F428749

General Info

Members Datasets Scaffolds Average Seq Length
380 255 760 198

Family's Representative Sequence

Representative Sequence 3300044656|Ga0466969_0011071|Ga0466969_0011071_1213_1881
Length 222
Sequence MFNMLGPSPAPGTISVRKEHAMSIFGRKNDDTATGAPAAVNPDLASLTGDYTIDPAHSTLGFVARHAMVTNVKGKFNDFTGTLHLDGTDPTRSTATVDAKMDSIDTGSPDRDGHLKSSDFFRTEEFPTMTFRSTSAEALGGDDYRITGELTLLGVTKPLTIDLEFNGAAKDPFGNERVGFEGKAEILRSEWGLTWNAALETGGVLVSDKIKLNFDISAIKTA

Samples

Sample ID Description Type Environment
1 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
5 3300003308 Avena fatua rhizosphere microbial communities - H4_Rhizo_Litter_20 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
6 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
7 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
8 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
9 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
10 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
11 3300003575 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_25 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
12 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
13 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
14 3300003693 Avena fatua rhizosphere microbial communities - H2_Rhizo_Litter_49 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
15 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
16 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
17 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
18 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
19 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
20 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
21 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
22 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
23 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
24 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
25 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
26 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
27 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
28 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
29 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
30 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
31 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
32 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
33 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
34 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
35 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
36 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
37 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
38 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
39 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
40 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
41 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
42 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
43 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
44 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
45 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
46 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
47 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
48 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
49 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
50 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
51 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
52 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
53 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
54 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
55 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
56 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
57 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
58 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
59 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
60 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
61 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
62 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
63 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
64 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
65 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
66 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
67 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
68 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
69 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
70 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
71 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
72 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
73 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
74 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
75 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
76 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
77 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
78 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
79 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
80 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
81 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
82 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
83 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
84 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
85 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
86 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
87 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
88 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
89 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
90 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
91 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
92 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
93 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
94 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
95 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
96 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
97 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
98 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
99 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
100 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
101 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
102 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
103 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
104 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
105 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
106 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
107 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
108 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
109 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
110 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
111 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
112 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
113 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
114 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
115 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
116 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
117 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
118 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
119 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
120 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
121 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
122 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
123 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
124 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
125 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
126 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
127 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
128 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
129 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
130 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
131 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
132 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
133 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
134 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
135 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
136 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
137 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
138 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
139 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
140 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
141 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
142 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
143 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
144 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
145 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
146 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
147 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
148 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
149 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
150 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
151 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
152 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
153 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
154 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
155 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
156 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
157 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
158 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
159 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
160 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
161 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
162 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
163 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
164 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
165 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
166 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
167 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
170 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
175 3300049534 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
176 3300049536 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
177 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
178 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
179 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
180 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
181 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
182 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
183 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
184 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
185 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
186 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
187 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
188 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
189 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
190 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
191 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
192 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
193 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
194 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
195 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
196 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
197 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
198 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
199 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
200 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
201 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
202 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
203 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
204 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
205 3300053101 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 endosphere Metagenome Endosphere
206 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
207 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
208 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
209 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
210 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
213 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
214 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
215 2582581313 Streptomyces mirabilis OV308 Isolate Rhizosphere
216 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
217 2616644814 Streptomyces mirabilis OK461 Isolate Rhizosphere
218 2643221647 Streptomyces sp. Root369 Isolate Unclassified
219 2643221678 Streptomyces sp. Root1310 Isolate Unclassified
220 2643221714 Streptomyces sp. Root264 Isolate Unclassified
221 2784132148 Streptomyces sp. E5N91 SAI-083 Isolate Unclassified
222 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
223 2786546132 Streptomyces sp. W SAI-097 Isolate Unclassified
224 2802429296 Streptomyces sampsonii KJ40 Isolate Rhizosphere
225 2808606359 Streptomyces sp. RJA2910 Isolate Unclassified
226 2808606375 Streptomyces sp. SLBN-31 Isolate Unclassified
227 2808606448 Streptomyces sp. 193411 Isolate Unclassified
228 2811994879 Streptomyces sp. 4-17 Isolate Unclassified
229 2811994917 Streptomyces sp. SLBN-134 Isolate Unclassified
230 2852635781 Streptomyces sp. AK010 Isolate Rhizosphere
231 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
232 2862382967 Streptomyces scabiei NRRL B-2795 Isolate Nodule
233 2862507626 Streptomyces sp. NWU339 Isolate Unclassified
234 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
235 2867428634 Streptomyces sp. RP5T Isolate Unclassified
236 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
237 2877676314 Streptomyces griseorubiginosus 3E-1 Isolate Unclassified
238 2912715099 Streptomyces sp. Z423-1 Isolate Rhizosphere
239 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
240 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
241 2919468124 Streptomyces sp. 3330 Isolate Rhizosphere
242 2946064051 Streptomyces luteogriseus W4I19-1 Isolate Rhizosphere
243 2946072368 Streptomyces achromogenes W4I19-2 Isolate Rhizosphere
244 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
245 2954002825 Streptomyces turgidiscabies W2I16 Isolate Rhizosphere
246 2954673503 Streptomyces sp. SAI-119 Isolate Rhizosphere
247 2954682443 Streptomyces sp. SAI-149 Isolate Rhizosphere
248 3006425503 Streptomyces zingiberis PLAI1-29 Isolate Unclassified
249 3006493962 Streptomyces grisecoloratus TRM S81-3 Isolate Rhizosphere
250 8008558824 Streptomyces scabiei NRRL B-2795 Isolate Nodule
251 8008574985 Streptomyces sp. Jing01 Isolate Rhizosphere
252 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
253 8025530807 Streptomyces sp. 4R-3d Isolate Unclassified
254 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
255 8056829672 Streptomyces barringtoniae JA03 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 80.26
Metatranscriptomes 8.16
Isolates 11.58

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 6.32
Nodule 0.53
Rhizoplane 0.79
Rhizosphere 78.42
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0466969_0011071 3300044656 Bacteria 4777
2 JGI24739J22299_10038334 3300001989 Bacteria 1611
3 JGI24737J22298_10022132 3300001990 Bacteria 2020
4 JGI24738J21930_10038701 3300002075 Bacteria 969
5 Ga0006777J48905_1035587 3300003308 Bacteria 797
6 rootH1_10003300 3300003316 Bacteria 7700
7 rootH1_10022569 3300003316 Bacteria 6262
8 rootH2_10003146 3300003320 Bacteria 4098
9 rootL2_10068843 3300003322 Bacteria 1861
10 rootH1_10013371 3300003323 Bacteria 6153
11 Ga0007417J51691_1073095 3300003544 Bacteria 695
12 Ga0007409J51694_1047840 3300003575 Bacteria 732
13 Ga0007409J51694_1063462 3300003575 Bacteria 864
14 Ga0006562J51391_1067841 3300003578 Bacteria 713
15 Ga0007429J51699_1007655 3300003579 Bacteria 761
16 Ga0007429J51699_1024990 3300003579 Bacteria 775
17 Ga0007429J51699_1073580 3300003579 Bacteria 697
18 Ga0032354_1023136 3300003693 Bacteria 769
19 Ga0032354_1061834 3300003693 Bacteria 668
20 Ga0068855_100646072 3300005563 Bacteria 1137
21 Ga0068856_100750762 3300005614 Bacteria 996
22 Ga0081455_10121827 3300005937 Bacteria 2054
23 Ga0075368_10220397 3300006042 Bacteria 806
24 Ga0075363_100012030 3300006048 Bacteria 4160
25 Ga0075363_100161061 3300006048 Bacteria 1271
26 Ga0075363_100183701 3300006048 Bacteria 1191
27 Ga0075367_10049142 3300006178 Bacteria 2486
28 Ga0075367_10151347 3300006178 Bacteria 1440
29 Ga0075370_10090207 3300006353 Bacteria 1768
30 Ga0105251_10035148 3300009011 Bacteria 2474
31 Ga0105245_10609259 3300009098 Bacteria 1119
32 Ga0105248_10476838 3300009177 Bacteria 1406
33 Ga0105238_11308418 3300009551 Bacteria 751
34 Ga0105239_11005483 3300010375 Bacteria 959
35 Ga0157369_10963787 3300013105 Bacteria 874
36 Ga0157372_10416376 3300013307 Bacteria 1566
37 Ga0182008_10000253 3300014497 Bacteria 41589
38 Ga0182007_10000295 3300015262 Bacteria 32455
39 Ga0183367_1013 3300015688 Bacteria 334176
40 Ga0206356_10072166 3300020070 Bacteria 901
41 Ga0206354_11009237 3300020081 Bacteria 592
42 Ga0224712_10314924 3300022467 Bacteria 734
43 Ga0209758_1007596 3300025297 Bacteria 7321
44 Ga0207426_1025655 3300025302 Bacteria 1982
45 Ga0207647_10046517 3300025904 Bacteria 2703
46 Ga0207687_10449677 3300025927 Bacteria 1068
47 Ga0207711_10699947 3300025941 Bacteria 945
48 Ga0207667_10724785 3300025949 Bacteria 995
49 Ga0207639_10159850 3300026041 Bacteria 1897
50 Ga0209371_1026112 3300027312 Bacteria 1334
51 Ga0209813_10162802 3300027866 Bacteria 806
52 Ga0307517_10001694 3300028786 Bacteria 36420
53 Ga0307515_10003815 3300028794 Bacteria 31511
54 Ga0307515_10106158 3300028794 Bacteria 3335
55 Ga0268256_1029718 3300030500 Bacteria 1334
56 Ga0307511_10000110 3300030521 Bacteria 74100
57 Ga0307511_10031071 3300030521 Bacteria 4780
58 Ga0307512_10003846 3300030522 Bacteria 16901
59 Ga0307512_10034183 3300030522 Bacteria 4354
60 Ga0307512_10258156 3300030522 Bacteria 859
61 Ga0307513_10009907 3300031456 Bacteria 12025
62 Ga0307509_10005284 3300031507 Bacteria 18069
63 Ga0307509_10171694 3300031507 Bacteria 2046
64 Ga0307508_10016285 3300031616 Bacteria 6767
65 Ga0307508_10072748 3300031616 Bacteria 3012
66 Ga0307508_10286006 3300031616 Bacteria 1242
67 Ga0307514_10007021 3300031649 Bacteria 9724
68 Ga0307514_10041355 3300031649 Bacteria 3630
69 Ga0307516_10082089 3300031730 Bacteria 3065
70 Ga0307516_10140416 3300031730 Bacteria 2186
71 Ga0307518_10122618 3300031838 Bacteria 1837
72 Ga0307518_10175127 3300031838 Bacteria 1457
73 Ga0307410_10230501 3300031852 Bacteria 1430
74 Ga0307409_100043015 3300031995 Bacteria 3388
75 Ga0307416_100522929 3300032002 Bacteria 1255
76 Ga0307411_10679266 3300032005 Bacteria 895
77 Ga0307415_100425284 3300032126 Bacteria 1141
78 Ga0307507_10016080 3300033179 Bacteria 8740
79 Ga0307507_10062804 3300033179 Bacteria 3445
80 Ga0307507_10070561 3300033179 Bacteria 3168
81 Ga0307510_10002117 3300033180 Bacteria 22459
82 Ga0307510_10174450 3300033180 Bacteria 1723
83 Ga0395900_0443008 3300037418 Bacteria 1256
84 Ga0395900_0791469 3300037418 Bacteria 877
85 Ga0395898_0036768 3300037466 Bacteria 4860
86 Ga0395898_0362340 3300037466 Bacteria 1382
87 Ga0451802_1660669 3300041460 Bacteria 1459
88 Ga0451853_1919014 3300041512 Bacteria 2534
89 Ga0451853_3967696 3300041512 Bacteria 3456
90 Ga0439433_0044921 3300041999 Bacteria 1033
91 Ga0439448_0017427 3300042005 Bacteria 2193
92 Ga0439432_042683 3300042006 Bacteria 1433
93 Ga0439449_0011984 3300042007 Bacteria 3258
94 Ga0439449_0042060 3300042007 Bacteria 1698
95 Ga0439449_0092462 3300042007 Bacteria 1117
96 Ga0439454_020321 3300042011 Bacteria 973
97 Ga0439455_0008464 3300042012 Bacteria 2207
98 Ga0439457_001380 3300042014 Bacteria 7307
99 Ga0439462_0046993 3300042015 Bacteria 1157
100 Ga0450894_000098 3300042131 Bacteria 14478
101 Ga0450902_020965 3300042137 Bacteria 1079
102 Ga0450903_000127 3300042138 Bacteria 16609
103 Ga0450903_034574 3300042138 Bacteria 757
104 Ga0450906_000986 3300042145 Bacteria 6257
105 Ga0439458_0003900 3300042157 Bacteria 3447
106 Ga0450908_007907 3300042184 Bacteria 1995
107 Ga0466969_0111180 3300044656 Bacteria 1282
108 Ga0466972_0005371 3300044658 Bacteria 6419
109 Ga0466972_0029260 3300044658 Bacteria 2712
110 Ga0466972_0044341 3300044658 Bacteria 2157
111 Ga0466972_0046867 3300044658 Bacteria 2091
112 Ga0466965_0000115 3300044683 Bacteria 22680
113 Ga0466965_0004818 3300044683 Bacteria 6020
114 Ga0466966_0000867 3300044684 Bacteria 19335
115 Ga0466966_0014036 3300044684 Bacteria 5303
116 Ga0466961_0004460 3300044693 Bacteria 8767
117 Ga0466961_0045537 3300044693 Bacteria 2807
118 Ga0466963_0000097 3300044694 Bacteria 30992
119 Ga0466963_0005691 3300044694 Bacteria 7322
120 Ga0466964_0012855 3300044706 Bacteria 3171
121 Ga0466971_0000827 3300044719 Bacteria 12539
122 Ga0466971_0014017 3300044719 Bacteria 3524
123 Ga0466968_0265442 3300044735 Bacteria 818
124 Ga0466970_0010870 3300044765 Bacteria 4629
125 Ga0466970_0016146 3300044765 Bacteria 3846
126 Ga0466957_0000719 3300044842 Bacteria 16989
127 Ga0466959_0000282 3300045049 Bacteria 31016
128 Ga0466958_0014411 3300045836 Bacteria 4514
129 Ga0466967_0009260 3300045976 Bacteria 7295
130 Ga0466967_0112308 3300045976 Bacteria 2505
131 Ga0466967_0386594 3300045976 Bacteria 1359
132 Ga0495627_013886 3300046453 Bacteria 2826
133 Ga0495592_0011480 3300046454 Bacteria 6705
134 Ga0495592_0037459 3300046454 Bacteria 3652
135 Ga0495592_0100306 3300046454 Bacteria 2064
136 Ga0495603_0063629 3300046455 Bacteria 2176
137 Ga0495603_0106256 3300046455 Bacteria 1638
138 Ga0495603_0164226 3300046455 Bacteria 1287
139 Ga0495603_0366471 3300046455 Bacteria 826
140 Ga0495629_0036999 3300046459 Bacteria 3441
141 Ga0495629_0048123 3300046459 Bacteria 2989
142 Ga0495629_0062968 3300046459 Bacteria 2590
143 Ga0495629_0081387 3300046459 Bacteria 2260
144 Ga0495629_0109473 3300046459 Bacteria 1926
145 Ga0495638_0088502 3300046460 Bacteria 1869
146 Ga0495638_0092793 3300046460 Bacteria 1817
147 Ga0495651_0072989 3300046462 Bacteria 2605
148 Ga0495651_0230905 3300046462 Bacteria 1274
149 Ga0495580_0082059 3300046472 Bacteria 2247
150 Ga0495582_0015794 3300046473 Bacteria 4140
151 Ga0495582_0310879 3300046473 Bacteria 906
152 Ga0495605_0001646 3300046474 Bacteria 14369
153 Ga0495639_0080460 3300046475 Bacteria 1517
154 Ga0495662_0000665 3300046476 Bacteria 16196
155 Ga0495662_0016044 3300046476 Bacteria 3634
156 Ga0495662_0052381 3300046476 Bacteria 1970
157 Ga0495662_0123129 3300046476 Bacteria 1273
158 Ga0495664_0025154 3300046477 Bacteria 3465
159 Ga0495664_0230664 3300046477 Bacteria 1120
160 Ga0495664_0279160 3300046477 Bacteria 1009
161 Ga0495585_0059649 3300046492 Bacteria 2102
162 Ga0495594_0013419 3300046499 Bacteria 4278
163 Ga0495594_0086379 3300046499 Bacteria 1755
164 Ga0495594_0098050 3300046499 Bacteria 1647
165 Ga0495607_0032401 3300046501 Bacteria 3190
166 Ga0495606_0036360 3300046507 Bacteria 3354
167 Ga0495610_0032939 3300046512 Bacteria 2685
168 Ga0495616_0015049 3300046513 Bacteria 4306
169 Ga0495618_0130244 3300046514 Bacteria 1609
170 Ga0495620_0032013 3300046515 Bacteria 2401
171 Ga0495620_0098722 3300046515 Bacteria 1166
172 Ga0495628_0029997 3300046516 Bacteria 4405
173 Ga0495628_0174744 3300046516 Bacteria 1627
174 Ga0495628_0406004 3300046516 Bacteria 994
175 Ga0495630_0061289 3300046517 Bacteria 2825
176 Ga0495631_0008459 3300046518 Bacteria 5186
177 Ga0495632_0132350 3300046519 Bacteria 1160
178 Ga0495643_0012193 3300046522 Bacteria 5193
179 Ga0495648_0140638 3300046524 Bacteria 1271
180 Ga0495666_0020639 3300046526 Bacteria 3263
181 Ga0495666_0033883 3300046526 Bacteria 2493
182 Ga0495666_0051990 3300046526 Bacteria 1967
183 Ga0495652_0035798 3300046529 Bacteria 4319
184 Ga0495652_0133008 3300046529 Bacteria 1966
185 Ga0495654_0044398 3300046530 Bacteria 2198
186 Ga0495665_0119446 3300046531 Bacteria 1381
187 Ga0495640_0030749 3300046533 Bacteria 3841
188 Ga0495640_0048149 3300046533 Bacteria 2947
189 Ga0495586_0084819 3300046535 Bacteria 1744
190 Ga0495587_0009610 3300046536 Bacteria 6187
191 Ga0495597_0021245 3300046542 Bacteria 3019
192 Ga0495597_0075262 3300046542 Bacteria 1449
193 Ga0495645_0065381 3300046543 Bacteria 2631
194 Ga0495622_0134519 3300046557 Bacteria 1124
195 Ga0495622_0205968 3300046557 Bacteria 875
196 Ga0495667_0123909 3300046559 Bacteria 1668
197 Ga0495667_0281431 3300046559 Bacteria 1056
198 Ga0495656_0127215 3300046615 Bacteria 1209
199 Ga0495668_0006787 3300046616 Bacteria 7438
200 Ga0495668_0026392 3300046616 Bacteria 3296
201 Ga0495634_0004931 3300046642 Bacteria 10321
202 Ga0495634_0009272 3300046642 Bacteria 7266
203 Ga0495634_0253922 3300046642 Bacteria 1074
204 Ga0495611_0018602 3300046648 Bacteria 2981
205 Ga0495625_0011671 3300046660 Bacteria 7147
206 Ga0495625_0070888 3300046660 Bacteria 2446
207 Ga0495625_0117028 3300046660 Bacteria 1817
208 Ga0495635_0000713 3300046663 Bacteria 21440
209 Ga0495635_0457202 3300046663 Bacteria 843
210 Ga0495661_0258080 3300046665 Bacteria 887
211 Ga0495661_0304590 3300046665 Bacteria 796
212 Ga0495588_0002822 3300046674 Bacteria 7468
213 Ga0495588_0171435 3300046674 Bacteria 1147
214 Ga0495657_0007869 3300046675 Bacteria 8179
215 Ga0495657_0043449 3300046675 Bacteria 3064
216 Ga0495657_0050588 3300046675 Bacteria 2793
217 Ga0495657_0154239 3300046675 Bacteria 1424
218 Ga0495646_0004031 3300046680 Bacteria 9206
219 Ga0495646_0098986 3300046680 Bacteria 1674
220 Ga0495613_0003706 3300046689 Bacteria 11462
221 Ga0495613_0005737 3300046689 Bacteria 9300
222 Ga0495613_0024080 3300046689 Bacteria 4536
223 Ga0495613_0030629 3300046689 Bacteria 3996
224 Ga0495613_0063561 3300046689 Bacteria 2700
225 Ga0495613_0099473 3300046689 Bacteria 2101
226 Ga0495613_0152222 3300046689 Bacteria 1649
227 Ga0495613_0200888 3300046689 Bacteria 1405
228 Ga0495624_0037832 3300046690 Bacteria 3103
229 Ga0495624_0038847 3300046690 Bacteria 3055
230 Ga0495624_0124483 3300046690 Bacteria 1582
231 Ga0495671_0041980 3300046692 Bacteria 2301
232 Ga0495649_0029038 3300046694 Bacteria 3063
233 Ga0495589_0004381 3300046794 Bacteria 7520
234 Ga0495589_0020024 3300046794 Bacteria 3422
235 Ga0495589_0048865 3300046794 Bacteria 2093
236 Ga0495589_0094091 3300046794 Bacteria 1454
237 Ga0495600_0013495 3300046809 Bacteria 5135
238 Ga0495600_0041902 3300046809 Bacteria 2984
239 Ga0495600_0057239 3300046809 Bacteria 2547
240 Ga0495581_0579521 3300047315 Bacteria 650
241 Ga0495604_0000427 3300047317 Bacteria 37908
242 Ga0495604_0042623 3300047317 Bacteria 3556
243 Ga0495636_0007712 3300047318 Bacteria 4234
244 Ga0495636_0021223 3300047318 Bacteria 2622
245 Ga0495636_0091860 3300047318 Bacteria 1318
246 Ga0495636_0344644 3300047318 Bacteria 702
247 Ga0495674_0133903 3300047319 Bacteria 2087
248 Ga0495674_0160064 3300047319 Bacteria 1884
249 Ga0495672_0081954 3300047320 Bacteria 1795
250 Ga0495676_0002676 3300047321 Bacteria 15949
251 Ga0495676_0004972 3300047321 Bacteria 12190
252 Ga0495676_0013197 3300047321 Bacteria 7430
253 Ga0495676_0041973 3300047321 Bacteria 3760
254 Ga0495680_0008999 3300047322 Bacteria 9022
255 Ga0495687_005955 3300047443 Bacteria 7608
256 Ga0495687_009725 3300047443 Bacteria 5345
257 Ga0495675_0023938 3300047444 Bacteria 3891
258 Ga0495685_003328 3300047447 Bacteria 5115
259 Ga0495685_005776 3300047447 Bacteria 4041
260 Ga0495681_0002751 3300047470 Bacteria 12450
261 Ga0495593_0002203 3300047673 Bacteria 11665
262 Ga0495593_0065086 3300047673 Bacteria 1901
263 Ga0495593_0086147 3300047673 Bacteria 1620
264 Ga0495602_0028210 3300048088 Bacteria 5376
265 Ga0495602_0115263 3300048088 Bacteria 2174
266 Ga0495614_0049510 3300048089 Bacteria 1801
267 Ga0495614_0090386 3300048089 Bacteria 1331
268 Ga0495614_0201433 3300048089 Bacteria 901
269 Ga0495626_0004653 3300048091 Bacteria 8335
270 Ga0496108_0253444 3300048911 Bacteria 1531
271 Ga0496111_0545359 3300048914 Bacteria 852
272 Ga0501306_011782 3300049127 Bacteria 1119
273 Ga0501306_021688 3300049127 Bacteria 901
274 Ga0501308_024929 3300049128 Bacteria 772
275 Ga0501309_033604 3300049129 Bacteria 764
276 Ga0501310_013998 3300049130 Bacteria 937
277 Ga0501305_043051 3300049161 Bacteria 740
278 Ga0501307_018276 3300049162 Bacteria 890
279 Ga0495678_098656 3300049459 Bacteria 1015
280 Ga0501311_040161 3300049527 Bacteria 707
281 Ga0501313_025948 3300049529 Bacteria 743
282 Ga0501315_029928 3300049531 Bacteria 779
283 Ga0501316_025247 3300049532 Bacteria 772
284 Ga0501317_020227 3300049533 Bacteria 895
285 Ga0501318_027685 3300049534 Bacteria 755
286 Ga0501320_020459 3300049536 Bacteria 762
287 Ga0501322_009817 3300049538 Bacteria 729
288 Ga0501323_027839 3300049539 Bacteria 780
289 Ga0501032_0120447 3300049569 Bacteria 1735
290 Ga0501033_0026085 3300049570 Bacteria 4398
291 Ga0501033_0667293 3300049570 Bacteria 709
292 Ga0501034_0050760 3300049571 Bacteria 4183
293 Ga0501036_0331961 3300049572 Bacteria 1270
294 Ga0501037_0134430 3300049573 Bacteria 1772
295 Ga0501038_0012549 3300049574 Bacteria 7742
296 Ga0501038_0032992 3300049574 Bacteria 4562
297 Ga0501043_0041191 3300049579 Bacteria 3629
298 Ga0501047_0016896 3300049581 Bacteria 6974
299 Ga0501047_0021266 3300049581 Bacteria 6228
300 Ga0501047_0054283 3300049581 Bacteria 3875
301 Ga0501048_0263924 3300049582 Bacteria 1223
302 Ga0501048_0804397 3300049582 Bacteria 675
303 Ga0501067_0271916 3300049583 Bacteria 944
304 Ga0501069_0257558 3300049585 Bacteria 1018
305 Ga0501070_0461241 3300049586 Bacteria 1024
306 Ga0501073_0331423 3300049589 Bacteria 1051
307 Ga0501080_0401965 3300049742 Bacteria 1232
308 Ga0501282_015301 3300049778 Bacteria 833
309 Ga0501035_0149798 3300049822 Bacteria 2025
310 Ga0501035_0153975 3300049822 Bacteria 1993
311 Ga0501035_0204729 3300049822 Bacteria 1691
312 Ga0501044_0001972 3300049823 Bacteria 23738
313 Ga0501044_0044426 3300049823 Bacteria 4610
314 Ga0501044_0044742 3300049823 Bacteria 4591
315 Ga0501044_0161812 3300049823 Bacteria 2214
316 Ga0501044_0426072 3300049823 Bacteria 1236
317 nmdc:mga03n38_290587_c1 3300050490 Bacteria 875
318 nmdc:mga03n38_80327_c1 3300050490 Bacteria 1007
319 nmdc:mga06z11_298396_c1 3300050494 Bacteria 958
320 nmdc:mga04h51_188560_c1 3300050495 Bacteria 806
321 nmdc:mga07m45_216201_c1 3300050496 Bacteria 1115
322 Ga0495612_0110396 3300053078 Bacteria 1176
323 Ga0495619_0354547 3300053085 Bacteria 1015
324 Ga0500578_0145710 3300053086 Bacteria 1478
325 Ga0500644_0029089 3300053088 Bacteria 1734
326 Ga0500640_008841 3300053095 Bacteria 4003
327 Ga0500553_057832 3300053101 Bacteria 1833
328 Ga0500608_034508 3300053122 Bacteria 2411
329 Ga0500652_196216 3300053131 Bacteria 821
330 Ga0500600_0063396 3300053149 Bacteria 2052
331 Ga0500600_0085586 3300053149 Bacteria 1694
332 Ga0500633_0098906 3300053160 Bacteria 1072
333 Ga0587075_061133 3300059644 Bacteria 680
334 Ga0587111_0071487 3300060346 Bacteria 811
335 Ga0466962_0005143 3300061719 Bacteria 6293
336 Ga0466962_0083129 3300061719 Bacteria 1532
337 2547411542 2547132111 Bacteria 8013147
338 2554256091 2554235005 Bacteria 6457341
339 2585311330 2582581313 Bacteria 10042643
340 2585317919 2582581314 Bacteria 11452267
341 2616700541 2616644814 Bacteria 11555299
342 2644269501 2643221647 Bacteria 10741251
343 2644437853 2643221678 Bacteria 9540101
344 2644629760 2643221714 Bacteria 9015452
345 2644631199 2643221714 Bacteria 9015452
346 2784590555 2784132148 Bacteria 8627943
347 2785341031 2784746763 Bacteria 9783172
348 2786672828 2786546132 Bacteria 10419719
349 2804848087 2802429296 Bacteria 7227771
350 2808844180 2808606359 Bacteria 9866990
351 2808913797 2808606375 Bacteria 9466072
352 2809234248 2808606448 Bacteria 8656184
353 2812355786 2811994879 Bacteria 9313447
354 2812478599 2811994917 Bacteria 7761064
355 2852639635 2852635781 Bacteria 8251373
356 2862284555 2862281513 Bacteria 9621493
357 2862385194 2862382967 Bacteria 10317375
358 2862511282 2862507626 Bacteria 9425308
359 2863408804 2863404153 Bacteria 9672205
360 2867434087 2867428634 Bacteria 9590268
361 2873153899 2873151551 Bacteria 8625867
362 2877678873 2877676314 Bacteria 9512378
363 2912717424 2912715099 Bacteria 9460473
364 2912729999 2912723979 Bacteria 8557534
365 2912762956 2912757875 Bacteria 7940295
366 2919472409 2919468124 Bacteria 9133025
367 2946070006 2946064051 Bacteria 8957905
368 2946077898 2946072368 Bacteria 8999607
369 2947226767 2947224130 Bacteria 9938529
370 2954005712 2954002825 Bacteria 9173742
371 2954679132 2954673503 Bacteria 9685905
372 2954685020 2954682443 Bacteria 9862841
373 3006427711 3006425503 Bacteria 6491253
374 3006496702 3006493962 Bacteria 8825450
375 8008562967 8008558824 Bacteria 10610750
376 8008576994 8008574985 Bacteria 7815457
377 8023631192 8023623736 Bacteria 8593882
378 8025532581 8025530807 Bacteria 8495698
379 8048409178 8048406513 Bacteria 8936924
380 8056834026 8056829672 Bacteria 9045328
381 Ga0466969_0011071
382 JGI24739J22299_10038334
383 JGI24737J22298_10022132
384 JGI24738J21930_10038701
385 Ga0006777J48905_1035587
386 rootH1_10003300
387 rootH1_10022569
388 rootH2_10003146
389 rootL2_10068843
390 rootH1_10013371
391 Ga0007417J51691_1073095
392 Ga0007409J51694_1047840
393 Ga0007409J51694_1063462
394 Ga0006562J51391_1067841
395 Ga0007429J51699_1007655
396 Ga0007429J51699_1024990
397 Ga0007429J51699_1073580
398 Ga0032354_1023136
399 Ga0032354_1061834
400 Ga0068855_100646072
401 Ga0068856_100750762
402 Ga0081455_10121827
403 Ga0075368_10220397
404 Ga0075363_100012030
405 Ga0075363_100161061
406 Ga0075363_100183701
407 Ga0075367_10049142
408 Ga0075367_10151347
409 Ga0075370_10090207
410 Ga0105251_10035148
411 Ga0105245_10609259
412 Ga0105248_10476838
413 Ga0105238_11308418
414 Ga0105239_11005483
415 Ga0157369_10963787
416 Ga0157372_10416376
417 Ga0182008_10000253
418 Ga0182007_10000295
419 Ga0183367_1013
420 Ga0206356_10072166
421 Ga0206354_11009237
422 Ga0224712_10314924
423 Ga0209758_1007596
424 Ga0207426_1025655
425 Ga0207647_10046517
426 Ga0207687_10449677
427 Ga0207711_10699947
428 Ga0207667_10724785
429 Ga0207639_10159850
430 Ga0209371_1026112
431 Ga0209813_10162802
432 Ga0307517_10001694
433 Ga0307515_10003815
434 Ga0307515_10106158
435 Ga0268256_1029718
436 Ga0307511_10000110
437 Ga0307511_10031071
438 Ga0307512_10003846
439 Ga0307512_10034183
440 Ga0307512_10258156
441 Ga0307513_10009907
442 Ga0307509_10005284
443 Ga0307509_10171694
444 Ga0307508_10016285
445 Ga0307508_10072748
446 Ga0307508_10286006
447 Ga0307514_10007021
448 Ga0307514_10041355
449 Ga0307516_10082089
450 Ga0307516_10140416
451 Ga0307518_10122618
452 Ga0307518_10175127
453 Ga0307410_10230501
454 Ga0307409_100043015
455 Ga0307416_100522929
456 Ga0307411_10679266
457 Ga0307415_100425284
458 Ga0307507_10016080
459 Ga0307507_10062804
460 Ga0307507_10070561
461 Ga0307510_10002117
462 Ga0307510_10174450
463 Ga0395900_0443008
464 Ga0395900_0791469
465 Ga0395898_0036768
466 Ga0395898_0362340
467 Ga0451802_1660669
468 Ga0451853_1919014
469 Ga0451853_3967696
470 Ga0439433_0044921
471 Ga0439448_0017427
472 Ga0439432_042683
473 Ga0439449_0011984
474 Ga0439449_0042060
475 Ga0439449_0092462
476 Ga0439454_020321
477 Ga0439455_0008464
478 Ga0439457_001380
479 Ga0439462_0046993
480 Ga0450894_000098
481 Ga0450902_020965
482 Ga0450903_000127
483 Ga0450903_034574
484 Ga0450906_000986
485 Ga0439458_0003900
486 Ga0450908_007907
487 Ga0466969_0111180
488 Ga0466972_0005371
489 Ga0466972_0029260
490 Ga0466972_0044341
491 Ga0466972_0046867
492 Ga0466965_0000115
493 Ga0466965_0004818
494 Ga0466966_0000867
495 Ga0466966_0014036
496 Ga0466961_0004460
497 Ga0466961_0045537
498 Ga0466963_0000097
499 Ga0466963_0005691
500 Ga0466964_0012855
501 Ga0466971_0000827
502 Ga0466971_0014017
503 Ga0466968_0265442
504 Ga0466970_0010870
505 Ga0466970_0016146
506 Ga0466957_0000719
507 Ga0466959_0000282
508 Ga0466958_0014411
509 Ga0466967_0009260
510 Ga0466967_0112308
511 Ga0466967_0386594
512 Ga0495627_013886
513 Ga0495592_0011480
514 Ga0495592_0037459
515 Ga0495592_0100306
516 Ga0495603_0063629
517 Ga0495603_0106256
518 Ga0495603_0164226
519 Ga0495603_0366471
520 Ga0495629_0036999
521 Ga0495629_0048123
522 Ga0495629_0062968
523 Ga0495629_0081387
524 Ga0495629_0109473
525 Ga0495638_0088502
526 Ga0495638_0092793
527 Ga0495651_0072989
528 Ga0495651_0230905
529 Ga0495580_0082059
530 Ga0495582_0015794
531 Ga0495582_0310879
532 Ga0495605_0001646
533 Ga0495639_0080460
534 Ga0495662_0000665
535 Ga0495662_0016044
536 Ga0495662_0052381
537 Ga0495662_0123129
538 Ga0495664_0025154
539 Ga0495664_0230664
540 Ga0495664_0279160
541 Ga0495585_0059649
542 Ga0495594_0013419
543 Ga0495594_0086379
544 Ga0495594_0098050
545 Ga0495607_0032401
546 Ga0495606_0036360
547 Ga0495610_0032939
548 Ga0495616_0015049
549 Ga0495618_0130244
550 Ga0495620_0032013
551 Ga0495620_0098722
552 Ga0495628_0029997
553 Ga0495628_0174744
554 Ga0495628_0406004
555 Ga0495630_0061289
556 Ga0495631_0008459
557 Ga0495632_0132350
558 Ga0495643_0012193
559 Ga0495648_0140638
560 Ga0495666_0020639
561 Ga0495666_0033883
562 Ga0495666_0051990
563 Ga0495652_0035798
564 Ga0495652_0133008
565 Ga0495654_0044398
566 Ga0495665_0119446
567 Ga0495640_0030749
568 Ga0495640_0048149
569 Ga0495586_0084819
570 Ga0495587_0009610
571 Ga0495597_0021245
572 Ga0495597_0075262
573 Ga0495645_0065381
574 Ga0495622_0134519
575 Ga0495622_0205968
576 Ga0495667_0123909
577 Ga0495667_0281431
578 Ga0495656_0127215
579 Ga0495668_0006787
580 Ga0495668_0026392
581 Ga0495634_0004931
582 Ga0495634_0009272
583 Ga0495634_0253922
584 Ga0495611_0018602
585 Ga0495625_0011671
586 Ga0495625_0070888
587 Ga0495625_0117028
588 Ga0495635_0000713
589 Ga0495635_0457202
590 Ga0495661_0258080
591 Ga0495661_0304590
592 Ga0495588_0002822
593 Ga0495588_0171435
594 Ga0495657_0007869
595 Ga0495657_0043449
596 Ga0495657_0050588
597 Ga0495657_0154239
598 Ga0495646_0004031
599 Ga0495646_0098986
600 Ga0495613_0003706
601 Ga0495613_0005737
602 Ga0495613_0024080
603 Ga0495613_0030629
604 Ga0495613_0063561
605 Ga0495613_0099473
606 Ga0495613_0152222
607 Ga0495613_0200888
608 Ga0495624_0037832
609 Ga0495624_0038847
610 Ga0495624_0124483
611 Ga0495671_0041980
612 Ga0495649_0029038
613 Ga0495589_0004381
614 Ga0495589_0020024
615 Ga0495589_0048865
616 Ga0495589_0094091
617 Ga0495600_0013495
618 Ga0495600_0041902
619 Ga0495600_0057239
620 Ga0495581_0579521
621 Ga0495604_0000427
622 Ga0495604_0042623
623 Ga0495636_0007712
624 Ga0495636_0021223
625 Ga0495636_0091860
626 Ga0495636_0344644
627 Ga0495674_0133903
628 Ga0495674_0160064
629 Ga0495672_0081954
630 Ga0495676_0002676
631 Ga0495676_0004972
632 Ga0495676_0013197
633 Ga0495676_0041973
634 Ga0495680_0008999
635 Ga0495687_005955
636 Ga0495687_009725
637 Ga0495675_0023938
638 Ga0495685_003328
639 Ga0495685_005776
640 Ga0495681_0002751
641 Ga0495593_0002203
642 Ga0495593_0065086
643 Ga0495593_0086147
644 Ga0495602_0028210
645 Ga0495602_0115263
646 Ga0495614_0049510
647 Ga0495614_0090386
648 Ga0495614_0201433
649 Ga0495626_0004653
650 Ga0496108_0253444
651 Ga0496111_0545359
652 Ga0501306_011782
653 Ga0501306_021688
654 Ga0501308_024929
655 Ga0501309_033604
656 Ga0501310_013998
657 Ga0501305_043051
658 Ga0501307_018276
659 Ga0495678_098656
660 Ga0501311_040161
661 Ga0501313_025948
662 Ga0501315_029928
663 Ga0501316_025247
664 Ga0501317_020227
665 Ga0501318_027685
666 Ga0501320_020459
667 Ga0501322_009817
668 Ga0501323_027839
669 Ga0501032_0120447
670 Ga0501033_0026085
671 Ga0501033_0667293
672 Ga0501034_0050760
673 Ga0501036_0331961
674 Ga0501037_0134430
675 Ga0501038_0012549
676 Ga0501038_0032992
677 Ga0501043_0041191
678 Ga0501047_0016896
679 Ga0501047_0021266
680 Ga0501047_0054283
681 Ga0501048_0263924
682 Ga0501048_0804397
683 Ga0501067_0271916
684 Ga0501069_0257558
685 Ga0501070_0461241
686 Ga0501073_0331423
687 Ga0501080_0401965
688 Ga0501282_015301
689 Ga0501035_0149798
690 Ga0501035_0153975
691 Ga0501035_0204729
692 Ga0501044_0001972
693 Ga0501044_0044426
694 Ga0501044_0044742
695 Ga0501044_0161812
696 Ga0501044_0426072
697 nmdc:mga03n38_290587_c1
698 nmdc:mga03n38_80327_c1
699 nmdc:mga06z11_298396_c1
700 nmdc:mga04h51_188560_c1
701 nmdc:mga07m45_216201_c1
702 Ga0495612_0110396
703 Ga0495619_0354547
704 Ga0500578_0145710
705 Ga0500644_0029089
706 Ga0500640_008841
707 Ga0500553_057832
708 Ga0500608_034508
709 Ga0500652_196216
710 Ga0500600_0063396
711 Ga0500600_0085586
712 Ga0500633_0098906
713 Ga0587075_061133
714 Ga0587111_0071487
715 Ga0466962_0005143
716 Ga0466962_0083129
717 2547411542
718 2554256091
719 2585311330
720 2585317919
721 2616700541
722 2644269501
723 2644437853
724 2644629760
725 2644631199
726 2784590555
727 2785341031
728 2786672828
729 2804848087
730 2808844180
731 2808913797
732 2809234248
733 2812355786
734 2812478599
735 2852639635
736 2862284555
737 2862385194
738 2862511282
739 2863408804
740 2867434087
741 2873153899
742 2877678873
743 2912717424
744 2912729999
745 2912762956
746 2919472409
747 2946070006
748 2946077898
749 2947226767
750 2954005712
751 2954679132
752 2954685020
753 3006427711
754 3006496702
755 8008562967
756 8008576994
757 8023631192
758 8025532581
759 8048409178
760 8056834026

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04264

YceI

YceI-like domain

51

218

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9281 11 183
7bwl-assembly1.cif.gz_A structure of antibiotic sequester from pseudomonas aerurinosa 0.9227 11 183
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9205 11 184
1y0g-assembly2.cif.gz_D crystal structure of the escherichia coli ycei protein, structural genomics 0.9153 11 184
5ixh-assembly1.cif.gz_A crystal structure of burkholderia cenocepacia bcna 0.9091 15 179
ID Description Score Start End Superfamily
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9228 11 184 2.40.128.110
af_P0A8X2_23_191_2.40.128.110 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9175 11 184 2.40.128.110
1wubA00 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9035 12 184 2.40.128.110
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.9029 31 184 2.40.128.110
5w2dA01 Mainly Beta;Beta Barrel;Lipocalin;Lipid/polyisoprenoid-binding, YceI-like 0.8972 31 184 2.40.128.110
ID Description Score Start End GO Terms
AF-A0A850D6W1-F1-model_v4 deleted 0.9692 1 151
AF-A0A351D3E9-F1-model_v4 Lipid/polyisoprenoid-binding YceI-like domain-containing protein 0.964 10 184
AF-A0A7C2Q9A1-F1-model_v4 Polyisoprenoid-binding protein 0.9619 10 182
AF-A0A2N1UYY6-F1-model_v4 Polyisoprenoid-binding protein 0.9609 10 183
AF-A0A1F2Z4H7-F1-model_v4 Polyisoprenoid-binding protein 0.9574 10 184

Map