F428737

General Info

Members Datasets Scaffolds Average Seq Length
380 245 760 205

Family's Representative Sequence

Representative Sequence 3300039450|Ga0436363_1457784|Ga0436363_1457784_136_825
Length 229
Sequence LNLDATRPHNGANVGNDGSQMNADSPLFDRIRVKPDKDRRPRTDLPACEWPSCKAVATHRAPKGRQHESEHWRFCLDHVRQYNHSYNFFAGMSEDAIAKYHKDAVTGHRPTWKMGMNGGRPTMRSHSARFHPDLADDPFEMFRDHGGRAGRAADEHLRRRETRVIRNAERKALEVLGLEADANTNDIKVRFKVLVKRHHPDANGGDRSSEERLRAIIEAYNYLKSVGFR

Samples

Sample ID Description Type Environment
1 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
2 3300000042 Arabidopsis rhizosphere soil microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil young Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
8 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
9 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
10 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
11 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
14 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
17 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
18 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
19 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
22 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
23 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
26 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
27 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
28 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
29 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
32 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
33 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
34 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
35 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
36 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
37 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
38 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
39 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
40 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
41 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
42 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
43 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
44 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
45 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
46 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
47 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
48 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
49 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
50 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
51 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
52 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
53 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
57 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
58 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
59 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
60 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
61 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
62 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
63 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
64 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
65 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
66 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
67 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
68 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
69 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
70 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
71 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
72 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
94 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
95 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
96 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
97 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
98 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
99 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
100 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
101 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
102 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
103 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
104 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
105 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
106 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
107 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
108 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
109 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
110 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
111 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
112 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
113 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
114 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
115 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
116 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
117 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
118 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
119 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
120 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
121 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
122 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
123 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
124 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
125 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
126 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
127 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
128 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
129 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
130 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
131 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
132 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
133 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
134 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
135 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
136 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
137 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
138 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
139 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
140 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
141 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
142 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
143 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
144 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
145 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
146 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
147 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
148 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
149 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
150 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
151 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
152 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
153 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
154 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
155 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
156 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
157 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
158 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
159 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
160 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
161 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
162 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
163 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
164 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
165 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
166 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
167 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
170 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
171 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
172 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
173 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
174 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
175 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
176 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
177 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
178 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
179 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
180 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
181 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
182 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
183 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
184 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
185 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
186 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
187 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
188 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
189 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
190 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
191 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
193 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
194 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
196 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
197 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
198 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
199 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
200 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
201 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
202 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
205 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
209 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
210 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
211 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
212 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
213 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
214 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
217 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
218 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
219 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
220 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
221 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
222 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
223 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
224 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
225 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
226 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
227 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
228 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
229 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
230 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
231 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
232 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
233 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
234 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
235 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
236 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
237 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
238 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
239 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
240 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
241 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
242 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
243 2545555834 Methylobacterium sp. WSM2598 Isolate Nodule
244 2884298095 Microvirga thermotolerans HR1 Isolate Rhizosphere
245 641522639 Methylobacterium sp. 4-46 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.95
Nodule 0.53
Rhizoplane 8.42
Rhizosphere 81.05
Stem 0
Stem Tuber 0
Unclassified 3.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436363_1457784 3300039450 Bacteria 1398
2 ARSoilYngRDRAFT_c00272 3300000042 Bacteria 7838
3 JGI24743J22301_10000893 3300001991 Bacteria 3817
4 JGI25404J52841_10005306 3300003659 Bacteria 2659
5 JGI25405J52794_10014413 3300003911 Bacteria 1544
6 JGI25405J52794_10024206 3300003911 Bacteria 1239
7 Ga0065707_10123282 3300005295 Bacteria 2064
8 Ga0070670_100014155 3300005331 Bacteria 6843
9 Ga0070682_100421738 3300005337 Bacteria 1014
10 Ga0068868_100167014 3300005338 Bacteria 1820
11 Ga0068868_100263883 3300005338 Bacteria 1453
12 Ga0070669_100617153 3300005353 Unclassified 910
13 Ga0070675_100436862 3300005354 Bacteria 1172
14 Ga0070673_100075633 3300005364 Bacteria 2717
15 Ga0070667_100202001 3300005367 Bacteria 1764
16 Ga0070709_10061719 3300005434 Bacteria 2387
17 Ga0070711_100469305 3300005439 Bacteria 1033
18 Ga0070705_100225074 3300005440 Bacteria 1301
19 Ga0070681_10057434 3300005458 Bacteria 3872
20 Ga0068867_100734721 3300005459 Bacteria 874
21 Ga0070698_100161246 3300005471 Bacteria 2186
22 Ga0070696_100379188 3300005546 Bacteria 1102
23 Ga0070696_100486847 3300005546 Bacteria 979
24 Ga0070665_100742048 3300005548 Bacteria 995
25 Ga0070704_100893158 3300005549 Bacteria 799
26 Ga0070664_100143002 3300005564 Bacteria 2108
27 Ga0068859_101315231 3300005617 Unclassified 797
28 Ga0068861_100287372 3300005719 Bacteria 1419
29 Ga0068858_100151904 3300005842 Bacteria 2178
30 Ga0068858_100322872 3300005842 Bacteria 1476
31 Ga0068860_100134013 3300005843 Bacteria 2379
32 Ga0068860_100247601 3300005843 Bacteria 1735
33 Ga0068860_100453070 3300005843 Bacteria 1276
34 Ga0081455_10014048 3300005937 Bacteria 7870
35 Ga0081455_10024554 3300005937 Bacteria 5579
36 Ga0081538_10020257 3300005981 Bacteria 4906
37 Ga0081538_10026855 3300005981 Bacteria 4012
38 Ga0081540_1000005 3300005983 Bacteria 227052
39 Ga0081540_1113802 3300005983 Bacteria 1138
40 Ga0081539_10053423 3300005985 Bacteria 2262
41 Ga0070717_10634503 3300006028 Bacteria 970
42 Ga0075365_10006725 3300006038 Bacteria 6360
43 Ga0075365_10047292 3300006038 Bacteria 2827
44 Ga0075365_10380189 3300006038 Unclassified 996
45 Ga0075365_10425535 3300006038 Bacteria 937
46 Ga0075363_100086399 3300006048 Bacteria 1722
47 Ga0075363_100318353 3300006048 Bacteria 905
48 Ga0075364_10005967 3300006051 Bacteria 7118
49 Ga0070716_100653331 3300006173 Bacteria 798
50 Ga0070712_100058592 3300006175 Bacteria 2710
51 Ga0075362_10006226 3300006177 Bacteria 4435
52 Ga0075362_10145743 3300006177 Bacteria 1134
53 Ga0075367_10016186 3300006178 Bacteria 4070
54 Ga0075366_10004841 3300006195 Bacteria 7263
55 Ga0075366_10007298 3300006195 Bacteria 6097
56 Ga0097621_100195352 3300006237 Bacteria 1754
57 Ga0075370_10142590 3300006353 Bacteria 1401
58 Ga0075428_100105571 3300006844 Bacteria 3072
59 Ga0075428_100262964 3300006844 Bacteria 1857
60 Ga0075428_100402870 3300006844 Bacteria 1466
61 Ga0075428_100990178 3300006844 Bacteria 890
62 Ga0075430_100252069 3300006846 Bacteria 1462
63 Ga0075430_100297527 3300006846 Bacteria 1335
64 Ga0075431_100173403 3300006847 Bacteria 2216
65 Ga0075431_100397274 3300006847 Bacteria 1380
66 Ga0075431_100647306 3300006847 Bacteria 1037
67 Ga0075431_100659741 3300006847 Bacteria 1026
68 Ga0075433_10063061 3300006852 Bacteria 3247
69 Ga0075433_10722737 3300006852 Bacteria 872
70 Ga0075434_100006003 3300006871 Bacteria 11114
71 Ga0075434_100062417 3300006871 Bacteria 3709
72 Ga0075429_100073550 3300006880 Bacteria 2977
73 Ga0097620_101315311 3300006931 Unclassified 797
74 Ga0075435_100710800 3300007076 Bacteria 874
75 Ga0099794_10060046 3300007265 Bacteria 1846
76 Ga0099795_10002410 3300007788 Bacteria 4395
77 Ga0099795_10078938 3300007788 Bacteria 1256
78 Ga0111539_10018731 3300009094 Bacteria 8570
79 Ga0111539_10057994 3300009094 Bacteria 4595
80 Ga0111539_10084561 3300009094 Bacteria 3730
81 Ga0105245_10006183 3300009098 Bacteria 10537
82 Ga0105245_10220715 3300009098 Bacteria 1829
83 Ga0105247_10679616 3300009101 Unclassified 772
84 Ga0114129_10001060 3300009147 Bacteria 36097
85 Ga0114129_10005063 3300009147 Bacteria 18550
86 Ga0114129_10538319 3300009147 Bacteria 1520
87 Ga0114129_10564619 3300009147 Bacteria 1478
88 Ga0105243_10170480 3300009148 Bacteria 1884
89 Ga0105243_10327581 3300009148 Bacteria 1398
90 Ga0105243_10623040 3300009148 Bacteria 1042
91 Ga0105242_10121129 3300009176 Bacteria 2245
92 Ga0105237_10031824 3300009545 Bacteria 5343
93 Ga0105249_10548347 3300009553 Bacteria 1206
94 Ga0105249_10732311 3300009553 Bacteria 1050
95 Ga0099796_10004995 3300010159 Bacteria 3270
96 Ga0105246_10006694 3300011119 Bacteria 7046
97 Ga0105246_10107868 3300011119 Bacteria 2040
98 Ga0157374_10377713 3300013296 Bacteria 1411
99 Ga0157378_10192686 3300013297 Bacteria 1924
100 Ga0163162_10139544 3300013306 Bacteria 2536
101 Ga0163162_10286732 3300013306 Bacteria 1778
102 Ga0163162_10980693 3300013306 Unclassified 955
103 Ga0157375_10486564 3300013308 Bacteria 1399
104 Ga0163163_10075379 3300014325 Bacteria 3367
105 Ga0163163_10696544 3300014325 Bacteria 1079
106 Ga0157380_10229086 3300014326 Bacteria 1668
107 Ga0157380_10592307 3300014326 Bacteria 1095
108 Ga0182008_10007216 3300014497 Bacteria 6146
109 Ga0157376_10415959 3300014969 Bacteria 1303
110 Ga0207426_1043410 3300025302 Bacteria 1381
111 Ga0207707_10077027 3300025912 Bacteria 2910
112 Ga0207693_10122491 3300025915 Bacteria 2042
113 Ga0207660_10154606 3300025917 Bacteria 1765
114 Ga0207660_10390127 3300025917 Bacteria 1120
115 Ga0207652_10639574 3300025921 Bacteria 952
116 Ga0207650_10008669 3300025925 Bacteria 6947
117 Ga0207687_10005544 3300025927 Bacteria 8344
118 Ga0207665_10223968 3300025939 Bacteria 1379
119 Ga0207711_10390861 3300025941 Bacteria 1291
120 Ga0207679_10120191 3300025945 Bacteria 2090
121 Ga0207651_10346676 3300025960 Bacteria 1249
122 Ga0207651_10721080 3300025960 Bacteria 880
123 Ga0207668_10053924 3300025972 Bacteria 2789
124 Ga0207668_10481359 3300025972 Bacteria 1065
125 Ga0207658_10302527 3300025986 Bacteria 1378
126 Ga0207677_10156093 3300026023 Bacteria 1767
127 Ga0207703_10129111 3300026035 Bacteria 2180
128 Ga0207703_10348091 3300026035 Bacteria 1364
129 Ga0207678_10282731 3300026067 Bacteria 1424
130 Ga0207678_10689640 3300026067 Bacteria 898
131 Ga0207702_10460075 3300026078 Bacteria 1236
132 Ga0207641_10730867 3300026088 Bacteria 976
133 Ga0207675_100628675 3300026118 Bacteria 1078
134 Ga0209179_1014030 3300027512 Bacteria 1465
135 Ga0209179_1054245 3300027512 Bacteria 863
136 Ga0268266_10119401 3300028379 Bacteria 2345
137 Ga0268264_10129024 3300028381 Bacteria 2239
138 Ga0268264_10424193 3300028381 Bacteria 1283
139 Ga0265332_10199926 3300031238 Bacteria 831
140 Ga0265325_10001782 3300031241 Bacteria 14906
141 Ga0265325_10002799 3300031241 Bacteria 11641
142 Ga0265329_10044721 3300031242 Bacteria 1416
143 Ga0265339_10003962 3300031249 Bacteria 10235
144 Ga0265316_10059022 3300031344 Bacteria 2986
145 Ga0265313_10001018 3300031595 Bacteria 27299
146 Ga0316579_10000778 3300031691 Bacteria 10920
147 Ga0316579_10139531 3300031691 Bacteria 1168
148 Ga0265314_10410331 3300031711 Bacteria 730
149 Ga0265342_10322889 3300031712 Bacteria 809
150 Ga0316578_10026225 3300031728 Bacteria 3285
151 Ga0307405_10362804 3300031731 Bacteria 1122
152 Ga0307416_100463676 3300032002 Bacteria 1323
153 Ga0316583_10035924 3300032133 Bacteria 1759
154 Ga0373926_0089262 3300035083 Bacteria 1145
155 Ga0373926_0099947 3300035083 Bacteria 1084
156 Ga0373940_0066649 3300035088 Bacteria 1040
157 Ga0373944_0006390 3300035089 Bacteria 3129
158 Ga0373923_0045515 3300035111 Bacteria 1823
159 Ga0373932_0072518 3300035112 Bacteria 1071
160 Ga0373936_0039916 3300035113 Bacteria 1879
161 Ga0373941_0043393 3300035115 Bacteria 1400
162 Ga0373945_0035803 3300035116 Bacteria 1776
163 Ga0373956_0018531 3300035119 Bacteria 2949
164 Ga0373943_0086707 3300035170 Bacteria 1615
165 Ga0373946_0027053 3300035171 Bacteria 2266
166 Ga0316574_0000127 3300035398 Bacteria 23760
167 Ga0373931_0008506 3300035691 Bacteria 4871
168 Ga0373931_0071873 3300035691 Bacteria 1891
169 Ga0373935_0427057 3300035692 Bacteria 955
170 Ga0373935_0442229 3300035692 Bacteria 938
171 Ga0373927_0006729 3300035695 Bacteria 7825
172 Ga0373927_0021542 3300035695 Unclassified 4224
173 Ga0373927_0120358 3300035695 Bacteria 1713
174 Ga0373927_0166371 3300035695 Bacteria 1445
175 Ga0373927_0223295 3300035695 Bacteria 1237
176 Ga0373933_0078403 3300035724 Bacteria 2021
177 Ga0373947_0009160 3300035725 Bacteria 5691
178 Ga0373947_0027865 3300035725 Bacteria 3309
179 Ga0373947_0057211 3300035725 Bacteria 2359
180 Ga0373947_0062060 3300035725 Bacteria 2273
181 Ga0373947_0097995 3300035725 Unclassified 1838
182 Ga0373947_0112107 3300035725 Bacteria 1725
183 Ga0316584_0023242 3300036712 Bacteria 4529
184 Ga0373925_0015249 3300037068 Bacteria 5556
185 Ga0373925_0065732 3300037068 Bacteria 2732
186 Ga0373925_0114723 3300037068 Bacteria 2085
187 Ga0373925_0179208 3300037068 Bacteria 1676
188 Ga0395898_0063040 3300037466 Bacteria 3598
189 Ga0395905_0195262 3300037471 Bacteria 1898
190 Ga0436365_0751689 3300039437 Bacteria 2327
191 Ga0436363_0620130 3300039450 Bacteria 2344
192 Ga0466972_0081102 3300044658 Bacteria 1545
193 Ga0495627_038990 3300046453 Bacteria 1467
194 Ga0495603_0017194 3300046455 Bacteria 4377
195 Ga0495603_0077013 3300046455 Bacteria 1957
196 Ga0495603_0404989 3300046455 Bacteria 782
197 Ga0495591_040064 3300046458 Bacteria 1338
198 Ga0495638_0066577 3300046460 Bacteria 2214
199 Ga0495641_0088943 3300046461 Bacteria 1380
200 Ga0495580_0253863 3300046472 Bacteria 1203
201 Ga0495582_0046126 3300046473 Bacteria 2400
202 Ga0495582_0253657 3300046473 Bacteria 1009
203 Ga0495584_0016246 3300046491 Bacteria 3796
204 Ga0495585_0022062 3300046492 Bacteria 3655
205 Ga0495594_0058992 3300046499 Bacteria 2121
206 Ga0495594_0531710 3300046499 Bacteria 667
207 Ga0495607_0023087 3300046501 Bacteria 3897
208 Ga0495616_0017163 3300046513 Bacteria 3994
209 Ga0495616_0253896 3300046513 Bacteria 754
210 Ga0495620_0054287 3300046515 Bacteria 1693
211 Ga0495630_0113276 3300046517 Bacteria 2055
212 Ga0495630_0379917 3300046517 Bacteria 1082
213 Ga0495631_0071808 3300046518 Bacteria 1495
214 Ga0495637_0040889 3300046520 Bacteria 1993
215 Ga0495644_0007605 3300046523 Bacteria 4177
216 Ga0495665_0043881 3300046531 Bacteria 2377
217 Ga0495640_0038648 3300046533 Bacteria 3356
218 Ga0495640_0634742 3300046533 Bacteria 643
219 Ga0495598_0002481 3300046537 Bacteria 3816
220 Ga0495609_0071708 3300046538 Bacteria 1522
221 Ga0495621_0029518 3300046539 Bacteria 1870
222 Ga0495645_0694683 3300046543 Bacteria 618
223 Ga0495622_0039499 3300046557 Bacteria 2198
224 Ga0495656_0000214 3300046615 Bacteria 20658
225 Ga0495656_0005167 3300046615 Bacteria 4501
226 Ga0495668_0102932 3300046616 Bacteria 1562
227 Ga0495611_0149788 3300046648 Bacteria 1089
228 Ga0495611_0151377 3300046648 Bacteria 1083
229 Ga0495659_0087083 3300046664 Bacteria 1194
230 Ga0495659_0136790 3300046664 Bacteria 975
231 Ga0495661_0082946 3300046665 Bacteria 1844
232 Ga0495588_0039887 3300046674 Bacteria 2393
233 Ga0495647_0034939 3300046681 Bacteria 1885
234 Ga0495658_0058826 3300046683 Bacteria 2199
235 Ga0495613_0056853 3300046689 Bacteria 2873
236 Ga0495613_0291473 3300046689 Bacteria 1131
237 Ga0495613_0601202 3300046689 Bacteria 732
238 Ga0495624_0054845 3300046690 Bacteria 2512
239 Ga0495624_0359422 3300046690 Bacteria 876
240 Ga0495670_0092704 3300046691 Bacteria 1547
241 Ga0495671_0052474 3300046692 Bacteria 2027
242 Ga0495671_0064381 3300046692 Bacteria 1805
243 Ga0495589_0058443 3300046794 Bacteria 1896
244 Ga0495660_0082235 3300046810 Bacteria 1687
245 Ga0495581_0099647 3300047315 Unclassified 1688
246 Ga0495674_0170559 3300047319 Bacteria 1816
247 Ga0495674_0604883 3300047319 Bacteria 868
248 Ga0495680_0144051 3300047322 Bacteria 1742
249 Ga0495677_0045731 3300047445 Bacteria 1606
250 Ga0495684_0175300 3300047471 Bacteria 1592
251 Ga0495593_0073003 3300047673 Bacteria 1780
252 Ga0495614_0258397 3300048089 Bacteria 798
253 Ga0496100_0120536 3300048903 Bacteria 1834
254 Ga0496101_0020879 3300048904 Bacteria 4492
255 Ga0496101_0280164 3300048904 Bacteria 1303
256 Ga0496101_0467590 3300048904 Bacteria 995
257 Ga0496101_0709656 3300048904 Bacteria 794
258 Ga0496102_0029696 3300048905 Bacteria 4892
259 Ga0496103_0155310 3300048906 Bacteria 1466
260 Ga0496104_0001225 3300048907 Bacteria 22061
261 Ga0496104_0008498 3300048907 Bacteria 9132
262 Ga0496104_0033395 3300048907 Bacteria 4793
263 Ga0496104_0075639 3300048907 Bacteria 3206
264 Ga0496105_0000637 3300048908 Bacteria 23492
265 Ga0496105_0031116 3300048908 Bacteria 4375
266 Ga0496105_0125988 3300048908 Bacteria 2111
267 Ga0496105_0330970 3300048908 Bacteria 1219
268 Ga0496106_0031006 3300048909 Bacteria 3985
269 Ga0496106_0131639 3300048909 Bacteria 1962
270 Ga0496107_0660626 3300048910 Bacteria 770
271 Ga0496108_0000745 3300048911 Bacteria 25333
272 Ga0496108_0030814 3300048911 Bacteria 4445
273 Ga0496109_0010192 3300048912 Bacteria 8023
274 Ga0496109_0303378 3300048912 Bacteria 1506
275 Ga0496110_0011576 3300048913 Bacteria 7230
276 Ga0496111_0000254 3300048914 Bacteria 25829
277 Ga0496112_0033634 3300048915 Bacteria 4984
278 Ga0496113_0000209 3300048916 Bacteria 27329
279 Ga0496114_0756340 3300048917 Bacteria 849
280 Ga0496115_0011333 3300048918 Bacteria 6683
281 Ga0496115_0019222 3300048918 Bacteria 5256
282 Ga0496115_0028798 3300048918 Bacteria 4356
283 Ga0496115_0284119 3300048918 Bacteria 1358
284 Ga0496115_0517167 3300048918 Bacteria 957
285 Ga0496121_0226947 3300048924 Bacteria 1311
286 Ga0501031_0003183 3300049568 Bacteria 10533
287 Ga0501031_0037305 3300049568 Bacteria 3171
288 Ga0501032_0057915 3300049569 Bacteria 2602
289 Ga0501033_0035610 3300049570 Bacteria 3731
290 Ga0501033_0046318 3300049570 Bacteria 3233
291 Ga0501033_0109574 3300049570 Bacteria 2010
292 Ga0501034_0026456 3300049571 Bacteria 5908
293 Ga0501034_0104582 3300049571 Bacteria 2824
294 Ga0501036_0005785 3300049572 Bacteria 10021
295 Ga0501036_0240455 3300049572 Bacteria 1518
296 Ga0501036_0274694 3300049572 Bacteria 1411
297 Ga0501037_0002948 3300049573 Bacteria 12337
298 Ga0501037_0090826 3300049573 Bacteria 2208
299 Ga0501038_0000843 3300049574 Bacteria 27250
300 Ga0501038_0008980 3300049574 Bacteria 9171
301 Ga0501040_0258890 3300049576 Bacteria 1242
302 Ga0501041_0054420 3300049577 Bacteria 2441
303 Ga0501043_0034861 3300049579 Bacteria 3958
304 Ga0501043_0050165 3300049579 Bacteria 3280
305 Ga0501046_0003200 3300049580 Bacteria 15070
306 Ga0501047_0228169 3300049581 Bacteria 1716
307 Ga0501048_0003240 3300049582 Bacteria 12399
308 Ga0501067_0409324 3300049583 Bacteria 757
309 Ga0501068_0001776 3300049584 Bacteria 11468
310 Ga0501070_0025130 3300049586 Bacteria 4994
311 Ga0501070_0536399 3300049586 Bacteria 938
312 Ga0501073_0047892 3300049589 Bacteria 3002
313 Ga0501073_0051719 3300049589 Bacteria 2877
314 Ga0501074_0044575 3300049590 Bacteria 3210
315 Ga0501074_0123748 3300049590 Bacteria 1849
316 Ga0501076_0258936 3300049592 Bacteria 1424
317 Ga0501077_0013501 3300049593 Bacteria 5123
318 Ga0501077_0207155 3300049593 Bacteria 1246
319 Ga0501079_0204813 3300049741 Bacteria 1541
320 Ga0501080_0030590 3300049742 Bacteria 5017
321 Ga0501080_0062751 3300049742 Bacteria 3458
322 Ga0501083_0113294 3300049744 Bacteria 1782
323 Ga0501083_0190046 3300049744 Bacteria 1340
324 Ga0501035_0043688 3300049822 Bacteria 4037
325 Ga0501035_0043938 3300049822 Bacteria 4025
326 Ga0501044_0094091 3300049823 Bacteria 3021
327 Ga0501044_0100504 3300049823 Bacteria 2910
328 Ga0501045_0238210 3300049824 Bacteria 1355
329 nmdc:mga03683_185712_c1 3300050489 Bacteria 950
330 nmdc:mga03683_271478_c1 3300050489 Bacteria 791
331 nmdc:mga03n38_160553_c1 3300050490 Bacteria 1138
332 nmdc:mga03n38_97495_c1 3300050490 Bacteria 1412
333 nmdc:mga00v17_160405_c1 3300050491 Bacteria 1447
334 nmdc:mga00v17_36256_c1 3300050491 Bacteria 2939
335 nmdc:mga0yw44_1519_c1 3300050492 Bacteria 9268
336 nmdc:mga0yw44_169419_c1 3300050492 Bacteria 1433
337 nmdc:mga0yw44_243405_c1 3300050492 Unclassified 1196
338 nmdc:mga0yw44_50926_c1 3300050492 Bacteria 2506
339 nmdc:mga0k408_139639_c1 3300050493 Bacteria 1441
340 nmdc:mga0k408_18386_c1 3300050493 Bacteria 3902
341 nmdc:mga0k408_26808_c1 3300050493 Bacteria 3268
342 nmdc:mga0k408_542115_c1 3300050493 Bacteria 688
343 nmdc:mga06z11_324195_c1 3300050494 Bacteria 919
344 nmdc:mga06z11_41726_c1 3300050494 Bacteria 2297
345 nmdc:mga04h51_102079_c1 3300050495 Bacteria 1046
346 nmdc:mga05p37_14993_c1 3300050507 Bacteria 9304
347 nmdc:mga05p37_2001_c1 3300050507 Bacteria 23793
348 nmdc:mga05p37_699635_c1 3300050507 Unclassified 1126
349 nmdc:mga09592_124198_c1 3300050508 Bacteria 2218
350 nmdc:mga0qj67_311131_c1 3300050509 Bacteria 1275
351 nmdc:mga06r32_205176_c1 3300050510 Bacteria 1959
352 nmdc:mga06r32_409437_c1 3300050510 Bacteria 1338
353 nmdc:mga06r32_679617_c1 3300050510 Bacteria 996
354 nmdc:mga06r32_73548_c1 3300050510 Bacteria 3311
355 nmdc:mga08y16_129961_c1 3300050511 Bacteria 2620
356 nmdc:mga08y16_358828_c1 3300050511 Bacteria 1496
357 nmdc:mga08y16_48979_c1 3300050511 Bacteria 4421
358 nmdc:mga08y16_79782_c1 3300050511 Bacteria 3411
359 nmdc:mga0n895_100339_c1 3300050512 Bacteria 2903
360 nmdc:mga0rr50_1416273_c1 3300050513 Unclassified 588
361 nmdc:mga0rr50_608300_c1 3300050513 Bacteria 932
362 nmdc:mga08x19_346597_c1 3300050514 Bacteria 1036
363 nmdc:mga0a205_326740_c1 3300050515 Bacteria 1404
364 nmdc:mga0a205_657755_c1 3300050515 Bacteria 899
365 Ga0495601_0239260 3300053077 Bacteria 1185
366 Ga0495612_0193611 3300053078 Bacteria 895
367 Ga0495655_0005990 3300053083 Bacteria 2182
368 Ga0495655_0010076 3300053083 Bacteria 1854
369 Ga0495595_0038527 3300053084 Bacteria 2178
370 Ga0495619_0022154 3300053085 Bacteria 4062
371 Ga0500641_0234376 3300053096 Bacteria 774
372 Ga0500568_0075877 3300053139 Bacteria 1281
373 Ga0500616_0228164 3300053153 Bacteria 808
374 Ga0501082_0084815 3300060353 Bacteria 2732
375 Ga0501082_0330622 3300060353 Bacteria 1328
376 Ga0530510_0066575 3300061734 Bacteria 2612
377 Ga0530510_0085704 3300061734 Bacteria 2295
378 2545678855 2545555834 Bacteria 8130841
379 2884298634 2884298095 Bacteria 3823049
380 641646584 641522639 Bacteria 7737025
381 Ga0436363_1457784
382 ARSoilYngRDRAFT_c00272
383 JGI24743J22301_10000893
384 JGI25404J52841_10005306
385 JGI25405J52794_10014413
386 JGI25405J52794_10024206
387 Ga0065707_10123282
388 Ga0070670_100014155
389 Ga0070682_100421738
390 Ga0068868_100167014
391 Ga0068868_100263883
392 Ga0070669_100617153
393 Ga0070675_100436862
394 Ga0070673_100075633
395 Ga0070667_100202001
396 Ga0070709_10061719
397 Ga0070711_100469305
398 Ga0070705_100225074
399 Ga0070681_10057434
400 Ga0068867_100734721
401 Ga0070698_100161246
402 Ga0070696_100379188
403 Ga0070696_100486847
404 Ga0070665_100742048
405 Ga0070704_100893158
406 Ga0070664_100143002
407 Ga0068859_101315231
408 Ga0068861_100287372
409 Ga0068858_100151904
410 Ga0068858_100322872
411 Ga0068860_100134013
412 Ga0068860_100247601
413 Ga0068860_100453070
414 Ga0081455_10014048
415 Ga0081455_10024554
416 Ga0081538_10020257
417 Ga0081538_10026855
418 Ga0081540_1000005
419 Ga0081540_1113802
420 Ga0081539_10053423
421 Ga0070717_10634503
422 Ga0075365_10006725
423 Ga0075365_10047292
424 Ga0075365_10380189
425 Ga0075365_10425535
426 Ga0075363_100086399
427 Ga0075363_100318353
428 Ga0075364_10005967
429 Ga0070716_100653331
430 Ga0070712_100058592
431 Ga0075362_10006226
432 Ga0075362_10145743
433 Ga0075367_10016186
434 Ga0075366_10004841
435 Ga0075366_10007298
436 Ga0097621_100195352
437 Ga0075370_10142590
438 Ga0075428_100105571
439 Ga0075428_100262964
440 Ga0075428_100402870
441 Ga0075428_100990178
442 Ga0075430_100252069
443 Ga0075430_100297527
444 Ga0075431_100173403
445 Ga0075431_100397274
446 Ga0075431_100647306
447 Ga0075431_100659741
448 Ga0075433_10063061
449 Ga0075433_10722737
450 Ga0075434_100006003
451 Ga0075434_100062417
452 Ga0075429_100073550
453 Ga0097620_101315311
454 Ga0075435_100710800
455 Ga0099794_10060046
456 Ga0099795_10002410
457 Ga0099795_10078938
458 Ga0111539_10018731
459 Ga0111539_10057994
460 Ga0111539_10084561
461 Ga0105245_10006183
462 Ga0105245_10220715
463 Ga0105247_10679616
464 Ga0114129_10001060
465 Ga0114129_10005063
466 Ga0114129_10538319
467 Ga0114129_10564619
468 Ga0105243_10170480
469 Ga0105243_10327581
470 Ga0105243_10623040
471 Ga0105242_10121129
472 Ga0105237_10031824
473 Ga0105249_10548347
474 Ga0105249_10732311
475 Ga0099796_10004995
476 Ga0105246_10006694
477 Ga0105246_10107868
478 Ga0157374_10377713
479 Ga0157378_10192686
480 Ga0163162_10139544
481 Ga0163162_10286732
482 Ga0163162_10980693
483 Ga0157375_10486564
484 Ga0163163_10075379
485 Ga0163163_10696544
486 Ga0157380_10229086
487 Ga0157380_10592307
488 Ga0182008_10007216
489 Ga0157376_10415959
490 Ga0207426_1043410
491 Ga0207707_10077027
492 Ga0207693_10122491
493 Ga0207660_10154606
494 Ga0207660_10390127
495 Ga0207652_10639574
496 Ga0207650_10008669
497 Ga0207687_10005544
498 Ga0207665_10223968
499 Ga0207711_10390861
500 Ga0207679_10120191
501 Ga0207651_10346676
502 Ga0207651_10721080
503 Ga0207668_10053924
504 Ga0207668_10481359
505 Ga0207658_10302527
506 Ga0207677_10156093
507 Ga0207703_10129111
508 Ga0207703_10348091
509 Ga0207678_10282731
510 Ga0207678_10689640
511 Ga0207702_10460075
512 Ga0207641_10730867
513 Ga0207675_100628675
514 Ga0209179_1014030
515 Ga0209179_1054245
516 Ga0268266_10119401
517 Ga0268264_10129024
518 Ga0268264_10424193
519 Ga0265332_10199926
520 Ga0265325_10001782
521 Ga0265325_10002799
522 Ga0265329_10044721
523 Ga0265339_10003962
524 Ga0265316_10059022
525 Ga0265313_10001018
526 Ga0316579_10000778
527 Ga0316579_10139531
528 Ga0265314_10410331
529 Ga0265342_10322889
530 Ga0316578_10026225
531 Ga0307405_10362804
532 Ga0307416_100463676
533 Ga0316583_10035924
534 Ga0373926_0089262
535 Ga0373926_0099947
536 Ga0373940_0066649
537 Ga0373944_0006390
538 Ga0373923_0045515
539 Ga0373932_0072518
540 Ga0373936_0039916
541 Ga0373941_0043393
542 Ga0373945_0035803
543 Ga0373956_0018531
544 Ga0373943_0086707
545 Ga0373946_0027053
546 Ga0316574_0000127
547 Ga0373931_0008506
548 Ga0373931_0071873
549 Ga0373935_0427057
550 Ga0373935_0442229
551 Ga0373927_0006729
552 Ga0373927_0021542
553 Ga0373927_0120358
554 Ga0373927_0166371
555 Ga0373927_0223295
556 Ga0373933_0078403
557 Ga0373947_0009160
558 Ga0373947_0027865
559 Ga0373947_0057211
560 Ga0373947_0062060
561 Ga0373947_0097995
562 Ga0373947_0112107
563 Ga0316584_0023242
564 Ga0373925_0015249
565 Ga0373925_0065732
566 Ga0373925_0114723
567 Ga0373925_0179208
568 Ga0395898_0063040
569 Ga0395905_0195262
570 Ga0436365_0751689
571 Ga0436363_0620130
572 Ga0466972_0081102
573 Ga0495627_038990
574 Ga0495603_0017194
575 Ga0495603_0077013
576 Ga0495603_0404989
577 Ga0495591_040064
578 Ga0495638_0066577
579 Ga0495641_0088943
580 Ga0495580_0253863
581 Ga0495582_0046126
582 Ga0495582_0253657
583 Ga0495584_0016246
584 Ga0495585_0022062
585 Ga0495594_0058992
586 Ga0495594_0531710
587 Ga0495607_0023087
588 Ga0495616_0017163
589 Ga0495616_0253896
590 Ga0495620_0054287
591 Ga0495630_0113276
592 Ga0495630_0379917
593 Ga0495631_0071808
594 Ga0495637_0040889
595 Ga0495644_0007605
596 Ga0495665_0043881
597 Ga0495640_0038648
598 Ga0495640_0634742
599 Ga0495598_0002481
600 Ga0495609_0071708
601 Ga0495621_0029518
602 Ga0495645_0694683
603 Ga0495622_0039499
604 Ga0495656_0000214
605 Ga0495656_0005167
606 Ga0495668_0102932
607 Ga0495611_0149788
608 Ga0495611_0151377
609 Ga0495659_0087083
610 Ga0495659_0136790
611 Ga0495661_0082946
612 Ga0495588_0039887
613 Ga0495647_0034939
614 Ga0495658_0058826
615 Ga0495613_0056853
616 Ga0495613_0291473
617 Ga0495613_0601202
618 Ga0495624_0054845
619 Ga0495624_0359422
620 Ga0495670_0092704
621 Ga0495671_0052474
622 Ga0495671_0064381
623 Ga0495589_0058443
624 Ga0495660_0082235
625 Ga0495581_0099647
626 Ga0495674_0170559
627 Ga0495674_0604883
628 Ga0495680_0144051
629 Ga0495677_0045731
630 Ga0495684_0175300
631 Ga0495593_0073003
632 Ga0495614_0258397
633 Ga0496100_0120536
634 Ga0496101_0020879
635 Ga0496101_0280164
636 Ga0496101_0467590
637 Ga0496101_0709656
638 Ga0496102_0029696
639 Ga0496103_0155310
640 Ga0496104_0001225
641 Ga0496104_0008498
642 Ga0496104_0033395
643 Ga0496104_0075639
644 Ga0496105_0000637
645 Ga0496105_0031116
646 Ga0496105_0125988
647 Ga0496105_0330970
648 Ga0496106_0031006
649 Ga0496106_0131639
650 Ga0496107_0660626
651 Ga0496108_0000745
652 Ga0496108_0030814
653 Ga0496109_0010192
654 Ga0496109_0303378
655 Ga0496110_0011576
656 Ga0496111_0000254
657 Ga0496112_0033634
658 Ga0496113_0000209
659 Ga0496114_0756340
660 Ga0496115_0011333
661 Ga0496115_0019222
662 Ga0496115_0028798
663 Ga0496115_0284119
664 Ga0496115_0517167
665 Ga0496121_0226947
666 Ga0501031_0003183
667 Ga0501031_0037305
668 Ga0501032_0057915
669 Ga0501033_0035610
670 Ga0501033_0046318
671 Ga0501033_0109574
672 Ga0501034_0026456
673 Ga0501034_0104582
674 Ga0501036_0005785
675 Ga0501036_0240455
676 Ga0501036_0274694
677 Ga0501037_0002948
678 Ga0501037_0090826
679 Ga0501038_0000843
680 Ga0501038_0008980
681 Ga0501040_0258890
682 Ga0501041_0054420
683 Ga0501043_0034861
684 Ga0501043_0050165
685 Ga0501046_0003200
686 Ga0501047_0228169
687 Ga0501048_0003240
688 Ga0501067_0409324
689 Ga0501068_0001776
690 Ga0501070_0025130
691 Ga0501070_0536399
692 Ga0501073_0047892
693 Ga0501073_0051719
694 Ga0501074_0044575
695 Ga0501074_0123748
696 Ga0501076_0258936
697 Ga0501077_0013501
698 Ga0501077_0207155
699 Ga0501079_0204813
700 Ga0501080_0030590
701 Ga0501080_0062751
702 Ga0501083_0113294
703 Ga0501083_0190046
704 Ga0501035_0043688
705 Ga0501035_0043938
706 Ga0501044_0094091
707 Ga0501044_0100504
708 Ga0501045_0238210
709 nmdc:mga03683_185712_c1
710 nmdc:mga03683_271478_c1
711 nmdc:mga03n38_160553_c1
712 nmdc:mga03n38_97495_c1
713 nmdc:mga00v17_160405_c1
714 nmdc:mga00v17_36256_c1
715 nmdc:mga0yw44_1519_c1
716 nmdc:mga0yw44_169419_c1
717 nmdc:mga0yw44_243405_c1
718 nmdc:mga0yw44_50926_c1
719 nmdc:mga0k408_139639_c1
720 nmdc:mga0k408_18386_c1
721 nmdc:mga0k408_26808_c1
722 nmdc:mga0k408_542115_c1
723 nmdc:mga06z11_324195_c1
724 nmdc:mga06z11_41726_c1
725 nmdc:mga04h51_102079_c1
726 nmdc:mga05p37_14993_c1
727 nmdc:mga05p37_2001_c1
728 nmdc:mga05p37_699635_c1
729 nmdc:mga09592_124198_c1
730 nmdc:mga0qj67_311131_c1
731 nmdc:mga06r32_205176_c1
732 nmdc:mga06r32_409437_c1
733 nmdc:mga06r32_679617_c1
734 nmdc:mga06r32_73548_c1
735 nmdc:mga08y16_129961_c1
736 nmdc:mga08y16_358828_c1
737 nmdc:mga08y16_48979_c1
738 nmdc:mga08y16_79782_c1
739 nmdc:mga0n895_100339_c1
740 nmdc:mga0rr50_1416273_c1
741 nmdc:mga0rr50_608300_c1
742 nmdc:mga08x19_346597_c1
743 nmdc:mga0a205_326740_c1
744 nmdc:mga0a205_657755_c1
745 Ga0495601_0239260
746 Ga0495612_0193611
747 Ga0495655_0005990
748 Ga0495655_0010076
749 Ga0495595_0038527
750 Ga0495619_0022154
751 Ga0500641_0234376
752 Ga0500568_0075877
753 Ga0500616_0228164
754 Ga0501082_0084815
755 Ga0501082_0330622
756 Ga0530510_0066575
757 Ga0530510_0085704
758 2545678855
759 2884298634
760 641646584

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00226

DnaJ

DnaJ domain

171

227

0.96

Map