F428747

General Info

Members Datasets Scaffolds Average Seq Length
380 162 760 163

Family's Representative Sequence

Representative Sequence 3300042876|Ga0451577_0298735|Ga0451577_0298735_483_1019
Length 178
Sequence MELEKTWQEAMDKIATWARVNSPWILHYNSGSCNGCDIEIVAVLTPRYDVERFGLKLQGSPRHADVLVCTGPVTRQSRDRLRRIYEQMPDPKFVVAVGSCATSGGVFQGCYNVVGHIDEVIPVNAYIPGCPPRPEAIIDGVVKLLQSLQAPAAPATEPAARPESYVPAEASAVEGENR

Samples

Sample ID Description Type Environment
1 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
5 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
6 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
17 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
22 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
23 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
24 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
25 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
26 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
27 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
28 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
29 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
30 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
31 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
32 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
33 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
34 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
35 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
36 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
37 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
38 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
39 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
40 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
41 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
42 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
43 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
44 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
45 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
46 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
47 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
48 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
49 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
50 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
51 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
55 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
56 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
57 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
58 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
59 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
60 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
61 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
62 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
63 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
64 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
65 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
66 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
67 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
68 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
69 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
70 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
71 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
72 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
73 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
74 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
75 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
76 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
77 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
109 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
112 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
120 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
121 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
122 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
123 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
124 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
125 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
126 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
127 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
128 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
129 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
130 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
131 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
132 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
133 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
134 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
135 3300031665 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_050615r2r3 Metagenome Rhizosphere
136 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
137 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
138 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
139 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
140 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
141 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
142 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
143 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
144 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
145 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
146 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
147 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
148 3300038725 Seagrass microbial communities from Seahorse Key, FL, USA - HV0818 Metagenome Unclassified
149 3300038726 Seagrass microbial communities from Seahorse Key, FL, USA - TH0319 Metagenome Unclassified
150 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
151 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
152 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
153 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
154 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
155 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
156 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
157 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
158 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
159 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
160 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
161 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
162 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.05
Rhizosphere 97.63
Stem 0
Stem Tuber 0
Unclassified 21.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0451577_0298735 3300042876 Bacteria 1459
2 rootH1_10196822 3300003316 Unclassified 1160
3 rootH2_10114393 3300003320 Bacteria 1581
4 rootH2_10121829 3300003320 Bacteria 2655
5 Ga0065704_10168798 3300005289 Unclassified 1302
6 Ga0065707_10003159 3300005295 Unclassified 3957
7 Ga0070658_10031997 3300005327 Bacteria 4229
8 Ga0070658_10054883 3300005327 Bacteria 3236
9 Ga0070676_10095325 3300005328 Bacteria 1830
10 Ga0070683_100000282 3300005329 Bacteria 34970
11 Ga0070683_100022582 3300005329 Bacteria 5625
12 Ga0070683_100044853 3300005329 Unclassified 4079
13 Ga0070683_100045678 3300005329 Bacteria 4043
14 Ga0070690_100459670 3300005330 Bacteria 945
15 Ga0070670_100107361 3300005331 Bacteria 2406
16 Ga0068869_100027439 3300005334 Bacteria 3970
17 Ga0068869_100172512 3300005334 Bacteria 1690
18 Ga0070680_100033639 3300005336 Bacteria 4134
19 Ga0070682_100148763 3300005337 Unclassified 1604
20 Ga0068868_100007406 3300005338 Bacteria 7814
21 Ga0068868_100036337 3300005338 Bacteria 3812
22 Ga0068868_100138378 3300005338 Unclassified 1997
23 Ga0070660_100001506 3300005339 Bacteria 15965
24 Ga0070660_100474714 3300005339 Bacteria 1039
25 Ga0070661_100004448 3300005344 Bacteria 9664
26 Ga0070661_100176220 3300005344 Bacteria 1625
27 Ga0070668_100440207 3300005347 Bacteria 1119
28 Ga0070671_100027022 3300005355 Bacteria 4722
29 Ga0070671_100292775 3300005355 Bacteria 1386
30 Ga0070667_100028657 3300005367 Bacteria 4637
31 Ga0070667_100077032 3300005367 Bacteria 2847
32 Ga0070714_100022918 3300005435 Bacteria 5123
33 Ga0070713_100210219 3300005436 Bacteria 1761
34 Ga0070713_100418610 3300005436 Bacteria 1254
35 Ga0070711_100504567 3300005439 Unclassified 998
36 Ga0070663_100233934 3300005455 Unclassified 1448
37 Ga0070662_100851107 3300005457 Bacteria 777
38 Ga0070681_10002976 3300005458 Bacteria 15719
39 Ga0070679_100003299 3300005530 Bacteria 14769
40 Ga0070684_100000597 3300005535 Bacteria 24821
41 Ga0070684_100143673 3300005535 Bacteria 2159
42 Ga0070684_100345072 3300005535 Unclassified 1369
43 Ga0070684_101201227 3300005535 Unclassified 713
44 Ga0068853_100000333 3300005539 Bacteria 33063
45 Ga0068853_100264834 3300005539 Unclassified 1581
46 Ga0068853_100415947 3300005539 Bacteria 1260
47 Ga0068853_100747125 3300005539 Bacteria 935
48 Ga0070672_100458454 3300005543 Bacteria 1099
49 Ga0070665_100213272 3300005548 Bacteria 1931
50 Ga0070665_100948967 3300005548 Bacteria 873
51 Ga0068855_100001257 3300005563 Bacteria 31483
52 Ga0068855_100002295 3300005563 Bacteria 23633
53 Ga0068855_100007984 3300005563 Bacteria 12783
54 Ga0068855_100172036 3300005563 Archaea 2452
55 Ga0070664_100129863 3300005564 Archaea 2213
56 Ga0070664_100469853 3300005564 Bacteria 1156
57 Ga0068857_100002013 3300005577 Bacteria 16481
58 Ga0068857_100114185 3300005577 Bacteria 2429
59 Ga0068857_100466468 3300005577 Bacteria 1182
60 Ga0068854_100049807 3300005578 Bacteria 2994
61 Ga0068854_100147135 3300005578 Unclassified 1813
62 Ga0068854_100305883 3300005578 Bacteria 1288
63 Ga0068854_100330390 3300005578 Unclassified 1242
64 Ga0068856_100007750 3300005614 Bacteria 10485
65 Ga0068856_100012305 3300005614 Bacteria 8285
66 Ga0068856_100052410 3300005614 Bacteria 4023
67 Ga0068856_100065888 3300005614 Bacteria 3579
68 Ga0068856_100183899 3300005614 Unclassified 2103
69 Ga0068856_100458331 3300005614 Unclassified 1296
70 Ga0068856_100863807 3300005614 Unclassified 924
71 Ga0068852_100000017 3300005616 Bacteria 132313
72 Ga0068852_100002239 3300005616 Bacteria 13269
73 Ga0068852_100012320 3300005616 Bacteria 6487
74 Ga0068852_100155459 3300005616 Unclassified 2130
75 Ga0068852_100563880 3300005616 Bacteria 1140
76 Ga0068852_101168222 3300005616 Bacteria 790
77 Ga0068859_100062414 3300005617 Bacteria 3756
78 Ga0068864_100005523 3300005618 Bacteria 10361
79 Ga0068864_100813986 3300005618 Bacteria 919
80 Ga0068866_10541387 3300005718 Bacteria 777
81 Ga0068851_10020351 3300005834 Bacteria 3212
82 Ga0068851_10031666 3300005834 Bacteria 2628
83 Ga0068851_10130314 3300005834 Bacteria 1359
84 Ga0068863_100011732 3300005841 Bacteria 8475
85 Ga0068858_100025911 3300005842 Bacteria 5453
86 Ga0068860_100004141 3300005843 Bacteria 14863
87 Ga0068862_100069009 3300005844 Bacteria 3050
88 Ga0070717_10000563 3300006028 Bacteria 23636
89 Ga0070717_10024574 3300006028 Bacteria 4787
90 Ga0070717_10134389 3300006028 Unclassified 2129
91 Ga0070716_101148705 3300006173 Unclassified 621
92 Ga0070712_100094709 3300006175 Bacteria 2195
93 Ga0070712_100704432 3300006175 Unclassified 861
94 Ga0070712_101057342 3300006175 Bacteria 704
95 Ga0097621_100112280 3300006237 Bacteria 2304
96 Ga0097621_100186692 3300006237 Bacteria 1793
97 Ga0068871_100095107 3300006358 Bacteria 2487
98 Ga0068871_100209261 3300006358 Bacteria 1686
99 Ga0068871_100486952 3300006358 Bacteria 1110
100 Ga0075428_100820899 3300006844 Unclassified 988
101 Ga0075429_100302833 3300006880 Unclassified 1399
102 Ga0068865_100525131 3300006881 Bacteria 990
103 Ga0097620_100062416 3300006931 Bacteria 3756
104 Ga0105240_10000110 3300009093 Bacteria 171018
105 Ga0105240_10002142 3300009093 Bacteria 32242
106 Ga0105240_10005844 3300009093 Bacteria 18243
107 Ga0105240_10007039 3300009093 Bacteria 16410
108 Ga0105240_10009925 3300009093 Bacteria 13426
109 Ga0105240_10017869 3300009093 Bacteria 9541
110 Ga0105240_10279499 3300009093 Bacteria 1918
111 Ga0105245_10006386 3300009098 Bacteria 10370
112 Ga0105245_10024024 3300009098 Bacteria 5350
113 Ga0105245_10102645 3300009098 Bacteria 2648
114 Ga0105247_10031679 3300009101 Bacteria 3210
115 Ga0114129_10227250 3300009147 Bacteria 2515
116 Ga0105243_10501053 3300009148 Bacteria 1151
117 Ga0105241_10000029 3300009174 Bacteria 125929
118 Ga0105241_10000550 3300009174 Bacteria 28315
119 Ga0105241_10004830 3300009174 Bacteria 9935
120 Ga0105241_10007421 3300009174 Bacteria 8071
121 Ga0105241_10018936 3300009174 Bacteria 5073
122 Ga0105241_10021242 3300009174 Bacteria 4797
123 Ga0105242_11415414 3300009176 Unclassified 723
124 Ga0105248_10000795 3300009177 Bacteria 35418
125 Ga0105248_10055869 3300009177 Bacteria 4429
126 Ga0105248_10113796 3300009177 Bacteria 3051
127 Ga0105248_12361388 3300009177 Unclassified 606
128 Ga0105237_10002262 3300009545 Bacteria 23960
129 Ga0105237_10021153 3300009545 Bacteria 6692
130 Ga0105237_10233863 3300009545 Unclassified 1839
131 Ga0105238_10000600 3300009551 Bacteria 37822
132 Ga0105238_10002104 3300009551 Bacteria 20114
133 Ga0105238_10003199 3300009551 Bacteria 16345
134 Ga0105238_10060328 3300009551 Bacteria 3798
135 Ga0105238_10153301 3300009551 Unclassified 2279
136 Ga0105249_10599852 3300009553 Bacteria 1156
137 Ga0105239_10003266 3300010375 Bacteria 20003
138 Ga0105239_10012317 3300010375 Bacteria 9524
139 Ga0105239_10037117 3300010375 Bacteria 5345
140 Ga0105239_10126434 3300010375 Bacteria 2841
141 Ga0105239_11217798 3300010375 Unclassified 868
142 Ga0105246_10191515 3300011119 Bacteria 1583
143 Ga0157370_10000001 3300013104 Bacteria 529517
144 Ga0157369_10000017 3300013105 Bacteria 246520
145 Ga0157369_10001197 3300013105 Bacteria 32299
146 Ga0157369_10001363 3300013105 Bacteria 30141
147 Ga0157369_10062155 3300013105 Bacteria 4025
148 Ga0157369_10077205 3300013105 Bacteria 3570
149 Ga0157374_10068254 3300013296 Bacteria 3345
150 Ga0157374_10074347 3300013296 Bacteria 3209
151 Ga0157374_10082816 3300013296 Unclassified 3047
152 Ga0157378_10012030 3300013297 Bacteria 7574
153 Ga0157378_10014227 3300013297 Bacteria 6964
154 Ga0157378_10150076 3300013297 Unclassified 2171
155 Ga0163162_10293796 3300013306 Bacteria 1756
156 Ga0157372_10000019 3300013307 Bacteria 209591
157 Ga0157372_10000968 3300013307 Bacteria 31318
158 Ga0157372_10039234 3300013307 Bacteria 5227
159 Ga0157372_10064988 3300013307 Bacteria 4095
160 Ga0157372_10119767 3300013307 Bacteria 3022
161 Ga0157372_10135053 3300013307 Bacteria 2840
162 Ga0157372_11246773 3300013307 Unclassified 859
163 Ga0157375_10004932 3300013308 Bacteria 11606
164 Ga0163163_10211748 3300014325 Bacteria 1987
165 Ga0157379_10010164 3300014968 Bacteria 8200
166 Ga0157376_10055945 3300014969 Bacteria 3294
167 Ga0157376_10930028 3300014969 Bacteria 889
168 Ga0157376_12018598 3300014969 Unclassified 614
169 Ga0207656_10008622 3300025321 Archaea 3759
170 Ga0207656_10411924 3300025321 Bacteria 680
171 Ga0207692_10107673 3300025898 Bacteria 1541
172 Ga0207692_10885919 3300025898 Bacteria 586
173 Ga0207699_10910153 3300025906 Bacteria 649
174 Ga0207705_10027459 3300025909 Unclassified 4059
175 Ga0207705_10071719 3300025909 Unclassified 2511
176 Ga0207705_10194286 3300025909 Archaea 1536
177 Ga0207654_10000039 3300025911 Bacteria 105913
178 Ga0207654_10000268 3300025911 Bacteria 31847
179 Ga0207654_10215516 3300025911 Bacteria 1271
180 Ga0207707_10004167 3300025912 Bacteria 12808
181 Ga0207695_10000026 3300025913 Bacteria 624558
182 Ga0207695_10000161 3300025913 Bacteria 199839
183 Ga0207695_10000252 3300025913 Bacteria 139109
184 Ga0207695_10001682 3300025913 Bacteria 35568
185 Ga0207695_10010889 3300025913 Bacteria 11072
186 Ga0207695_10010972 3300025913 Bacteria 11013
187 Ga0207695_10360515 3300025913 Bacteria 1340
188 Ga0207671_10000082 3300025914 Bacteria 146424
189 Ga0207671_10000512 3300025914 Bacteria 52517
190 Ga0207671_10557444 3300025914 Bacteria 914
191 Ga0207671_11324123 3300025914 Unclassified 560
192 Ga0207693_10568364 3300025915 Bacteria 884
193 Ga0207663_10027185 3300025916 Bacteria 3331
194 Ga0207663_11050439 3300025916 Bacteria 654
195 Ga0207660_10062440 3300025917 Unclassified 2684
196 Ga0207657_10005001 3300025919 Bacteria 13929
197 Ga0207649_10129334 3300025920 Bacteria 1713
198 Ga0207649_10506229 3300025920 Unclassified 919
199 Ga0207652_10013702 3300025921 Bacteria 6556
200 Ga0207694_10000246 3300025924 Bacteria 51904
201 Ga0207694_10000769 3300025924 Bacteria 28761
202 Ga0207694_10004633 3300025924 Bacteria 10707
203 Ga0207694_10018618 3300025924 Bacteria 5250
204 Ga0207694_10110798 3300025924 Unclassified 2184
205 Ga0207650_10095290 3300025925 Bacteria 2281
206 Ga0207687_10051395 3300025927 Bacteria 2873
207 Ga0207687_10111459 3300025927 Bacteria 2031
208 Ga0207700_10136881 3300025928 Bacteria 2007
209 Ga0207700_10256167 3300025928 Bacteria 1497
210 Ga0207664_10059711 3300025929 Unclassified 3038
211 Ga0207664_10179118 3300025929 Bacteria 1819
212 Ga0207664_10587853 3300025929 Bacteria 1000
213 Ga0207664_10664867 3300025929 Unclassified 936
214 Ga0207644_10527314 3300025931 Bacteria 976
215 Ga0207706_10053356 3300025933 Bacteria 3569
216 Ga0207704_10228740 3300025938 Bacteria 1381
217 Ga0207711_10004621 3300025941 Bacteria 11706
218 Ga0207711_10324905 3300025941 Bacteria 1422
219 Ga0207689_10028695 3300025942 Bacteria 4654
220 Ga0207661_10052942 3300025944 Unclassified 3246
221 Ga0207661_10110541 3300025944 Bacteria 2323
222 Ga0207661_10169717 3300025944 Unclassified 1899
223 Ga0207661_10891363 3300025944 Unclassified 819
224 Ga0207667_10006012 3300025949 Bacteria 14771
225 Ga0207667_10019998 3300025949 Bacteria 7458
226 Ga0207667_10054302 3300025949 Bacteria 4214
227 Ga0207651_10290325 3300025960 Bacteria 1356
228 Ga0207668_10050847 3300025972 Bacteria 2859
229 Ga0207640_10146626 3300025981 Unclassified 1728
230 Ga0207640_10430042 3300025981 Bacteria 1083
231 Ga0207658_10022012 3300025986 Bacteria 4433
232 Ga0207677_10155503 3300026023 Bacteria 1770
233 Ga0207703_10455656 3300026035 Bacteria 1195
234 Ga0207639_10000152 3300026041 Bacteria 52289
235 Ga0207639_10570745 3300026041 Bacteria 1040
236 Ga0207678_10272909 3300026067 Unclassified 1450
237 Ga0207702_10012645 3300026078 Bacteria 7027
238 Ga0207702_10022746 3300026078 Bacteria 5200
239 Ga0207702_10027333 3300026078 Bacteria 4737
240 Ga0207702_10108485 3300026078 Unclassified 2463
241 Ga0207702_10179336 3300026078 Unclassified 1949
242 Ga0207702_10973531 3300026078 Unclassified 841
243 Ga0207641_10008087 3300026088 Bacteria 8712
244 Ga0207641_10016400 3300026088 Bacteria 6066
245 Ga0207641_10503543 3300026088 Bacteria 1176
246 Ga0207676_10011396 3300026095 Bacteria 6354
247 Ga0207676_10712944 3300026095 Bacteria 973
248 Ga0207674_10001640 3300026116 Bacteria 28791
249 Ga0207674_10025893 3300026116 Bacteria 6244
250 Ga0207674_10220514 3300026116 Bacteria 1844
251 Ga0207674_10237361 3300026116 Unclassified 1770
252 Ga0207683_10001119 3300026121 Bacteria 24387
253 Ga0207698_10000018 3300026142 Bacteria 176540
254 Ga0207698_10000071 3300026142 Bacteria 67951
255 Ga0207698_10009644 3300026142 Bacteria 6165
256 Ga0207698_10335969 3300026142 Unclassified 1421
257 Ga0207698_11058131 3300026142 Unclassified 823
258 Ga0268266_10707971 3300028379 Unclassified 971
259 Ga0268264_10008040 3300028381 Bacteria 8770
260 Ga0265318_10016819 3300028577 Bacteria 3014
261 Ga0265323_10098605 3300028653 Bacteria 969
262 Ga0265336_10008597 3300028666 Bacteria 3571
263 Ga0265338_10003245 3300028800 Bacteria 23123
264 Ga0265338_10004924 3300028800 Bacteria 17749
265 Ga0265338_10015773 3300028800 Bacteria 8274
266 Ga0265338_10058612 3300028800 Bacteria 3398
267 Ga0265338_10134760 3300028800 Bacteria 1944
268 Ga0265338_10376932 3300028800 Unclassified 1015
269 Ga0265324_10024059 3300029957 Unclassified 2166
270 Ga0265330_10000180 3300031235 Bacteria 48901
271 Ga0265330_10000858 3300031235 Bacteria 18943
272 Ga0265330_10010220 3300031235 Bacteria 4431
273 Ga0265330_10019400 3300031235 Unclassified 3117
274 Ga0265332_10028001 3300031238 Bacteria 2467
275 Ga0265332_10076510 3300031238 Bacteria 1422
276 Ga0265332_10339566 3300031238 Unclassified 620
277 Ga0265328_10001211 3300031239 Bacteria 11947
278 Ga0265328_10004788 3300031239 Bacteria 5845
279 Ga0265320_10002594 3300031240 Bacteria 12548
280 Ga0265320_10109781 3300031240 Unclassified 1264
281 Ga0265325_10000086 3300031241 Bacteria 64912
282 Ga0265325_10006579 3300031241 Bacteria 7039
283 Ga0265325_10017875 3300031241 Bacteria 3938
284 Ga0265329_10015498 3300031242 Unclassified 2662
285 Ga0265340_10005859 3300031247 Bacteria 6799
286 Ga0265340_10018010 3300031247 Bacteria 3651
287 Ga0265340_10064102 3300031247 Bacteria 1752
288 Ga0265339_10000076 3300031249 Bacteria 85094
289 Ga0265339_10000705 3300031249 Bacteria 25899
290 Ga0265339_10002255 3300031249 Bacteria 13935
291 Ga0265339_10003865 3300031249 Bacteria 10398
292 Ga0265339_10006440 3300031249 Bacteria 7699
293 Ga0265339_10158689 3300031249 Unclassified 1139
294 Ga0265339_10174777 3300031249 Unclassified 1073
295 Ga0265331_10075737 3300031250 Bacteria 1569
296 Ga0265316_10004373 3300031344 Bacteria 14092
297 Ga0265316_10009940 3300031344 Bacteria 8713
298 Ga0265316_10013994 3300031344 Bacteria 7094
299 Ga0265316_10030115 3300031344 Bacteria 4454
300 Ga0265316_10051162 3300031344 Bacteria 3246
301 Ga0265316_10086362 3300031344 Bacteria 2398
302 Ga0265316_10097439 3300031344 Bacteria 2238
303 Ga0265316_10129614 3300031344 Unclassified 1901
304 Ga0265316_10141155 3300031344 Bacteria 1809
305 Ga0265316_10148724 3300031344 Bacteria 1755
306 Ga0265316_10235605 3300031344 Bacteria 1347
307 Ga0265316_10466779 3300031344 Bacteria 904
308 Ga0265316_10541584 3300031344 Bacteria 829
309 Ga0265313_10001987 3300031595 Bacteria 18447
310 Ga0265313_10011351 3300031595 Bacteria 5548
311 Ga0265313_10019351 3300031595 Bacteria 3792
312 Ga0265313_10020618 3300031595 Bacteria 3632
313 Ga0265313_10083451 3300031595 Bacteria 1447
314 Ga0316575_10067966 3300031665 Unclassified 1429
315 Ga0316579_10014693 3300031691 Bacteria 3392
316 Ga0316579_10150523 3300031691 Unclassified 1123
317 Ga0265314_10000047 3300031711 Bacteria 194061
318 Ga0265314_10003214 3300031711 Bacteria 15986
319 Ga0265314_10106057 3300031711 Bacteria 1796
320 Ga0265314_10112821 3300031711 Unclassified 1724
321 Ga0265314_10327789 3300031711 Unclassified 850
322 Ga0265342_10000208 3300031712 Bacteria 66250
323 Ga0265342_10001572 3300031712 Bacteria 21085
324 Ga0265342_10005228 3300031712 Bacteria 9958
325 Ga0265342_10016460 3300031712 Bacteria 4832
326 Ga0265342_10041736 3300031712 Bacteria 2775
327 Ga0265342_10074278 3300031712 Bacteria 1976
328 Ga0265342_10139638 3300031712 Bacteria 1352
329 Ga0265342_10282457 3300031712 Bacteria 878
330 Ga0265342_10355893 3300031712 Bacteria 762
331 Ga0316576_10197684 3300031727 Archaea 1515
332 Ga0316578_10739524 3300031728 Bacteria 572
333 Ga0316585_10087967 3300032137 Unclassified 1014
334 Ga0373954_0389891 3300035118 Unclassified 689
335 Ga0316574_0102972 3300035398 Unclassified 1828
336 Ga0373933_0499695 3300035724 Unclassified 797
337 Ga0316582_0003046 3300036647 Archaea 8089
338 Ga0316582_0007619 3300036647 Bacteria 5772
339 Ga0316582_0035537 3300036647 Bacteria 3078
340 Ga0316582_0040717 3300036647 Archaea 2901
341 Ga0316582_0314163 3300036647 Unclassified 1077
342 Ga0316582_0767839 3300036647 Bacteria 661
343 Ga0316584_0050040 3300036712 Unclassified 3124
344 Ga0316584_0481950 3300036712 Bacteria 874
345 Ga0316581_0081870 3300037588 Unclassified 993
346 Ga0316581_0101742 3300037588 Unclassified 885
347 Ga0316581_0117975 3300037588 Unclassified 817
348 Ga0400484_11789 3300038725 Unclassified 4745
349 Ga0400490_48275 3300038726 Bacteria 6298
350 Ga0436362_1166078 3300039453 Bacteria 1459
351 Ga0451577_0135016 3300042876 Bacteria 2215
352 Ga0451577_0351052 3300042876 Bacteria 1338
353 Ga0451577_0385663 3300042876 Bacteria 1272
354 Ga0451577_0754886 3300042876 Unclassified 880
355 Ga0453683_0037420 3300044673 Bacteria 3052
356 Ga0466963_0003119 3300044694 Bacteria 9394
357 Ga0466963_0996323 3300044694 Bacteria 590
358 Ga0453684_0001019 3300044712 Bacteria 90275
359 Ga0453684_0004357 3300044712 Bacteria 30033
360 Ga0453684_0005560 3300044712 Bacteria 24864
361 Ga0453684_0007021 3300044712 Bacteria 21039
362 Ga0453684_0009046 3300044712 Bacteria 17579
363 Ga0453684_0078580 3300044712 Bacteria 4128
364 Ga0453684_0095196 3300044712 Unclassified 3661
365 Ga0453684_0102259 3300044712 Bacteria 3504
366 Ga0453684_0124160 3300044712 Bacteria 3110
367 Ga0453684_0137754 3300044712 Bacteria 2919
368 Ga0453684_0217443 3300044712 Bacteria 2216
369 Ga0453684_1882181 3300044712 Unclassified 606
370 Ga0451576_0000438 3300045051 Bacteria 95259
371 Ga0451576_0020552 3300045051 Bacteria 7186
372 Ga0451576_0168390 3300045051 Unclassified 2286
373 Ga0466967_0003965 3300045976 Bacteria 9852
374 Ga0495629_0920383 3300046459 Unclassified 572
375 Ga0496101_0941664 3300048904 Bacteria 680
376 Ga0496104_0184810 3300048907 Bacteria 1995
377 Ga0496105_0099658 3300048908 Bacteria 2400
378 Ga0496112_1916825 3300048915 Unclassified 504
379 nmdc:mga05p37_726064_c1 3300050507 Unclassified 1099
380 Ga0501084_0879307 3300054114 Bacteria 754
381 Ga0451577_0298735
382 rootH1_10196822
383 rootH2_10114393
384 rootH2_10121829
385 Ga0065704_10168798
386 Ga0065707_10003159
387 Ga0070658_10031997
388 Ga0070658_10054883
389 Ga0070676_10095325
390 Ga0070683_100000282
391 Ga0070683_100022582
392 Ga0070683_100044853
393 Ga0070683_100045678
394 Ga0070690_100459670
395 Ga0070670_100107361
396 Ga0068869_100027439
397 Ga0068869_100172512
398 Ga0070680_100033639
399 Ga0070682_100148763
400 Ga0068868_100007406
401 Ga0068868_100036337
402 Ga0068868_100138378
403 Ga0070660_100001506
404 Ga0070660_100474714
405 Ga0070661_100004448
406 Ga0070661_100176220
407 Ga0070668_100440207
408 Ga0070671_100027022
409 Ga0070671_100292775
410 Ga0070667_100028657
411 Ga0070667_100077032
412 Ga0070714_100022918
413 Ga0070713_100210219
414 Ga0070713_100418610
415 Ga0070711_100504567
416 Ga0070663_100233934
417 Ga0070662_100851107
418 Ga0070681_10002976
419 Ga0070679_100003299
420 Ga0070684_100000597
421 Ga0070684_100143673
422 Ga0070684_100345072
423 Ga0070684_101201227
424 Ga0068853_100000333
425 Ga0068853_100264834
426 Ga0068853_100415947
427 Ga0068853_100747125
428 Ga0070672_100458454
429 Ga0070665_100213272
430 Ga0070665_100948967
431 Ga0068855_100001257
432 Ga0068855_100002295
433 Ga0068855_100007984
434 Ga0068855_100172036
435 Ga0070664_100129863
436 Ga0070664_100469853
437 Ga0068857_100002013
438 Ga0068857_100114185
439 Ga0068857_100466468
440 Ga0068854_100049807
441 Ga0068854_100147135
442 Ga0068854_100305883
443 Ga0068854_100330390
444 Ga0068856_100007750
445 Ga0068856_100012305
446 Ga0068856_100052410
447 Ga0068856_100065888
448 Ga0068856_100183899
449 Ga0068856_100458331
450 Ga0068856_100863807
451 Ga0068852_100000017
452 Ga0068852_100002239
453 Ga0068852_100012320
454 Ga0068852_100155459
455 Ga0068852_100563880
456 Ga0068852_101168222
457 Ga0068859_100062414
458 Ga0068864_100005523
459 Ga0068864_100813986
460 Ga0068866_10541387
461 Ga0068851_10020351
462 Ga0068851_10031666
463 Ga0068851_10130314
464 Ga0068863_100011732
465 Ga0068858_100025911
466 Ga0068860_100004141
467 Ga0068862_100069009
468 Ga0070717_10000563
469 Ga0070717_10024574
470 Ga0070717_10134389
471 Ga0070716_101148705
472 Ga0070712_100094709
473 Ga0070712_100704432
474 Ga0070712_101057342
475 Ga0097621_100112280
476 Ga0097621_100186692
477 Ga0068871_100095107
478 Ga0068871_100209261
479 Ga0068871_100486952
480 Ga0075428_100820899
481 Ga0075429_100302833
482 Ga0068865_100525131
483 Ga0097620_100062416
484 Ga0105240_10000110
485 Ga0105240_10002142
486 Ga0105240_10005844
487 Ga0105240_10007039
488 Ga0105240_10009925
489 Ga0105240_10017869
490 Ga0105240_10279499
491 Ga0105245_10006386
492 Ga0105245_10024024
493 Ga0105245_10102645
494 Ga0105247_10031679
495 Ga0114129_10227250
496 Ga0105243_10501053
497 Ga0105241_10000029
498 Ga0105241_10000550
499 Ga0105241_10004830
500 Ga0105241_10007421
501 Ga0105241_10018936
502 Ga0105241_10021242
503 Ga0105242_11415414
504 Ga0105248_10000795
505 Ga0105248_10055869
506 Ga0105248_10113796
507 Ga0105248_12361388
508 Ga0105237_10002262
509 Ga0105237_10021153
510 Ga0105237_10233863
511 Ga0105238_10000600
512 Ga0105238_10002104
513 Ga0105238_10003199
514 Ga0105238_10060328
515 Ga0105238_10153301
516 Ga0105249_10599852
517 Ga0105239_10003266
518 Ga0105239_10012317
519 Ga0105239_10037117
520 Ga0105239_10126434
521 Ga0105239_11217798
522 Ga0105246_10191515
523 Ga0157370_10000001
524 Ga0157369_10000017
525 Ga0157369_10001197
526 Ga0157369_10001363
527 Ga0157369_10062155
528 Ga0157369_10077205
529 Ga0157374_10068254
530 Ga0157374_10074347
531 Ga0157374_10082816
532 Ga0157378_10012030
533 Ga0157378_10014227
534 Ga0157378_10150076
535 Ga0163162_10293796
536 Ga0157372_10000019
537 Ga0157372_10000968
538 Ga0157372_10039234
539 Ga0157372_10064988
540 Ga0157372_10119767
541 Ga0157372_10135053
542 Ga0157372_11246773
543 Ga0157375_10004932
544 Ga0163163_10211748
545 Ga0157379_10010164
546 Ga0157376_10055945
547 Ga0157376_10930028
548 Ga0157376_12018598
549 Ga0207656_10008622
550 Ga0207656_10411924
551 Ga0207692_10107673
552 Ga0207692_10885919
553 Ga0207699_10910153
554 Ga0207705_10027459
555 Ga0207705_10071719
556 Ga0207705_10194286
557 Ga0207654_10000039
558 Ga0207654_10000268
559 Ga0207654_10215516
560 Ga0207707_10004167
561 Ga0207695_10000026
562 Ga0207695_10000161
563 Ga0207695_10000252
564 Ga0207695_10001682
565 Ga0207695_10010889
566 Ga0207695_10010972
567 Ga0207695_10360515
568 Ga0207671_10000082
569 Ga0207671_10000512
570 Ga0207671_10557444
571 Ga0207671_11324123
572 Ga0207693_10568364
573 Ga0207663_10027185
574 Ga0207663_11050439
575 Ga0207660_10062440
576 Ga0207657_10005001
577 Ga0207649_10129334
578 Ga0207649_10506229
579 Ga0207652_10013702
580 Ga0207694_10000246
581 Ga0207694_10000769
582 Ga0207694_10004633
583 Ga0207694_10018618
584 Ga0207694_10110798
585 Ga0207650_10095290
586 Ga0207687_10051395
587 Ga0207687_10111459
588 Ga0207700_10136881
589 Ga0207700_10256167
590 Ga0207664_10059711
591 Ga0207664_10179118
592 Ga0207664_10587853
593 Ga0207664_10664867
594 Ga0207644_10527314
595 Ga0207706_10053356
596 Ga0207704_10228740
597 Ga0207711_10004621
598 Ga0207711_10324905
599 Ga0207689_10028695
600 Ga0207661_10052942
601 Ga0207661_10110541
602 Ga0207661_10169717
603 Ga0207661_10891363
604 Ga0207667_10006012
605 Ga0207667_10019998
606 Ga0207667_10054302
607 Ga0207651_10290325
608 Ga0207668_10050847
609 Ga0207640_10146626
610 Ga0207640_10430042
611 Ga0207658_10022012
612 Ga0207677_10155503
613 Ga0207703_10455656
614 Ga0207639_10000152
615 Ga0207639_10570745
616 Ga0207678_10272909
617 Ga0207702_10012645
618 Ga0207702_10022746
619 Ga0207702_10027333
620 Ga0207702_10108485
621 Ga0207702_10179336
622 Ga0207702_10973531
623 Ga0207641_10008087
624 Ga0207641_10016400
625 Ga0207641_10503543
626 Ga0207676_10011396
627 Ga0207676_10712944
628 Ga0207674_10001640
629 Ga0207674_10025893
630 Ga0207674_10220514
631 Ga0207674_10237361
632 Ga0207683_10001119
633 Ga0207698_10000018
634 Ga0207698_10000071
635 Ga0207698_10009644
636 Ga0207698_10335969
637 Ga0207698_11058131
638 Ga0268266_10707971
639 Ga0268264_10008040
640 Ga0265318_10016819
641 Ga0265323_10098605
642 Ga0265336_10008597
643 Ga0265338_10003245
644 Ga0265338_10004924
645 Ga0265338_10015773
646 Ga0265338_10058612
647 Ga0265338_10134760
648 Ga0265338_10376932
649 Ga0265324_10024059
650 Ga0265330_10000180
651 Ga0265330_10000858
652 Ga0265330_10010220
653 Ga0265330_10019400
654 Ga0265332_10028001
655 Ga0265332_10076510
656 Ga0265332_10339566
657 Ga0265328_10001211
658 Ga0265328_10004788
659 Ga0265320_10002594
660 Ga0265320_10109781
661 Ga0265325_10000086
662 Ga0265325_10006579
663 Ga0265325_10017875
664 Ga0265329_10015498
665 Ga0265340_10005859
666 Ga0265340_10018010
667 Ga0265340_10064102
668 Ga0265339_10000076
669 Ga0265339_10000705
670 Ga0265339_10002255
671 Ga0265339_10003865
672 Ga0265339_10006440
673 Ga0265339_10158689
674 Ga0265339_10174777
675 Ga0265331_10075737
676 Ga0265316_10004373
677 Ga0265316_10009940
678 Ga0265316_10013994
679 Ga0265316_10030115
680 Ga0265316_10051162
681 Ga0265316_10086362
682 Ga0265316_10097439
683 Ga0265316_10129614
684 Ga0265316_10141155
685 Ga0265316_10148724
686 Ga0265316_10235605
687 Ga0265316_10466779
688 Ga0265316_10541584
689 Ga0265313_10001987
690 Ga0265313_10011351
691 Ga0265313_10019351
692 Ga0265313_10020618
693 Ga0265313_10083451
694 Ga0316575_10067966
695 Ga0316579_10014693
696 Ga0316579_10150523
697 Ga0265314_10000047
698 Ga0265314_10003214
699 Ga0265314_10106057
700 Ga0265314_10112821
701 Ga0265314_10327789
702 Ga0265342_10000208
703 Ga0265342_10001572
704 Ga0265342_10005228
705 Ga0265342_10016460
706 Ga0265342_10041736
707 Ga0265342_10074278
708 Ga0265342_10139638
709 Ga0265342_10282457
710 Ga0265342_10355893
711 Ga0316576_10197684
712 Ga0316578_10739524
713 Ga0316585_10087967
714 Ga0373954_0389891
715 Ga0316574_0102972
716 Ga0373933_0499695
717 Ga0316582_0003046
718 Ga0316582_0007619
719 Ga0316582_0035537
720 Ga0316582_0040717
721 Ga0316582_0314163
722 Ga0316582_0767839
723 Ga0316584_0050040
724 Ga0316584_0481950
725 Ga0316581_0081870
726 Ga0316581_0101742
727 Ga0316581_0117975
728 Ga0400484_11789
729 Ga0400490_48275
730 Ga0436362_1166078
731 Ga0451577_0135016
732 Ga0451577_0351052
733 Ga0451577_0385663
734 Ga0451577_0754886
735 Ga0453683_0037420
736 Ga0466963_0003119
737 Ga0466963_0996323
738 Ga0453684_0001019
739 Ga0453684_0004357
740 Ga0453684_0005560
741 Ga0453684_0007021
742 Ga0453684_0009046
743 Ga0453684_0078580
744 Ga0453684_0095196
745 Ga0453684_0102259
746 Ga0453684_0124160
747 Ga0453684_0137754
748 Ga0453684_0217443
749 Ga0453684_1882181
750 Ga0451576_0000438
751 Ga0451576_0020552
752 Ga0451576_0168390
753 Ga0466967_0003965
754 Ga0495629_0920383
755 Ga0496101_0941664
756 Ga0496104_0184810
757 Ga0496105_0099658
758 Ga0496112_1916825
759 nmdc:mga05p37_726064_c1
760 Ga0501084_0879307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01058

Oxidored_q6

NADH ubiquinone oxidoreductase, 20 Kd subunit

33

144

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6cfw-assembly1.cif.gz_J cryoem structure of a respiratory membrane-bound hydrogenase 0.7966 12 147
4hea-assembly2.cif.gz_G crystal structure of the entire respiratory complex i from thermus thermophilus 0.7888 11 139
7ard-assembly1.cif.gz_B cryo-em structure of polytomella complex-i (complete composition) 0.7658 11 154
8b9z-assembly1.cif.gz_B drosophila melanogaster complex i in the active state (dm1) 0.7617 11 145
2fug-assembly2.cif.gz_F crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus 0.7568 4 139
ID Description Score Start End Superfamily
af_I6XUD2_20_159_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.838 19 143 3.40.50.12280
6cfwJ00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7966 12 147 3.40.50.12280
af_Q57936_1_148_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7916 11 154 3.40.50.12280
af_P77668_14_171_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7701 10 161 3.40.50.12280
af_Q57936_1_148_3.40.50.12280 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; 0.7668 11 154 3.40.50.12280
ID Description Score Start End GO Terms
AF-A0A151F814-F1-model_v4 NADH:ubiquinone oxidoreductase-like 20kDa subunit domain-containing protein 0.867 7 145 GO:0051539
AF-A0A1I5QKT0-F1-model_v4 Ech hydrogenase subunit C 0.86 19 154 GO:0051539
AF-U2CPV4-F1-model_v4 deleted 0.8596 18 154
AF-A0A845RQS9-F1-model_v4 NADH-quinone oxidoreductase subunit B family protein 0.8583 18 154 GO:0051539
AF-A0A1H9EE79-F1-model_v4 Ni,Fe-hydrogenase III small subunit 0.8582 18 155 GO:0051539

Map