037_2987 312
139 3300046529 Ga0495652_0067697 Ga0495652_0067697_384_1334 312
140 3300046533 Ga0495640_0000451 Ga0495640_0000451_13939_14889 312
141 3300046535 Ga0495586_0000742 Ga0495586_0000742_5702_6652 312
142 3300046559 Ga0495667_0011791 Ga0495667_0011791_4956_5906 312
143 3300046642 Ga0495634_0005311 Ga0495634_0005311_5429_6379 312
144 3300046663 Ga0495635_0056448 Ga0495635_0056448_1233_2183 312
145 3300046675 Ga0495657_0108872 Ga0495657_0108872_732_1682 312
146 3300046678 Ga0495599_0028837 Ga0495599_0028837_775_1725 312
147 3300046683 Ga0495658_0002414 Ga0495658_0002414_3433_4383 312
148 3300046689 Ga0495613_0002166 Ga0495613_0002166_11050_12000 312
149 3300046690 Ga0495624_0053420 Ga0495624_0053420_601_1551 312
150 3300046809 Ga0495600_0002385 Ga0495600_0002385_7730_8680 312
151 3300047317 Ga0495604_0001344 Ga0495604_0001344_11723_12673 312
152 3300047318 Ga0495636_0002552 Ga0495636_0002552_3606_4556 312
153 3300047322 Ga0495680_0000202 Ga0495680_0000202_10061_11011 312
154 3300047322 Ga0495680_0213774 Ga0495680_0213774_413_1369 312
155 3300047471 Ga0495684_0053792 Ga0495684_0053792_122_1072 312
156 3300047673 Ga0495593_0066531 Ga0495593_0066531_625_1575 312
157 3300050512 nmdc:mga0n895_367_c1 nmdc:mga0n895_367_c1_13843_14811 312
158 3300050514 nmdc:mga08x19_52572_c1 nmdc:mga08x19_52572_c1_68_1030 312
159 3300050515 nmdc:mga0a205_146878_c1 nmdc:mga0a205_146878_c1_831_1799 312
160 3300053077 Ga0495601_0012669 Ga0495601_0012669_410_1360 312
161 3300005329 Ga0070683_100035374 Ga0070683_1000353744 313
162 3300005330 Ga0070690_100027148 Ga0070690_1000271484 313
163 3300005355 Ga0070671_100118008 Ga0070671_1001180084 313
164 3300005458 Ga0070681_10014067 Ga0070681_100140675 313
165 3300005530 Ga0070679_100057076 Ga0070679_1000570765 313
166 3300005535 Ga0070684_100035445 Ga0070684_1000354454 313
167 3300005544 Ga0070686_100002491 Ga0070686_1000024919 313
168 3300006358 Ga0068871_100002204 Ga0068871_1000022049 313
169 3300007265 Ga0099794_10100023 Ga0099794_101000232 313
170 3300009148 Ga0105243_10002986 Ga0105243_100029864 313
171 3300014326 Ga0157380_10011899 Ga0157380_100118992 313
172 3300025912 Ga0207707_10006672 Ga0207707_100066724 313
173 3300025931 Ga0207644_10156264 Ga0207644_101562642 313
174 3300025944 Ga0207661_10145965 Ga0207661_101459652 313
175 3300034819 Ga0373958_0001239 Ga0373958_0001239_411_1364 313
176 3300035171 Ga0373946_0006980 Ga0373946_0006980_187_1164 313
177 3300035691 Ga0373931_0005650 Ga0373931_0005650_109_1068 313
178 3300037068 Ga0373925_0022983 Ga0373925_0022983_3072_4049 313
179 3300045051 Ga0451576_0018034 Ga0451576_0018034_845_1798 313
180 3300046455 Ga0495603_0108422 Ga0495603_0108422_607_1584 313
181 3300046472 Ga0495580_0002339 Ga0495580_0002339_8982_9959 313
182 3300046475 Ga0495639_0008859 Ga0495639_0008859_2515_3492 313
183 3300046499 Ga0495594_0046867 Ga0495594_0046867_546_1523 313
184 3300046517 Ga0495630_0064960 Ga0495630_0064960_125_1078 313
185 3300046524 Ga0495648_0143496 Ga0495648_0143496_42_989 313
186 3300046535 Ga0495586_0081230 Ga0495586_0081230_632_1609 313
187 3300046681 Ga0495647_0014396 Ga0495647_0014396_1286_2263 313
188 3300046683 Ga0495658_0027184 Ga0495658_0027184_442_1419 313
189 3300046684 Ga0495669_0044796 Ga0495669_0044796_104_1057 313
190 3300046684 Ga0495669_0114513 Ga0495669_0114513_195_1136 313
191 3300047315 Ga0495581_0111242 Ga0495581_0111242_579_1556 313
192 3300047321 Ga0495676_0054135 Ga0495676_0054135_976_1953 313
193 3300050511 nmdc:mga08y16_128036_c1 nmdc:mga08y16_128036_c1_1275_2228 313
194 3300050514 nmdc:mga08x19_27918_c1 nmdc:mga08x19_27918_c1_1632_2585 313
195 3300005345 Ga0070692_10013233 Ga0070692_100132334 314
196 3300005353 Ga0070669_100303091 Ga0070669_1003030911 314
197 3300005354 Ga0070675_100044481 Ga0070675_1000444813 314
198 3300005355 Ga0070671_100050324 Ga0070671_1000503243 314
199 3300005355 Ga0070671_100171788 Ga0070671_1001717882 314
200 3300005364 Ga0070673_100207972 Ga0070673_1002079722 314
201 3300005365 Ga0070688_100081134 Ga0070688_1000811341 314
202 3300005367 Ga0070667_100117589 Ga0070667_1001175892 314
203 3300005456 Ga0070678_100061692 Ga0070678_1000616923 314
204 3300005457 Ga0070662_100038408 Ga0070662_1000384083 314
205 3300005543 Ga0070672_100115684 Ga0070672_1001156841 314
206 3300005615 Ga0070702_100095798 Ga0070702_1000957982 314
207 3300006237 Ga0097621_100183315 Ga0097621_1001833152 314
208 3300006358 Ga0068871_100045206 Ga0068871_1000452062 314
209 3300006358 Ga0068871_100150624 Ga0068871_1001506242 314
210 3300006881 Ga0068865_100272885 Ga0068865_1002728851 314
211 3300009098 Ga0105245_10062770 Ga0105245_100627702 314
212 3300009176 Ga0105242_10019302 Ga0105242_100193023 314
213 3300009177 Ga0105248_10281574 Ga0105248_102815742 314
214 3300014326 Ga0157380_10035234 Ga0157380_100352343 314
215 3300014968 Ga0157379_10228332 Ga0157379_102283322 314
216 3300014969 Ga0157376_10213660 Ga0157376_102136602 314
217 3300017792 Ga0163161_10033979 Ga0163161_100339791 314
218 3300025315 Ga0207697_10060222 Ga0207697_100602222 314
219 3300025893 Ga0207682_10003726 Ga0207682_100037265 314
220 3300025901 Ga0207688_10011774 Ga0207688_100117745 314
221 3300025903 Ga0207680_10211090 Ga0207680_102110901 314
222 3300025907 Ga0207645_10013737 Ga0207645_100137372 314
223 3300025908 Ga0207643_10007966 Ga0207643_100079662 314
224 3300025918 Ga0207662_10006328 Ga0207662_100063282 314
225 3300025925 Ga0207650_10012754 Ga0207650_100127545 314
226 3300025926 Ga0207659_10017177 Ga0207659_100171773 314
227 3300025933 Ga0207706_10013885 Ga0207706_100138853 314
228 3300025942 Ga0207689_10010051 Ga0207689_100100516 314
229 3300025986 Ga0207658_10179509 Ga0207658_101795091 314
230 3300026075 Ga0207708_10012092 Ga0207708_100120923 314
231 3300026088 Ga0207641_10064435 Ga0207641_100644353 314
232 3300026089 Ga0207648_10008635 Ga0207648_100086354 314
233 3300026095 Ga0207676_10001836 Ga0207676_100018366 314
234 3300035086 Ga0373934_0006482 Ga0373934_0006482_1701_2657 314
235 3300035118 Ga0373954_0000001 Ga0373954_0000001_37830_38786 314
236 3300035724 Ga0373933_0016343 Ga0373933_0016343_412_1368 314
237 3300036401 Ga0373937_0003140 Ga0373937_0003140_11123_12079 314
238 3300046559 Ga0495667_0072303 Ga0495667_0072303_655_1620 314
239 3300048917 Ga0496114_0296995 Ga0496114_0296995_333_1295 314
240 3300053733 Ga0500552_001854 Ga0500552_001854_950_1951 314
241 3300005444 Ga0070694_100127353 Ga0070694_1001273532 315
242 3300005549 Ga0070704_100056080 Ga0070704_1000560803 315
243 3300005549 Ga0070704_100068626 Ga0070704_1000686262 315
244 3300005615 Ga0070702_100052482 Ga0070702_1000524821 315
245 3300006914 Ga0075436_100002507 Ga0075436_10000250712 315
246 3300035114 Ga0373939_0013758 Ga0373939_0013758_863_1828 315
247 3300050514 nmdc:mga08x19_2761_c2 nmdc:mga08x19_2761_c2_3132_4103 315
248 3300005334 Ga0068869_100019915 Ga0068869_1000199153 316
249 3300005334 Ga0068869_100095305 Ga0068869_1000953052 316
250 3300005347 Ga0070668_100235827 Ga0070668_1002358272 316
251 3300005353 Ga0070669_100038680 Ga0070669_1000386804 316
252 3300005354 Ga0070675_100022663 Ga0070675_1000226633 316
253 3300005364 Ga0070673_100046530 Ga0070673_1000465304 316
254 3300005435 Ga0070714_100122048 Ga0070714_1001220483 316
255 3300005441 Ga0070700_100002462 Ga0070700_10000246214 316
256 3300005444 Ga0070694_100022908 Ga0070694_1000229085 316
257 3300005444 Ga0070694_100122398 Ga0070694_1001223982 316
258 3300005457 Ga0070662_100333767 Ga0070662_1003337671 316
259 3300005459 Ga0068867_100003815 Ga0068867_1000038152 316
260 3300005518 Ga0070699_100247074 Ga0070699_1002470741 316
261 3300005545 Ga0070695_100058855 Ga0070695_1000588553 316
262 3300005546 Ga0070696_100024656 Ga0070696_1000246564 316
263 3300005549 Ga0070704_100004103 Ga0070704_1000041033 316
264 3300005617 Ga0068859_100106720 Ga0068859_1001067202 316
265 3300005618 Ga0068864_100044703 Ga0068864_1000447033 316
266 3300005719 Ga0068861_100000293 Ga0068861_1000002934 316
267 3300005842 Ga0068858_100044336 Ga0068858_1000443362 316
268 3300005843 Ga0068860_100170201 Ga0068860_1001702012 316
269 3300005844 Ga0068862_100001004 Ga0068862_10000100415 316
270 3300005985 Ga0081539_10000805 Ga0081539_1000080537 316
271 3300006175 Ga0070712_100178258 Ga0070712_1001782581 316
272 3300006871 Ga0075434_100000071 Ga0075434_10000007142 316
273 3300006914 Ga0075436_100000205 Ga0075436_10000020542 316
274 3300006914 Ga0075436_100000538 Ga0075436_10000053826 316
275 3300006914 Ga0075436_100009750 Ga0075436_1000097508 316
276 3300006914 Ga0075436_100028529 Ga0075436_1000285295 316
277 3300006931 Ga0097620_100106717 Ga0097620_1001067172 316
278 3300007076 Ga0075435_100001818 Ga0075435_10000181816 316
279 3300009094 Ga0111539_10006154 Ga0111539_100061548 316
280 3300014745 Ga0157377_10133860 Ga0157377_101338602 316
281 3300025908 Ga0207643_10059851 Ga0207643_100598512 316
282 3300025917 Ga0207660_10044224 Ga0207660_100442244 316
283 3300025917 Ga0207660_10050368 Ga0207660_100503683 316
284 3300025923 Ga0207681_10020995 Ga0207681_100209953 316
285 3300025926 Ga0207659_10170716 Ga0207659_101707162 316
286 3300025933 Ga0207706_10371291 Ga0207706_103712912 316
287 3300025935 Ga0207709_10002937 Ga0207709_1000293716 316
288 3300025938 Ga0207704_10000432 Ga0207704_100004322 316
289 3300025942 Ga0207689_10130970 Ga0207689_101309701 316
290 3300025960 Ga0207651_10221637 Ga0207651_102216372 316
291 3300025972 Ga0207668_10245768 Ga0207668_102457682 316
292 3300026035 Ga0207703_10110094 Ga0207703_101100942 316
293 3300026075 Ga0207708_10000264 Ga0207708_1000026415 316
294 3300026078 Ga0207702_10375339 Ga0207702_103753392 316
295 3300026089 Ga0207648_10000863 Ga0207648_1000086315 316
296 3300026095 Ga0207676_10122558 Ga0207676_101225582 316
297 3300027907 Ga0207428_10030322 Ga0207428_100303222 316
298 3300027907 Ga0207428_10230288 Ga0207428_102302881 316
299 3300028380 Ga0268265_10003037 Ga0268265_1000303718 316
300 3300028381 Ga0268264_10083406 Ga0268264_100834063 316
301 3300050511 nmdc:mga08y16_3948_c1 nmdc:mga08y16_3948_c1_5278_6264 316
302 3300050512 nmdc:mga0n895_59333_c1 nmdc:mga0n895_59333_c1_2120_3106 316
303 3300050513 nmdc:mga0rr50_13254_c1 nmdc:mga0rr50_13254_c1_3011_3997 316
304 3300050513 nmdc:mga0rr50_362369_c1 nmdc:mga0rr50_362369_c1_150_1124 316
305 3300050514 nmdc:mga08x19_2433_c1 nmdc:mga08x19_2433_c1_4265_5239 316
306 3300050514 nmdc:mga08x19_41363_c1 nmdc:mga08x19_41363_c1_523_1500 316
307 3300050514 nmdc:mga08x19_5304_c1 nmdc:mga08x19_5304_c1_3497_4483 316
308 3300050514 nmdc:mga08x19_84853_c1 nmdc:mga08x19_84853_c1_790_1746 316
309 3300050515 nmdc:mga0a205_123_c1 nmdc:mga0a205_123_c1_2744_3730 316
310 3300005471 Ga0070698_100004802 Ga0070698_1000048028 317
311 3300005563 Ga0068855_100085712 Ga0068855_1000857124 317
312 3300005614 Ga0068856_100057053 Ga0068856_1000570532 317
313 3300009545 Ga0105237_10436810 Ga0105237_104368102 317
314 3300009551 Ga0105238_10123541 Ga0105238_101235413 317
315 3300010375 Ga0105239_10083882 Ga0105239_100838822 317
316 3300013105 Ga0157369_10461787 Ga0157369_104617871 317
317 3300013307 Ga0157372_10227385 Ga0157372_102273852 317
318 3300025910 Ga0207684_10047916 Ga0207684_100479165 317
319 3300025913 Ga0207695_10065213 Ga0207695_100652134 317
320 3300025924 Ga0207694_10057985 Ga0207694_100579852 317
321 3300025949 Ga0207667_10087146 Ga0207667_100871462 317
322 3300026078 Ga0207702_10063576 Ga0207702_100635763 317
323 3300036401 Ga0373937_0060506 Ga0373937_0060506_2330_3283 317
324 3300037312 Ga0395899_0011178 Ga0395899_0011178_1967_2947 317
325 3300037418 Ga0395900_0058485 Ga0395900_0058485_483_1463 317
326 3300037466 Ga0395898_0007037 Ga0395898_0007037_7432_8412 317
327 3300038443 Ga0395901_0007035 Ga0395901_0007035_9693_10673 317
328 3300038443 Ga0395901_0031563 Ga0395901_0031563_2985_3965 317
329 3300039438 Ga0436360_0549693 Ga0436360_0549693_5987_7000 317
330 3300039447 Ga0436361_0689478 Ga0436361_0689478_585_1598 317
331 3300046454 Ga0495592_0009566 Ga0495592_0009566_3649_4602 317
332 3300046461 Ga0495641_0025216 Ga0495641_0025216_679_1632 317
333 3300046516 Ga0495628_0001549 Ga0495628_0001549_5106_6059 317
334 3300046529 Ga0495652_0044175 Ga0495652_0044175_1391_2344 317
335 3300046543 Ga0495645_0127879 Ga0495645_0127879_741_1694 317
336 3300046557 Ga0495622_0083024 Ga0495622_0083024_367_1320 317
337 3300049571 Ga0501034_0253235 Ga0501034_0253235_117_1097 317
338 3300053077 Ga0495601_0000653 Ga0495601_0000653_9356_10309 317
339 3300005545 Ga0070695_100047649 Ga0070695_1000476492 319
340 3300053153 Ga0500616_0002553 Ga0500616_0002553_364_1350 319
341 3300005937 Ga0081455_10127061 Ga0081455_101270611 320
342 3300005985 Ga0081539_10016034 Ga0081539_100160344 320
343 3300006038 Ga0075365_10088125 Ga0075365_100881253 320
344 3300006177 Ga0075362_10004886 Ga0075362_100048865 320
345 3300006177 Ga0075362_10011835 Ga0075362_100118353 320
346 3300006186 Ga0075369_10000948 Ga0075369_100009488 320
347 3300006186 Ga0075369_10031769 Ga0075369_100317692 320
348 3300006195 Ga0075366_10066557 Ga0075366_100665572 320
349 3300026116 Ga0207674_10370703 Ga0207674_103707032 320
350 3300049571 Ga0501034_0038395 Ga0501034_0038395_2213_3184 320
351 3300050489 nmdc:mga03683_9275_c1 nmdc:mga03683_9275_c1_1547_2518 320
352 3300050492 nmdc:mga0yw44_78649_c1 nmdc:mga0yw44_78649_c1_1018_1986 320
353 3300050516 nmdc:mga0sz30_6187_c1 nmdc:mga0sz30_6187_c1_3410_4381 320
354 3300053093 Ga0500651_0069195 Ga0500651_0069195_392_1363 320
355 3300050494 nmdc:mga06z11_121440_c1 nmdc:mga06z11_121440_c1_402_1376 322
356 3300050516 nmdc:mga0sz30_3853_c1 nmdc:mga0sz30_3853_c1_377_1351 322
357 3300050516 nmdc:mga0sz30_54781_c1 nmdc:mga0sz30_54781_c1_450_1427 322
358 3300053178 Ga0500637_0070764 Ga0500637_0070764_730_1821 322
359 3300005937 Ga0081455_10027558 Ga0081455_100275583 323
360 3300048904 Ga0496101_0175604 Ga0496101_0175604_360_1349 325
361 3300048908 Ga0496105_0200013 Ga0496105_0200013_331_1320 325
362 3300048917 Ga0496114_0230330 Ga0496114_0230330_611_1600 325
363 3300028573 Ga0265334_10031002 Ga0265334_100310022 326
364 3300031251 Ga0265327_10065506 Ga0265327_100655062 326
365 3300035692 Ga0373935_0230800 Ga0373935_0230800_73_1059 326
366 3300035725 Ga0373947_0017383 Ga0373947_0017383_2921_3910 326
367 3300047319 Ga0495674_0059322 Ga0495674_0059322_480_1469 326
368 3300005327 Ga0070658_10004552 Ga0070658_100045527 327
369 3300005336 Ga0070680_100012192 Ga0070680_1000121926 327
370 3300005341 Ga0070691_10003736 Ga0070691_100037362 327
371 3300005458 Ga0070681_10020775 Ga0070681_100207752 327
372 3300005530 Ga0070679_100006386 Ga0070679_1000063866 327
373 3300005563 Ga0068855_100149550 Ga0068855_1001495503 327
374 3300009093 Ga0105240_10019564 Ga0105240_100195645 327
375 3300025909 Ga0207705_10007445 Ga0207705_100074455 327
376 3300025912 Ga0207707_10015917 Ga0207707_100159176 327
377 3300025913 Ga0207695_10039875 Ga0207695_100398753 327
378 3300025917 Ga0207660_10204586 Ga0207660_102045862 327
379 3300025921 Ga0207652_10101921 Ga0207652_101019213 327
380 3300025949 Ga0207667_10076078 Ga0207667_100760783 327

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

68

341

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9732 33 327
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9687 30 327
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9634 30 327
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9624 30 327
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9591 30 327
ID Description Score Start End Superfamily
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9559 129 252 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9532 131 252 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9485 129 252 3.40.190.10
2dvzA01 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Bordetella uptake gene, domain 1 0.9449 30 327 3.40.190.150
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9411 129 247 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A537BWJ9-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9821 27 327
AF-A0A536TSZ2-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9811 27 232
AF-A0A1J5PQ67-F1-model_v4 Tripartite tricarboxylate transporter family receptor 0.9807 68 326
AF-A0A7C2YTZ7-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9797 27 327
AF-A0A2T7SUP8-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.979 29 327

Feature Viewer

pLDDT pTM Quality
90.19 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map