F428806

General Info

Members Datasets Scaffolds Average Seq Length
380 296 357 272

Family's Representative Sequence

Representative Sequence 3300050491|nmdc:mga00v17_1001_c1|nmdc:mga00v17_1001_c1_5371_6297
Length 308
Sequence MPIDLGNPLATPTATARDNRAPPDLPWRTMLDQHTYESLRETDMTDILDFTGKTVFVAGGSSGINLGIAQAFAQRGARVAIISRSQERVDAAVAGIRALGGDAHGWSADVRDPDAVMAALSSAHAALGDFDVLVSGAAGNFLASALGMSSNAFRTVVDIDLNGTFNVLRHAHPYLRKPGASVINISAPQAVNPTPLQAHVCAAKAGVDMLTRVLAMEWGADGIRVNAITPGPIADTEGMRRMAPTDEAMAAVARSVPLGRMGRLDEIANIALMLSSPLASFVTGAILPVDGGSSLGGARKLDASWTQR

Samples

Sample ID Description Type Environment
1 2524614857 Deinococcus ficus DSM 19119 Isolate Rhizosphere
2 2643221541 Sphingomonas sp. Root50 Isolate Unclassified
3 2643221606 Sphingomonas sp. Root720 Isolate Unclassified
4 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
5 2643221658 Variovorax sp. Root411 Isolate Unclassified
6 2643221671 Sphingomonas sp. Root1294 Isolate Unclassified
7 2643221672 Variovorax sp. Root434 Isolate Unclassified
8 2643221692 Nocardia sp. Root136 Isolate Unclassified
9 2643221717 Acidovorax sp. Root267 Isolate Unclassified
10 2738543011 Rhodococcus sp. OK611 Isolate Unclassified
11 2739367875 Deinococcus ficus CC-FR2-10 Isolate Unclassified
12 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
13 2842677519 Variovorax sp. R-72495 Isolate Unclassified
14 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
15 2857710386 Brevibacterium sp. R-73093 Isolate Unclassified
16 2889300758 Rhodococcus sp. PvR099 Isolate Rhizosphere
17 2919704043 Hydrogenophaga palleronii 4249 Isolate Unclassified
18 2929520902 Variovorax beijingensis 502 Isolate Unclassified
19 2932422444 Comamonas sp. 4034 Isolate Rhizosphere
20 2939743619 Rhodococcus sp. PvR044 Isolate Rhizosphere
21 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
22 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
23 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
24 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
25 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
26 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
27 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
28 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
29 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
30 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
31 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
32 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
33 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
34 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
35 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
36 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
37 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
38 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
39 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
40 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
41 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
42 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
43 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
44 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
45 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
49 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
50 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
51 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
52 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
53 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
54 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
55 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
56 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
57 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
58 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
59 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
60 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
61 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
62 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
63 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
64 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
65 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
66 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
67 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
68 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
69 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
70 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
71 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
72 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
73 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
74 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
79 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
80 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
86 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
91 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
92 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
103 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
104 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
110 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
111 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
112 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
113 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
120 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
121 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
122 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
123 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
124 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
125 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
126 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
127 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
129 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
132 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
133 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
134 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
135 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
136 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
175 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
176 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
177 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
180 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
181 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
182 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
183 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
184 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
185 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
186 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
187 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
188 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
189 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
190 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
191 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
194 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
195 3300032139 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_160517rDrB Metagenome Rhizosphere
196 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
197 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
198 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
199 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
200 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
201 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
202 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
203 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
204 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
205 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
206 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
207 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
208 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
209 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
210 3300038741 Seagrass microbial communities from Seahorse Key, FL, USA - SV0818 Metagenome Unclassified
211 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
212 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
213 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
214 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
215 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
216 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
217 3300042123 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_082716_2228 Metagenome Rhizosphere
218 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
219 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
220 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
221 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
222 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
223 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
224 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
225 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
226 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
227 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
228 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
229 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
230 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
231 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
232 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
233 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
234 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
235 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
236 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
237 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
238 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
239 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
240 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
241 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
242 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
243 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
244 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
245 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
246 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
247 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
248 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
249 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
250 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
251 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
252 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
253 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
254 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
255 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
256 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
257 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
258 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
259 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
260 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
261 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
262 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
263 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
264 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
265 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
266 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
267 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
268 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
269 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
270 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
271 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
272 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
273 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
274 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
275 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
276 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
277 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
280 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
281 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
282 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
283 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
284 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
285 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
286 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
287 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
288 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
289 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
290 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
291 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
292 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
293 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
294 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
295 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
296 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.95
Metatranscriptomes 0.53
Isolates 5.53

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 10.79
Nodule 1.05
Rhizoplane 3.16
Rhizosphere 75.53
Stem 0
Stem Tuber 0
Unclassified 9.47

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24746J21847_1008952 3300001977 Bacteria 1503
2 JGI24739J22299_10021747 3300001989 Bacteria 2280
3 JGI24750J21931_1001006 3300002070 Bacteria 3701
4 JGI24745J21846_1002890 3300002073 Bacteria 1776
5 JGI24738J21930_10013123 3300002075 Bacteria 1797
6 JGI24744J21845_10011927 3300002077 Bacteria 1769
7 JGI24742J22300_10017728 3300002244 Bacteria 1205
8 JGI25151J46595_10000212 3300003187 Bacteria 70741
9 JGI25160J50197_1004779 3300003354 Bacteria 5784
10 Ga0006562J51391_1051197 3300003578 Bacteria 6640
11 Ga0006562J51391_1051202 3300003578 Bacteria 1520
12 Ga0055537_1000064 3300003773 Bacteria 77134
13 Ga0055534_1000094 3300003784 Bacteria 70029
14 Ga0055530_10007178 3300003791 Bacteria 4758
15 Ga0055540_1002876 3300003792 Bacteria 8740
16 Ga0055531_10000084 3300003794 Bacteria 102550
17 Ga0065714_10003682 3300005288 Bacteria 7115
18 Ga0065714_10090003 3300005288 Bacteria 1959
19 Ga0070658_10072178 3300005327 Bacteria 2828
20 Ga0070676_10083145 3300005328 Bacteria 1946
21 Ga0068869_100045095 3300005334 Bacteria 3173
22 Ga0068869_100332605 3300005334 Bacteria 1234
23 Ga0070666_10152851 3300005335 Bacteria 1610
24 Ga0070680_100379330 3300005336 Bacteria 1204
25 Ga0068868_100019180 3300005338 Bacteria 5124
26 Ga0068868_100249859 3300005338 Bacteria 1492
27 Ga0070689_100041496 3300005340 Bacteria 3532
28 Ga0070691_10187274 3300005341 Bacteria 1080
29 Ga0070669_100334082 3300005353 Bacteria 1226
30 Ga0070675_100416603 3300005354 Bacteria 1201
31 Ga0070674_100006794 3300005356 Bacteria 6703
32 Ga0070674_100011568 3300005356 Bacteria 5379
33 Ga0070674_100325021 3300005356 Bacteria 1234
34 Ga0070688_100268406 3300005365 Bacteria 1221
35 Ga0070659_100149543 3300005366 Bacteria 1904
36 Ga0070667_100019846 3300005367 Bacteria 5577
37 Ga0070667_100252405 3300005367 Bacteria 1577
38 Ga0070667_100406656 3300005367 Bacteria 1239
39 Ga0070709_10375706 3300005434 Bacteria 1055
40 Ga0070701_10180810 3300005438 Bacteria 1234
41 Ga0070711_100063391 3300005439 Bacteria 2580
42 Ga0070705_100461268 3300005440 Bacteria 955
43 Ga0070700_100067847 3300005441 Bacteria 2266
44 Ga0070694_100298096 3300005444 Bacteria 1234
45 Ga0070678_100000638 3300005456 Bacteria 17152
46 Ga0070678_100009249 3300005456 Bacteria 5957
47 Ga0070662_100270253 3300005457 Bacteria 1372
48 Ga0070681_10764342 3300005458 Bacteria 883
49 Ga0068867_100074420 3300005459 Bacteria 2546
50 Ga0070685_10136683 3300005466 Bacteria 1538
51 Ga0070706_100178668 3300005467 Unclassified 1981
52 Ga0070698_100165590 3300005471 Bacteria 2154
53 Ga0070697_100130447 3300005536 Bacteria 2107
54 Ga0068853_100433398 3300005539 Bacteria 1234
55 Ga0070672_100003347 3300005543 Bacteria 10387
56 Ga0070672_100031279 3300005543 Bacteria 4005
57 Ga0070672_100176161 3300005543 Bacteria 1780
58 Ga0070672_100421791 3300005543 Bacteria 1146
59 Ga0070686_100123538 3300005544 Bacteria 1781
60 Ga0070695_100409308 3300005545 Bacteria 1030
61 Ga0070696_100232111 3300005546 Bacteria 1388
62 Ga0070693_100236899 3300005547 Bacteria 1203
63 Ga0070665_100044857 3300005548 Bacteria 4438
64 Ga0070665_100246651 3300005548 Bacteria 1786
65 Ga0070704_100240793 3300005549 Bacteria 1480
66 Ga0068855_100154530 3300005563 Bacteria 2607
67 Ga0068854_100168968 3300005578 Bacteria 1700
68 Ga0068854_100180071 3300005578 Bacteria 1650
69 Ga0068856_100509483 3300005614 Bacteria 1224
70 Ga0068856_100624139 3300005614 Bacteria 1099
71 Ga0070702_100234749 3300005615 Bacteria 1234
72 Ga0068859_100583491 3300005617 Bacteria 1211
73 Ga0068859_100585560 3300005617 Bacteria 1209
74 Ga0068866_10154453 3300005718 Bacteria 1332
75 Ga0068851_10021874 3300005834 Bacteria 3109
76 Ga0068863_100020929 3300005841 Bacteria 6248
77 Ga0068863_100486971 3300005841 Bacteria 1213
78 Ga0068858_100161955 3300005842 Bacteria 2106
79 Ga0068860_100345545 3300005843 Bacteria 1463
80 Ga0068860_100947830 3300005843 Bacteria 878
81 Ga0068862_100459710 3300005844 Bacteria 1201
82 Ga0081538_10004482 3300005981 Bacteria 12859
83 Ga0081538_10019211 3300005981 Bacteria 5091
84 Ga0081540_1017771 3300005983 Bacteria 4391
85 Ga0075365_10122496 3300006038 Bacteria 1795
86 Ga0075363_100047590 3300006048 Bacteria 2278
87 Ga0075364_10001206 3300006051 Bacteria 13887
88 Ga0075364_10093595 3300006051 Bacteria 1995
89 Ga0075432_10023270 3300006058 Bacteria 2122
90 Ga0070712_100331264 3300006175 Bacteria 1240
91 Ga0075366_10091065 3300006195 Bacteria 1827
92 Ga0097621_100010631 3300006237 Bacteria 6743
93 Ga0075370_10054496 3300006353 Bacteria 2271
94 Ga0075370_10110108 3300006353 Bacteria 1599
95 Ga0075370_10184512 3300006353 Bacteria 1228
96 Ga0068871_100044256 3300006358 Bacteria 3579
97 Ga0068871_100392612 3300006358 Bacteria 1234
98 Ga0075436_100150498 3300006914 Bacteria 1638
99 Ga0097620_100583501 3300006931 Bacteria 1211
100 Ga0097620_100585555 3300006931 Bacteria 1209
101 Ga0099826_10028171 3300006948 Bacteria 4114
102 Ga0099826_10121823 3300006948 Bacteria 1535
103 Ga0099826_10132761 3300006948 Bacteria 1449
104 Ga0075435_100102913 3300007076 Bacteria 2368
105 Ga0105240_10588790 3300009093 Bacteria 1226
106 Ga0105245_10535837 3300009098 Bacteria 1191
107 Ga0114129_10700308 3300009147 Bacteria 1302
108 Ga0105243_10001381 3300009148 Bacteria 21530
109 Ga0105243_10063398 3300009148 Bacteria 2962
110 Ga0105241_10099015 3300009174 Bacteria 2314
111 Ga0105242_10448945 3300009176 Bacteria 1215
112 Ga0105248_10561350 3300009177 Bacteria 1288
113 Ga0105237_10000700 3300009545 Bacteria 46452
114 Ga0105237_10034333 3300009545 Bacteria 5137
115 Ga0105238_10288389 3300009551 Bacteria 1623
116 Ga0105238_10379740 3300009551 Bacteria 1404
117 Ga0105239_10000075 3300010375 Bacteria 140531
118 Ga0105246_10075990 3300011119 Bacteria 2379
119 Ga0157373_10016322 3300013100 Bacteria 5417
120 Ga0157370_10477250 3300013104 Unclassified 1146
121 Ga0157369_10493002 3300013105 Bacteria 1268
122 Ga0157369_10515703 3300013105 Bacteria 1237
123 Ga0157374_10057380 3300013296 Bacteria 3636
124 Ga0157374_10068711 3300013296 Bacteria 3334
125 Ga0157378_10297938 3300013297 Bacteria 1560
126 Ga0157378_10802570 3300013297 Bacteria 967
127 Ga0163162_10612270 3300013306 Bacteria 1215
128 Ga0157372_10098941 3300013307 Bacteria 3327
129 Ga0157372_10296029 3300013307 Bacteria 1882
130 Ga0157375_10174331 3300013308 Bacteria 2299
131 Ga0157375_10410784 3300013308 Bacteria 1520
132 Ga0182008_10007203 3300014497 Bacteria 6157
133 Ga0157377_10069448 3300014745 Bacteria 2033
134 Ga0157379_10023653 3300014968 Bacteria 5454
135 Ga0157379_10230469 3300014968 Bacteria 1679
136 Ga0157376_10003245 3300014969 Bacteria 11186
137 Ga0157376_10006341 3300014969 Bacteria 8355
138 Ga0157376_10158963 3300014969 Bacteria 2046
139 Ga0182006_1050120 3300015261 Bacteria 1609
140 Ga0182007_10013839 3300015262 Bacteria 3062
141 Ga0163161_10001260 3300017792 Bacteria 18914
142 Ga0163161_10590058 3300017792 Bacteria 915
143 Ga0209565_1000025 3300025263 Bacteria 377969
144 Ga0209673_1000149 3300025273 Bacteria 148659
145 Ga0209130_1000804 3300025284 Bacteria 26631
146 Ga0209675_1000017 3300025291 Bacteria 378002
147 Ga0209676_1000123 3300025292 Bacteria 195351
148 Ga0209025_1000779 3300025294 Bacteria 52611
149 Ga0209025_1015608 3300025294 Bacteria 4560
150 Ga0209758_1004105 3300025297 Bacteria 12479
151 Ga0209050_1000188 3300025298 Bacteria 138865
152 Ga0207426_1000066 3300025302 Bacteria 351182
153 Ga0209051_1000091 3300025303 Bacteria 173683
154 Ga0209051_1000128 3300025303 Bacteria 142159
155 Ga0209257_1000057 3300025304 Bacteria 396985
156 Ga0207642_10150426 3300025899 Bacteria 1238
157 Ga0207688_10194875 3300025901 Bacteria 1213
158 Ga0207645_10233959 3300025907 Bacteria 1213
159 Ga0207705_10010581 3300025909 Bacteria 6704
160 Ga0207684_10152264 3300025910 Unclassified 1990
161 Ga0207707_10154819 3300025912 Bacteria 2005
162 Ga0207707_10656248 3300025912 Bacteria 884
163 Ga0207695_10006670 3300025913 Bacteria 14898
164 Ga0207671_10001811 3300025914 Bacteria 23884
165 Ga0207693_10339428 3300025915 Bacteria 1176
166 Ga0207663_10208477 3300025916 Bacteria 1415
167 Ga0207660_10091013 3300025917 Bacteria 2261
168 Ga0207662_10017265 3300025918 Bacteria 4080
169 Ga0207657_10014171 3300025919 Bacteria 7798
170 Ga0207657_10039607 3300025919 Unclassified 4185
171 Ga0207657_10361966 3300025919 Bacteria 1143
172 Ga0207681_10059743 3300025923 Bacteria 2614
173 Ga0207694_10294636 3300025924 Bacteria 1335
174 Ga0207694_10319560 3300025924 Bacteria 1281
175 Ga0207659_10337032 3300025926 Bacteria 1248
176 Ga0207706_10150185 3300025933 Bacteria 2049
177 Ga0207706_10386851 3300025933 Bacteria 1213
178 Ga0207709_10007513 3300025935 Bacteria 6066
179 Ga0207709_10141918 3300025935 Bacteria 1652
180 Ga0207669_10003255 3300025937 Bacteria 7022
181 Ga0207669_10110394 3300025937 Bacteria 1841
182 Ga0207704_10032094 3300025938 Bacteria 2968
183 Ga0207665_10275761 3300025939 Bacteria 1250
184 Ga0207691_10001944 3300025940 Bacteria 20178
185 Ga0207691_10002828 3300025940 Bacteria 16910
186 Ga0207691_10277471 3300025940 Bacteria 1442
187 Ga0207691_10375913 3300025940 Bacteria 1213
188 Ga0207689_10209737 3300025942 Bacteria 1609
189 Ga0207689_10358027 3300025942 Bacteria 1213
190 Ga0207661_10183683 3300025944 Unclassified 1829
191 Ga0207712_10293985 3300025961 Bacteria 1331
192 Ga0207668_10309093 3300025972 Bacteria 1307
193 Ga0207640_10053222 3300025981 Bacteria 2641
194 Ga0207640_10212679 3300025981 Bacteria 1474
195 Ga0207658_10015011 3300025986 Bacteria 5311
196 Ga0207677_10136203 3300026023 Bacteria 1873
197 Ga0207677_10227113 3300026023 Bacteria 1501
198 Ga0207639_10142438 3300026041 Bacteria 1999
199 Ga0207678_10000564 3300026067 Bacteria 33856
200 Ga0207678_10100630 3300026067 Bacteria 2469
201 Ga0207708_10371465 3300026075 Bacteria 1178
202 Ga0207702_10457369 3300026078 Bacteria 1239
203 Ga0207641_10013019 3300026088 Bacteria 6822
204 Ga0207648_10071816 3300026089 Bacteria 3017
205 Ga0207648_10184095 3300026089 Bacteria 1849
206 Ga0207675_100345684 3300026118 Bacteria 1457
207 Ga0207675_100497416 3300026118 Bacteria 1213
208 Ga0207675_100541026 3300026118 Bacteria 1163
209 Ga0207683_10010862 3300026121 Bacteria 7765
210 Ga0207683_10434198 3300026121 Bacteria 1210
211 Ga0209282_1105026 3300027666 Bacteria 1446
212 Ga0209998_10008925 3300027717 Bacteria 2074
213 Ga0207428_10123640 3300027907 Bacteria 1982
214 Ga0268266_10030419 3300028379 Bacteria 4587
215 Ga0268264_10463855 3300028381 Bacteria 1229
216 Ga0268264_10816598 3300028381 Bacteria 932
217 Ga0307517_10083920 3300028786 Bacteria 2687
218 Ga0307515_10255990 3300028794 Bacteria 1495
219 Ga0265320_10060408 3300031240 Bacteria 1810
220 Ga0265340_10113087 3300031247 Bacteria 1253
221 Ga0307513_10001396 3300031456 Bacteria 34750
222 Ga0307513_10297854 3300031456 Bacteria 1381
223 Ga0307408_100056233 3300031548 Bacteria 2852
224 Ga0316575_10019569 3300031665 Bacteria 2591
225 Ga0316579_10035485 3300031691 Bacteria 2299
226 Ga0316576_10132733 3300031727 Bacteria 1873
227 Ga0316578_10066880 3300031728 Bacteria 2123
228 Ga0307516_10042986 3300031730 Bacteria 4479
229 Ga0307516_10205064 3300031730 Bacteria 1689
230 Ga0307405_10024934 3300031731 Bacteria 3425
231 Ga0307413_10253459 3300031824 Bacteria 1307
232 Ga0307406_10025798 3300031901 Bacteria 3521
233 Ga0307412_10021495 3300031911 Bacteria 3942
234 Ga0307412_10040708 3300031911 Bacteria 3007
235 Ga0307414_10095629 3300032004 Bacteria 2220
236 Ga0316580_10000825 3300032139 Bacteria 7604
237 Ga0307507_10083154 3300033179 Bacteria 2801
238 Ga0373923_0024624 3300035111 Bacteria 2377
239 Ga0373953_0065198 3300035117 Bacteria 1495
240 Ga0373954_0013786 3300035118 Bacteria 3602
241 Ga0373942_0018147 3300035207 Bacteria 1743
242 Ga0316574_0029839 3300035398 Bacteria 3297
243 Ga0316574_0062337 3300035398 Bacteria 2343
244 Ga0316574_0283710 3300035398 Bacteria 1055
245 Ga0373931_0284956 3300035691 Bacteria 1015
246 Ga0373933_0021026 3300035724 Bacteria 3702
247 Ga0373937_0020561 3300036401 Bacteria 5917
248 Ga0316582_0013538 3300036647 Bacteria 4595
249 Ga0316582_0375960 3300036647 Bacteria 978
250 Ga0316584_0105048 3300036712 Bacteria 2113
251 Ga0373925_0021944 3300037068 Bacteria 4655
252 Ga0373925_0126598 3300037068 Bacteria 1988
253 Ga0395905_0000723 3300037471 Bacteria 43533
254 Ga0395905_0114436 3300037471 Bacteria 2534
255 Ga0436364_0173856 3300037853 Bacteria 2636
256 Ga0436364_1065372 3300037853 Bacteria 196587
257 Ga0400488_19806 3300038741 Bacteria 8174
258 Ga0400483_003758 3300039062 Bacteria 10653
259 Ga0400483_077827 3300039062 Bacteria 2084
260 Ga0436363_1494131 3300039450 Bacteria 1611
261 Ga0436362_0639608 3300039453 Bacteria 1191
262 Ga0439466_0025080 3300041411 Bacteria 2084
263 Ga0439465_0061694 3300041413 Bacteria 1243
264 Ga0451793_1374309 3300041452 Bacteria 1063
265 Ga0450921_000150 3300042123 Bacteria 2521
266 Ga0450923_023054 3300042125 Bacteria 1225
267 Ga0450888_004540 3300042126 Bacteria 1454
268 Ga0450898_020804 3300042134 Bacteria 1152
269 Ga0450906_002953 3300042145 Bacteria 3695
270 Ga0439434_0023197 3300042435 Bacteria 1867
271 Ga0439464_0102084 3300042439 Bacteria 872
272 Ga0439460_0014319 3300042461 Bacteria 2085
273 Ga0450918_012708 3300042531 Bacteria 1466
274 Ga0450893_0006379 3300042532 Bacteria 1907
275 Ga0495638_0023002 3300046460 Bacteria 4083
276 Ga0495651_0164174 3300046462 Bacteria 1588
277 Ga0495650_0013785 3300046471 Bacteria 4251
278 Ga0495605_0107796 3300046474 Bacteria 1274
279 Ga0495608_0075968 3300046511 Bacteria 2189
280 Ga0495610_0046098 3300046512 Bacteria 2153
281 Ga0495618_0045610 3300046514 Bacteria 2766
282 Ga0495628_0000612 3300046516 Bacteria 32753
283 Ga0495643_0011336 3300046522 Bacteria 5433
284 Ga0495652_0002873 3300046529 Bacteria 17371
285 Ga0495597_0089769 3300046542 Bacteria 1306
286 Ga0495633_0001542 3300046558 Bacteria 17688
287 Ga0495667_0276338 3300046559 Bacteria 1066
288 Ga0495668_0005258 3300046616 Bacteria 8862
289 Ga0495625_0000056 3300046660 Bacteria 186024
290 Ga0495635_0084300 3300046663 Bacteria 2175
291 Ga0495661_0002439 3300046665 Bacteria 14321
292 Ga0495657_0007808 3300046675 Bacteria 8216
293 Ga0495599_0195678 3300046678 Bacteria 1243
294 Ga0495623_0115124 3300046679 Bacteria 1625
295 Ga0495623_0135987 3300046679 Bacteria 1467
296 Ga0495658_0108733 3300046683 Bacteria 1664
297 Ga0495613_0058405 3300046689 Bacteria 2831
298 Ga0495600_0079908 3300046809 Bacteria 2135
299 Ga0495604_0010423 3300047317 Bacteria 7364
300 Ga0495604_0100289 3300047317 Bacteria 2129
301 Ga0495680_0097153 3300047322 Bacteria 2199
302 Ga0495687_031245 3300047443 Bacteria 2444
303 Ga0496100_0097574 3300048903 Bacteria 2018
304 Ga0496101_0069699 3300048904 Bacteria 2573
305 Ga0496103_0035177 3300048906 Bacteria 3066
306 Ga0496107_0089134 3300048910 Bacteria 2252
307 Ga0496108_0098059 3300048911 Bacteria 2498
308 Ga0496109_0152915 3300048912 Bacteria 2161
309 Ga0496109_0261275 3300048912 Bacteria 1631
310 Ga0496110_0478459 3300048913 Bacteria 1134
311 Ga0496111_0282405 3300048914 Bacteria 1231
312 Ga0496114_0030577 3300048917 Bacteria 4431
313 Ga0496115_0275069 3300048918 Bacteria 1383
314 Ga0496121_0000247 3300048924 Bacteria 114839
315 Ga0496121_0005849 3300048924 Bacteria 15577
316 Ga0496125_0052386 3300048928 Bacteria 3356
317 Ga0496126_0003156 3300048929 Bacteria 21231
318 Ga0496126_0556085 3300048929 Bacteria 910
319 Ga0501031_0040770 3300049568 Bacteria 3031
320 Ga0501032_0000122 3300049569 Bacteria 64671
321 Ga0501033_0000099 3300049570 Bacteria 82339
322 Ga0501034_0000220 3300049571 Bacteria 109015
323 Ga0501034_0225825 3300049571 Bacteria 1823
324 Ga0501036_0016196 3300049572 Bacteria 6225
325 Ga0501037_0000039 3300049573 Bacteria 119902
326 Ga0501038_0000289 3300049574 Bacteria 42809
327 Ga0501039_0000055 3300049575 Bacteria 91098
328 Ga0501039_0140504 3300049575 Bacteria 1897
329 Ga0501043_0000037 3300049579 Bacteria 131656
330 Ga0501046_0026534 3300049580 Bacteria 4731
331 Ga0501047_0506849 3300049581 Bacteria 1033
332 Ga0501047_0663345 3300049581 Bacteria 862
333 Ga0501068_0173070 3300049584 Bacteria 1363
334 Ga0501070_0176739 3300049586 Bacteria 1757
335 Ga0501035_0000094 3300049822 Bacteria 111052
336 Ga0501035_0000108 3300049822 Bacteria 100975
337 Ga0501045_0050635 3300049824 Bacteria 3031
338 nmdc:mga03683_16432_c1 3300050489 Bacteria 2780
339 nmdc:mga03683_22143_c1 3300050489 Bacteria 2460
340 nmdc:mga03n38_47161_c1 3300050490 Bacteria 1905
341 nmdc:mga00v17_1001_c1 3300050491 Bacteria 15114
342 nmdc:mga00v17_393708_c1 3300050491 Bacteria 900
343 nmdc:mga00v17_92139_c1 3300050491 Bacteria 1905
344 nmdc:mga0yw44_296833_c1 3300050492 Bacteria 1082
345 nmdc:mga0k408_28720_c1 3300050493 Bacteria 3163
346 nmdc:mga0k408_35695_c1 3300050493 Bacteria 2851
347 nmdc:mga06z11_66044_c1 3300050494 Bacteria 1900
348 nmdc:mga07m45_136525_c1 3300050496 Bacteria 1420
349 nmdc:mga05p37_438110_c1 3300050507 Bacteria 1107
350 nmdc:mga0qj67_200741_c1 3300050509 Bacteria 1620
351 nmdc:mga08x19_335018_c1 3300050514 Bacteria 1055
352 Ga0495601_0008111 3300053077 Bacteria 6192
353 Ga0495612_0009760 3300053078 Bacteria 3889
354 Ga0500610_0035438 3300053079 Bacteria 2559
355 Ga0495595_0000702 3300053084 Bacteria 12728
356 Ga0495619_0249590 3300053085 Bacteria 1229
357 Ga0500642_0124852 3300053130 Bacteria 1205

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003578 Ga0006562J51391_1051197 Ga0006562J51391_10511976 239
2 3300003578 Ga0006562J51391_1051202 Ga0006562J51391_10512022 239
3 3300005288 Ga0065714_10090003 Ga0065714_100900032 239
4 3300013100 Ga0157373_10016322 Ga0157373_100163223 239
5 3300014497 Ga0182008_10007203 Ga0182008_100072036 239
6 3300015261 Ga0182006_1050120 Ga0182006_10501202 239
7 3300031548 Ga0307408_100056233 Ga0307408_1000562333 239
8 3300031901 Ga0307406_10025798 Ga0307406_100257982 239
9 3300025923 Ga0207681_10059743 Ga0207681_100597435 240
10 3300025944 Ga0207661_10183683 Ga0207661_101836831 248
11 3300049568 Ga0501031_0040770 Ga0501031_0040770_1267_2070 249
12 3300049569 Ga0501032_0000122 Ga0501032_0000122_23308_24111 249
13 3300049570 Ga0501033_0000099 Ga0501033_0000099_42239_43042 249
14 3300049571 Ga0501034_0000220 Ga0501034_0000220_79708_80511 249
15 3300049572 Ga0501036_0016196 Ga0501036_0016196_4872_5675 249
16 3300049573 Ga0501037_0000039 Ga0501037_0000039_89370_90173 249
17 3300049574 Ga0501038_0000289 Ga0501038_0000289_12245_13048 249
18 3300049575 Ga0501039_0000055 Ga0501039_0000055_59999_60802 249
19 3300049579 Ga0501043_0000037 Ga0501043_0000037_40725_41528 249
20 3300049580 Ga0501046_0026534 Ga0501046_0026534_1882_2685 249
21 3300049581 Ga0501047_0506849 Ga0501047_0506849_207_1010 249
22 3300049822 Ga0501035_0000108 Ga0501035_0000108_59547_60350 249
23 3300049824 Ga0501045_0050635 Ga0501045_0050635_2072_2875 249
24 3300005334 Ga0068869_100045095 Ga0068869_1000450955 250
25 3300005841 Ga0068863_100020929 Ga0068863_1000209297 250
26 3300005843 Ga0068860_100947830 Ga0068860_1009478301 250
27 3300025942 Ga0207689_10209737 Ga0207689_102097373 250
28 3300026088 Ga0207641_10013019 Ga0207641_100130197 250
29 3300028381 Ga0268264_10816598 Ga0268264_108165981 250
30 3300031456 Ga0307513_10001396 Ga0307513_1000139621 250
31 3300053130 Ga0500642_0124852 Ga0500642_0124852_159_929 250
32 3300005327 Ga0070658_10072178 Ga0070658_100721782 252
33 3300013104 Ga0157370_10477250 Ga0157370_104772502 252
34 3300013105 Ga0157369_10493002 Ga0157369_104930022 253
35 3300025919 Ga0207657_10039607 Ga0207657_100396072 253
36 iso_pu_bacteria 2643221541 2643731886 254
37 iso_pu_bacteria 2643221606 2644041787 254
38 iso_pu_bacteria 2643221671 2644394570 254
39 3300013307 Ga0157372_10098941 Ga0157372_100989412 255
40 3300025909 Ga0207705_10010581 Ga0207705_100105816 255
41 3300037853 Ga0436364_0173856 Ga0436364_0173856_111_881 255
42 3300005614 Ga0068856_100624139 Ga0068856_1006241392 257
43 3300009545 Ga0105237_10000700 Ga0105237_1000070041 257
44 3300009551 Ga0105238_10288389 Ga0105238_102883892 257
45 3300010375 Ga0105239_10000075 Ga0105239_1000007554 257
46 3300025912 Ga0207707_10154819 Ga0207707_101548192 257
47 3300025913 Ga0207695_10006670 Ga0207695_1000667012 257
48 3300025914 Ga0207671_10001811 Ga0207671_1000181110 257
49 3300025924 Ga0207694_10294636 Ga0207694_102946361 257
50 3300035207 Ga0373942_0018147 Ga0373942_0018147_606_1382 257
51 3300037068 Ga0373925_0126598 Ga0373925_0126598_17_841 257
52 3300046542 Ga0495597_0089769 Ga0495597_0089769_297_1088 257
53 3300048924 Ga0496121_0000247 Ga0496121_0000247_81219_82010 257
54 3300048924 Ga0496121_0005849 Ga0496121_0005849_8181_8972 257
55 3300048929 Ga0496126_0003156 Ga0496126_0003156_14662_15453 257
56 3300049581 Ga0501047_0663345 Ga0501047_0663345_37_819 257
57 3300003187 JGI25151J46595_10000212 JGI25151J46595_1000021226 258
58 3300003354 JGI25160J50197_1004779 JGI25160J50197_10047796 258
59 3300005983 Ga0081540_1017771 Ga0081540_10177713 258
60 3300025284 Ga0209130_1000804 Ga0209130_10008045 258
61 3300025294 Ga0209025_1000779 Ga0209025_100077925 258
62 3300025297 Ga0209758_1004105 Ga0209758_10041055 258
63 3300025302 Ga0207426_1000066 Ga0207426_1000066143 258
64 3300025919 Ga0207657_10014171 Ga0207657_100141715 258
65 3300025981 Ga0207640_10053222 Ga0207640_100532221 258
66 3300026067 Ga0207678_10000564 Ga0207678_1000056413 258
67 3300031456 Ga0307513_10297854 Ga0307513_102978541 258
68 3300046512 Ga0495610_0046098 Ga0495610_0046098_55_876 258
69 3300049571 Ga0501034_0225825 Ga0501034_0225825_23_829 258
70 3300049575 Ga0501039_0140504 Ga0501039_0140504_747_1553 258
71 3300049822 Ga0501035_0000094 Ga0501035_0000094_55717_56517 258
72 3300005338 Ga0068868_100019180 Ga0068868_1000191804 259
73 3300005356 Ga0070674_100006794 Ga0070674_1000067945 259
74 3300005356 Ga0070674_100011568 Ga0070674_1000115683 259
75 3300005367 Ga0070667_100019846 Ga0070667_1000198466 259
76 3300005367 Ga0070667_100252405 Ga0070667_1002524052 259
77 3300005456 Ga0070678_100000638 Ga0070678_10000063816 259
78 3300005543 Ga0070672_100003347 Ga0070672_1000033471 259
79 3300005543 Ga0070672_100031279 Ga0070672_1000312791 259
80 3300005543 Ga0070672_100421791 Ga0070672_1004217911 259
81 3300005548 Ga0070665_100044857 Ga0070665_1000448576 259
82 3300005617 Ga0068859_100585560 Ga0068859_1005855602 259
83 3300006237 Ga0097621_100010631 Ga0097621_1000106315 259
84 3300006358 Ga0068871_100044256 Ga0068871_1000442562 259
85 3300006931 Ga0097620_100585555 Ga0097620_1005855551 259
86 3300013296 Ga0157374_10068711 Ga0157374_100687112 259
87 3300013297 Ga0157378_10297938 Ga0157378_102979381 259
88 3300013308 Ga0157375_10174331 Ga0157375_101743312 259
89 3300014968 Ga0157379_10230469 Ga0157379_102304692 259
90 3300014969 Ga0157376_10003245 Ga0157376_1000324513 259
91 3300014969 Ga0157376_10006341 Ga0157376_100063413 259
92 3300025937 Ga0207669_10003255 Ga0207669_100032554 259
93 3300025940 Ga0207691_10001944 Ga0207691_1000194412 259
94 3300025940 Ga0207691_10002828 Ga0207691_100028287 259
95 3300025940 Ga0207691_10277471 Ga0207691_102774711 259
96 3300025986 Ga0207658_10015011 Ga0207658_100150112 259
97 3300026023 Ga0207677_10136203 Ga0207677_101362032 259
98 3300026041 Ga0207639_10142438 Ga0207639_101424382 259
99 3300026118 Ga0207675_100345684 Ga0207675_1003456842 259
100 3300026121 Ga0207683_10010862 Ga0207683_100108627 259
101 3300028379 Ga0268266_10030419 Ga0268266_100304193 259
102 3300028794 Ga0307515_10255990 Ga0307515_102559903 259
103 3300031665 Ga0316575_10019569 Ga0316575_100195692 259
104 3300031691 Ga0316579_10035485 Ga0316579_100354853 259
105 3300031727 Ga0316576_10132733 Ga0316576_101327332 259
106 3300031728 Ga0316578_10066880 Ga0316578_100668803 259
107 3300032139 Ga0316580_10000825 Ga0316580_100008252 259
108 3300035398 Ga0316574_0029839 Ga0316574_0029839_533_1315 259
109 3300036647 Ga0316582_0013538 Ga0316582_0013538_3598_4380 259
110 3300036712 Ga0316584_0105048 Ga0316584_0105048_774_1556 259
111 3300048912 Ga0496109_0261275 Ga0496109_0261275_151_954 259
112 3300048929 Ga0496126_0556085 Ga0496126_0556085_90_893 259
113 iso_pu_bacteria 2919704043 2919708760 259
114 3300036647 Ga0316582_0375960 Ga0316582_0375960_99_890 260
115 3300049586 Ga0501070_0176739 Ga0501070_0176739_660_1460 260
116 iso_pu_bacteria 2643221717 2644646325 260
117 3300006914 Ga0075436_100150498 Ga0075436_1001504981 262
118 3300007076 Ga0075435_100102913 Ga0075435_1001029133 262
119 3300037068 Ga0373925_0021944 Ga0373925_0021944_2475_3266 262
120 3300037853 Ga0436364_1065372 Ga0436364_1065372_144062_144862 262
121 3300039450 Ga0436363_1494131 Ga0436363_1494131_783_1583 262
122 3300046663 Ga0495635_0084300 Ga0495635_0084300_680_1471 262
123 3300046683 Ga0495658_0108733 Ga0495658_0108733_103_894 262
124 3300046689 Ga0495613_0058405 Ga0495613_0058405_1941_2732 262
125 3300047317 Ga0495604_0100289 Ga0495604_0100289_1287_2081 262
126 3300048911 Ga0496108_0098059 Ga0496108_0098059_789_1580 262
127 3300048918 Ga0496115_0275069 Ga0496115_0275069_450_1241 262
128 3300050514 nmdc:mga08x19_335018_c1 nmdc:mga08x19_335018_c1_244_1035 262
129 iso_pu_bacteria 2842677519 2842680424 262
130 iso_pu_bacteria 2945945610 2945947917 262
131 3300005458 Ga0070681_10764342 Ga0070681_107643421 263
132 3300005459 Ga0068867_100074420 Ga0068867_1000744203 263
133 3300005578 Ga0068854_100168968 Ga0068854_1001689683 263
134 3300006051 Ga0075364_10001206 Ga0075364_100012064 263
135 3300009148 Ga0105243_10063398 Ga0105243_100633983 263
136 3300025912 Ga0207707_10656248 Ga0207707_106562481 263
137 3300025933 Ga0207706_10150185 Ga0207706_101501852 263
138 3300025935 Ga0207709_10141918 Ga0207709_101419183 263
139 3300025938 Ga0207704_10032094 Ga0207704_100320942 263
140 3300026089 Ga0207648_10184095 Ga0207648_101840952 263
141 3300026118 Ga0207675_100541026 Ga0207675_1005410261 263
142 3300035398 Ga0316574_0283710 Ga0316574_0283710_230_1024 263
143 3300050489 nmdc:mga03683_22143_c1 nmdc:mga03683_22143_c1_1016_1825 263
144 3300050491 nmdc:mga00v17_1001_c1 nmdc:mga00v17_1001_c1_5371_6297 263
145 3300050493 nmdc:mga0k408_28720_c1 nmdc:mga0k408_28720_c1_1952_2761 263
146 3300050496 nmdc:mga07m45_136525_c1 nmdc:mga07m45_136525_c1_456_1265 263
147 3300053079 Ga0500610_0035438 Ga0500610_0035438_733_1551 263
148 3300013307 Ga0157372_10296029 Ga0157372_102960292 264
149 3300037471 Ga0395905_0114436 Ga0395905_0114436_1451_2257 264
150 3300049584 Ga0501068_0173070 Ga0501068_0173070_329_1126 264
151 iso_pu_bacteria 2932422444 2932423072 264
152 3300006195 Ga0075366_10091065 Ga0075366_100910652 265
153 3300006353 Ga0075370_10110108 Ga0075370_101101082 265
154 3300006948 Ga0099826_10121823 Ga0099826_101218232 265
155 3300031730 Ga0307516_10205064 Ga0307516_102050642 265
156 3300031731 Ga0307405_10024934 Ga0307405_100249343 265
157 3300031911 Ga0307412_10021495 Ga0307412_100214953 265
158 3300031911 Ga0307412_10040708 Ga0307412_100407083 265
159 3300035398 Ga0316574_0062337 Ga0316574_0062337_345_1145 265
160 3300050493 nmdc:mga0k408_35695_c1 nmdc:mga0k408_35695_c1_1353_2168 265
161 3300005467 Ga0070706_100178668 Ga0070706_1001786682 266
162 3300015262 Ga0182007_10013839 Ga0182007_100138391 266
163 3300025910 Ga0207684_10152264 Ga0207684_101522641 266
164 3300037471 Ga0395905_0000723 Ga0395905_0000723_39372_40175 266
165 3300042126 Ga0450888_004540 Ga0450888_004540_293_1105 266
166 3300046474 Ga0495605_0107796 Ga0495605_0107796_140_943 266
167 3300046522 Ga0495643_0011336 Ga0495643_0011336_2269_3072 266
168 3300046558 Ga0495633_0001542 Ga0495633_0001542_8705_9508 266
169 3300046616 Ga0495668_0005258 Ga0495668_0005258_8015_8818 266
170 3300046665 Ga0495661_0002439 Ga0495661_0002439_545_1348 266
171 3300047443 Ga0495687_031245 Ga0495687_031245_733_1536 266
172 3300048928 Ga0496125_0052386 Ga0496125_0052386_1340_2143 266
173 3300028786 Ga0307517_10083920 Ga0307517_100839202 267
174 3300031730 Ga0307516_10042986 Ga0307516_100429861 267
175 3300041452 Ga0451793_1374309 Ga0451793_1374309_21_827 267
176 3300042532 Ga0450893_0006379 Ga0450893_0006379_581_1390 267
177 iso_pu_bacteria 2524614857 2526063593 267
178 iso_pu_bacteria 2643221628 2644159880 267
179 iso_pu_bacteria 2739367875 2740061943 267
180 iso_pu_bacteria 2929520902 2929522111 267
181 3300031240 Ga0265320_10060408 Ga0265320_100604082 268
182 3300031247 Ga0265340_10113087 Ga0265340_101130872 268
183 3300035111 Ga0373923_0024624 Ga0373923_0024624_1498_2310 268
184 3300035117 Ga0373953_0065198 Ga0373953_0065198_453_1265 268
185 3300035118 Ga0373954_0013786 Ga0373954_0013786_2349_3161 268
186 3300035724 Ga0373933_0021026 Ga0373933_0021026_496_1308 268
187 3300036401 Ga0373937_0020561 Ga0373937_0020561_499_1311 268
188 3300038741 Ga0400488_19806 Ga0400488_19806_2738_3547 268
189 3300042439 Ga0439464_0102084 Ga0439464_0102084_32_844 268
190 3300046460 Ga0495638_0023002 Ga0495638_0023002_794_1618 268
191 3300046462 Ga0495651_0164174 Ga0495651_0164174_322_1134 268
192 3300046559 Ga0495667_0276338 Ga0495667_0276338_45_857 268
193 3300046675 Ga0495657_0007808 Ga0495657_0007808_1204_2016 268
194 3300046678 Ga0495599_0195678 Ga0495599_0195678_65_877 268
195 3300046679 Ga0495623_0135987 Ga0495623_0135987_75_887 268
196 3300046809 Ga0495600_0079908 Ga0495600_0079908_328_1140 268
197 3300047317 Ga0495604_0010423 Ga0495604_0010423_6488_7300 268
198 3300047322 Ga0495680_0097153 Ga0495680_0097153_1175_1987 268
199 3300053077 Ga0495601_0008111 Ga0495601_0008111_2163_2975 268
200 3300053078 Ga0495612_0009760 Ga0495612_0009760_581_1393 268
201 3300053084 Ga0495595_0000702 Ga0495595_0000702_1312_2124 268
202 3300053085 Ga0495619_0249590 Ga0495619_0249590_372_1184 268
203 iso_pu_bacteria 2844533157 2844537020 268
204 iso_pu_bacteria 2857710386 2857711047 268
205 3300042461 Ga0439460_0014319 Ga0439460_0014319_461_1276 269
206 3300046511 Ga0495608_0075968 Ga0495608_0075968_197_1015 269
207 3300046514 Ga0495618_0045610 Ga0495618_0045610_1019_1837 269
208 3300046516 Ga0495628_0000612 Ga0495628_0000612_19945_20763 269
209 3300046529 Ga0495652_0002873 Ga0495652_0002873_2347_3165 269
210 3300046679 Ga0495623_0115124 Ga0495623_0115124_721_1539 269
211 iso_pu_bacteria 2643221658 2644325887 269
212 iso_pu_bacteria 2643221672 2644397240 269
213 iso_pu_bacteria 2821443989 2821449081 269
214 3300003773 Ga0055537_1000064 Ga0055537_100006462 270
215 3300003784 Ga0055534_1000094 Ga0055534_100009461 270
216 3300003791 Ga0055530_10007178 Ga0055530_100071786 270
217 3300003792 Ga0055540_1002876 Ga0055540_10028765 270
218 3300003794 Ga0055531_10000084 Ga0055531_1000008489 270
219 3300005288 Ga0065714_10003682 Ga0065714_100036828 270
220 3300005471 Ga0070698_100165590 Ga0070698_1001655905 270
221 3300006038 Ga0075365_10122496 Ga0075365_101224961 270
222 3300006048 Ga0075363_100047590 Ga0075363_1000475902 270
223 3300006051 Ga0075364_10093595 Ga0075364_100935952 270
224 3300006058 Ga0075432_10023270 Ga0075432_100232702 270
225 3300006353 Ga0075370_10054496 Ga0075370_100544963 270
226 3300006353 Ga0075370_10184512 Ga0075370_101845122 270
227 3300006948 Ga0099826_10028171 Ga0099826_100281713 270
228 3300006948 Ga0099826_10132761 Ga0099826_101327612 270
229 3300011119 Ga0105246_10075990 Ga0105246_100759902 270
230 3300017792 Ga0163161_10001260 Ga0163161_100012608 270
231 3300025263 Ga0209565_1000025 Ga0209565_100002513 270
232 3300025273 Ga0209673_1000149 Ga0209673_1000149134 270
233 3300025291 Ga0209675_1000017 Ga0209675_1000017361 270
234 3300025292 Ga0209676_1000123 Ga0209676_1000123155 270
235 3300025294 Ga0209025_1015608 Ga0209025_10156087 270
236 3300025298 Ga0209050_1000188 Ga0209050_1000188118 270
237 3300025303 Ga0209051_1000091 Ga0209051_1000091155 270
238 3300025303 Ga0209051_1000128 Ga0209051_10001287 270
239 3300025304 Ga0209257_1000057 Ga0209257_1000057113 270
240 3300027666 Ga0209282_1105026 Ga0209282_11050262 270
241 3300027907 Ga0207428_10123640 Ga0207428_101236403 270
242 3300031824 Ga0307413_10253459 Ga0307413_102534592 270
243 3300032004 Ga0307414_10095629 Ga0307414_100956292 270
244 3300041411 Ga0439466_0025080 Ga0439466_0025080_373_1200 270
245 3300041413 Ga0439465_0061694 Ga0439465_0061694_29_856 270
246 3300042123 Ga0450921_000150 Ga0450921_000150_648_1475 270
247 3300042125 Ga0450923_023054 Ga0450923_023054_79_906 270
248 3300042134 Ga0450898_020804 Ga0450898_020804_103_930 270
249 3300042145 Ga0450906_002953 Ga0450906_002953_1819_2646 270
250 3300042435 Ga0439434_0023197 Ga0439434_0023197_830_1657 270
251 3300042531 Ga0450918_012708 Ga0450918_012708_58_885 270
252 3300046660 Ga0495625_0000056 Ga0495625_0000056_83173_84000 270
253 3300050489 nmdc:mga03683_16432_c1 nmdc:mga03683_16432_c1_1153_1980 270
254 3300050490 nmdc:mga03n38_47161_c1 nmdc:mga03n38_47161_c1_105_932 270
255 3300050491 nmdc:mga00v17_393708_c1 nmdc:mga00v17_393708_c1_32_859 270
256 3300050491 nmdc:mga00v17_92139_c1 nmdc:mga00v17_92139_c1_671_1501 270
257 3300050492 nmdc:mga0yw44_296833_c1 nmdc:mga0yw44_296833_c1_179_1006 270
258 3300050494 nmdc:mga06z11_66044_c1 nmdc:mga06z11_66044_c1_912_1742 270
259 3300033179 Ga0307507_10083154 Ga0307507_100831544 271
260 3300039062 Ga0400483_003758 Ga0400483_003758_8623_9486 271
261 3300039062 Ga0400483_077827 Ga0400483_077827_645_1463 271
262 3300005545 Ga0070695_100409308 Ga0070695_1004093081 272
263 3300005981 Ga0081538_10004482 Ga0081538_1000448211 272
264 3300005981 Ga0081538_10019211 Ga0081538_100192114 272
265 3300009148 Ga0105243_10001381 Ga0105243_1000138119 272
266 3300025935 Ga0207709_10007513 Ga0207709_100075135 272
267 iso_pu_bacteria 2643221692 2644516387 272
268 iso_pu_bacteria 2738543011 2739239103 272
269 iso_pu_bacteria 2889300758 2889304057 272
270 iso_pu_bacteria 2939743619 2939745549 272
271 3300039453 Ga0436362_0639608 Ga0436362_0639608_207_1031 274
272 3300046471 Ga0495650_0013785 Ga0495650_0013785_1166_1999 274
273 3300025916 Ga0207663_10208477 Ga0207663_102084771 275
274 3300005365 Ga0070688_100268406 Ga0070688_1002684062 277
275 3300005834 Ga0068851_10021874 Ga0068851_100218741 277
276 3300048913 Ga0496110_0478459 Ga0496110_0478459_152_985 277
277 3300002070 JGI24750J21931_1001006 JGI24750J21931_10010066 279
278 3300009147 Ga0114129_10700308 Ga0114129_107003082 279
279 3300050507 nmdc:mga05p37_438110_c1 nmdc:mga05p37_438110_c1_198_1049 279
280 3300050509 nmdc:mga0qj67_200741_c1 nmdc:mga0qj67_200741_c1_419_1270 279
281 3300001977 JGI24746J21847_1008952 JGI24746J21847_10089522 289
282 3300001989 JGI24739J22299_10021747 JGI24739J22299_100217472 289
283 3300002070 JGI24750J21931_1001006 JGI24750J21931_10010062 289
284 3300002070 JGI24750J21931_1001006 JGI24750J21931_10010064 289
285 3300002073 JGI24745J21846_1002890 JGI24745J21846_10028901 289
286 3300002075 JGI24738J21930_10013123 JGI24738J21930_100131233 289
287 3300002077 JGI24744J21845_10011927 JGI24744J21845_100119273 289
288 3300002244 JGI24742J22300_10017728 JGI24742J22300_100177281 289
289 3300005328 Ga0070676_10083145 Ga0070676_100831453 289
290 3300005334 Ga0068869_100332605 Ga0068869_1003326052 289
291 3300005335 Ga0070666_10152851 Ga0070666_101528511 289
292 3300005336 Ga0070680_100379330 Ga0070680_1003793301 289
293 3300005338 Ga0068868_100249859 Ga0068868_1002498592 289
294 3300005340 Ga0070689_100041496 Ga0070689_1000414965 289
295 3300005341 Ga0070691_10187274 Ga0070691_101872742 289
296 3300005353 Ga0070669_100334082 Ga0070669_1003340821 289
297 3300005354 Ga0070675_100416603 Ga0070675_1004166031 289
298 3300005356 Ga0070674_100325021 Ga0070674_1003250211 289
299 3300005366 Ga0070659_100149543 Ga0070659_1001495432 289
300 3300005367 Ga0070667_100406656 Ga0070667_1004066561 289
301 3300005434 Ga0070709_10375706 Ga0070709_103757061 289
302 3300005438 Ga0070701_10180810 Ga0070701_101808101 289
303 3300005439 Ga0070711_100063391 Ga0070711_1000633911 289
304 3300005440 Ga0070705_100461268 Ga0070705_1004612681 289
305 3300005441 Ga0070700_100067847 Ga0070700_1000678473 289
306 3300005444 Ga0070694_100298096 Ga0070694_1002980962 289
307 3300005456 Ga0070678_100009249 Ga0070678_1000092496 289
308 3300005457 Ga0070662_100270253 Ga0070662_1002702531 289
309 3300005466 Ga0070685_10136683 Ga0070685_101366832 289
310 3300005536 Ga0070697_100130447 Ga0070697_1001304471 289
311 3300005539 Ga0068853_100433398 Ga0068853_1004333981 289
312 3300005543 Ga0070672_100176161 Ga0070672_1001761611 289
313 3300005544 Ga0070686_100123538 Ga0070686_1001235381 289
314 3300005546 Ga0070696_100232111 Ga0070696_1002321111 289
315 3300005547 Ga0070693_100236899 Ga0070693_1002368992 289
316 3300005548 Ga0070665_100246651 Ga0070665_1002466511 289
317 3300005549 Ga0070704_100240793 Ga0070704_1002407932 289
318 3300005563 Ga0068855_100154530 Ga0068855_1001545305 289
319 3300005578 Ga0068854_100180071 Ga0068854_1001800712 289
320 3300005614 Ga0068856_100509483 Ga0068856_1005094832 289
321 3300005615 Ga0070702_100234749 Ga0070702_1002347491 289
322 3300005617 Ga0068859_100583491 Ga0068859_1005834912 289
323 3300005718 Ga0068866_10154453 Ga0068866_101544531 289
324 3300005841 Ga0068863_100486971 Ga0068863_1004869712 289
325 3300005842 Ga0068858_100161955 Ga0068858_1001619553 289
326 3300005843 Ga0068860_100345545 Ga0068860_1003455452 289
327 3300005844 Ga0068862_100459710 Ga0068862_1004597101 289
328 3300006175 Ga0070712_100331264 Ga0070712_1003312641 289
329 3300006358 Ga0068871_100392612 Ga0068871_1003926122 289
330 3300006931 Ga0097620_100583501 Ga0097620_1005835012 289
331 3300009093 Ga0105240_10588790 Ga0105240_105887901 289
332 3300009098 Ga0105245_10535837 Ga0105245_105358372 289
333 3300009174 Ga0105241_10099015 Ga0105241_100990153 289
334 3300009176 Ga0105242_10448945 Ga0105242_104489452 289
335 3300009177 Ga0105248_10561350 Ga0105248_105613502 289
336 3300009545 Ga0105237_10034333 Ga0105237_100343333 289
337 3300009551 Ga0105238_10379740 Ga0105238_103797403 289
338 3300013105 Ga0157369_10515703 Ga0157369_105157032 289
339 3300013296 Ga0157374_10057380 Ga0157374_100573806 289
340 3300013297 Ga0157378_10802570 Ga0157378_108025701 289
341 3300013306 Ga0163162_10612270 Ga0163162_106122702 289
342 3300013308 Ga0157375_10410784 Ga0157375_104107842 289
343 3300014745 Ga0157377_10069448 Ga0157377_100694482 289
344 3300014968 Ga0157379_10023653 Ga0157379_100236532 289
345 3300014969 Ga0157376_10158963 Ga0157376_101589631 289
346 3300017792 Ga0163161_10590058 Ga0163161_105900581 289
347 3300025899 Ga0207642_10150426 Ga0207642_101504262 289
348 3300025901 Ga0207688_10194875 Ga0207688_101948752 289
349 3300025907 Ga0207645_10233959 Ga0207645_102339592 289
350 3300025915 Ga0207693_10339428 Ga0207693_103394282 289
351 3300025917 Ga0207660_10091013 Ga0207660_100910133 289
352 3300025918 Ga0207662_10017265 Ga0207662_100172651 289
353 3300025919 Ga0207657_10361966 Ga0207657_103619661 289
354 3300025924 Ga0207694_10319560 Ga0207694_103195602 289
355 3300025926 Ga0207659_10337032 Ga0207659_103370323 289
356 3300025933 Ga0207706_10386851 Ga0207706_103868512 289
357 3300025937 Ga0207669_10110394 Ga0207669_101103941 289
358 3300025939 Ga0207665_10275761 Ga0207665_102757612 289
359 3300025940 Ga0207691_10375913 Ga0207691_103759132 289
360 3300025942 Ga0207689_10358027 Ga0207689_103580272 289
361 3300025961 Ga0207712_10293985 Ga0207712_102939851 289
362 3300025972 Ga0207668_10309093 Ga0207668_103090933 289
363 3300025981 Ga0207640_10212679 Ga0207640_102126792 289
364 3300026023 Ga0207677_10227113 Ga0207677_102271132 289
365 3300026067 Ga0207678_10100630 Ga0207678_101006304 289
366 3300026075 Ga0207708_10371465 Ga0207708_103714652 289
367 3300026078 Ga0207702_10457369 Ga0207702_104573692 289
368 3300026089 Ga0207648_10071816 Ga0207648_100718165 289
369 3300026118 Ga0207675_100497416 Ga0207675_1004974162 289
370 3300026121 Ga0207683_10434198 Ga0207683_104341981 289
371 3300027717 Ga0209998_10008925 Ga0209998_100089252 289
372 3300028381 Ga0268264_10463855 Ga0268264_104638552 289
373 3300035691 Ga0373931_0284956 Ga0373931_0284956_59_928 289
374 3300048903 Ga0496100_0097574 Ga0496100_0097574_1123_1992 289
375 3300048904 Ga0496101_0069699 Ga0496101_0069699_1181_2050 289
376 3300048906 Ga0496103_0035177 Ga0496103_0035177_2158_3027 289
377 3300048910 Ga0496107_0089134 Ga0496107_0089134_43_912 289
378 3300048912 Ga0496109_0152915 Ga0496109_0152915_1239_2108 289
379 3300048914 Ga0496111_0282405 Ga0496111_0282405_216_1085 289
380 3300048917 Ga0496114_0030577 Ga0496114_0030577_793_1662 289

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00106

adh_short

short chain dehydrogenase

53

247

0.97

PF13561

adh_short_C2

Enoyl-(Acyl carrier protein) reductase

58

294

0.94

PF08659

KR

KR domain

53

235

0.87

PF23441

48

295

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9646 4 252
6ihi-assembly1.cif.gz_D crystal structure of rasadh 3b3/i91v from ralstonia.sp in complex with nadph and a6o 0.9634 4 252
4fgs-assembly1.cif.gz_B crystal structure of a probable dehydrogenase protein 0.9612 4 251
4bmn-assembly1.cif.gz_D apo structure of short-chain alcohol dehydrogenase from ralstonia sp. dsm 6428 0.9564 4 252
4fgs-assembly1.cif.gz_D crystal structure of a probable dehydrogenase protein 0.9557 4 251
ID Description Score Start End Superfamily
af_C6T421_12_106_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9688 7 84 3.40.50.720
af_Q9XE46_1_147_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9525 137 253 3.40.50.720
af_P05707_2_258_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9507 9 250 3.40.50.720
af_Q6PKH6_18_219_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9483 7 183 3.40.50.720
3ftpC00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9475 8 250 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A4W4E704-F1-model_v4 Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] (EC 1.3.1.124) (2,4-dienoyl-CoA reductase 2) 0.967 7 198 GO:0005777
GO:0008670
GO:0009062
AF-A0A5C7XHG4-F1-model_v4 SDR family oxidoreductase 0.9654 7 190 GO:0016491
AF-U4KRH9-F1-model_v4 Putative acetoin dehydrogenase BudC (EC 1.1.1.303) 0.962 9 187 GO:0052587
AF-A0A832MUH5-F1-model_v4 SDR family oxidoreductase 0.9613 4 190 GO:0016491
AF-A0A7L4TSE5-F1-model_v4 3-oxoacyl-ACP reductase 0.9613 8 90 GO:0016020
GO:0016491

Feature Viewer

pLDDT pTM Quality
87.77 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map