F428724

General Info

Members Datasets Scaffolds Average Seq Length
380 230 760 463

Family's Representative Sequence

Representative Sequence 3300037853|Ga0436364_0059440|Ga0436364_0059440_4998_6476
Length 492
Sequence VIAEQTAPAATTIMMMGRGYRSAAEEGSRMVSDGSNNAADLMVIFGITGDLARKMTLRALYRLECRKLLDCPILGVASRQRSDDELLQFARQSVSGSGEKIDEDVFNRLTSRLSYIFGDVTGDFLYTQLAERVRAHHRPLYYLETPPSLFGPIVQHLGKAQLVTNARVAVEKPFGYDLHSARELDAQLHQVLREDQILRVDHFLGKEPVMELEYLRFANLALAEIWDRKSISAVQITMAEDFGVEDRGRFYDPVGALRDVVQNHLLQVLALVAMEPPASASAEELQDKKAEVFRAMPTADPRRYVRGQYEGYLDVPGVAPGSTTETFVALQLEIDNWRWAGVPIFLRAGKELPHHVTEVRLLLRPTPRLAFLPHPTEVDPNQIVLRIDPDSGLRLQIITRSNDSWRSVHLDTLFRQELGEPWEPYERVLHAALVGDHQLFARQDSIEETWRIVQPLLDNPPAVQSYQRGSWGPPVAESFCGQYHWQQPWLAK

Samples

Sample ID Description Type Environment
1 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
7 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
8 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
11 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
12 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
13 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
14 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
15 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
16 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
17 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
18 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
19 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
20 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
21 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
22 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
23 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
24 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
25 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
29 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
30 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
31 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
34 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
35 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
38 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
41 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
42 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
43 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
44 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
45 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
46 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
47 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
48 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
49 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
50 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
51 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
52 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
53 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
54 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
55 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
56 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
57 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
58 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
59 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
60 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
61 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
62 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
63 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
64 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
65 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
66 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
67 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
68 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
69 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
108 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
109 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
110 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
111 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
112 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
113 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
114 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
115 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
116 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
117 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
118 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
119 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
120 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
121 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
122 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
123 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
124 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
125 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
126 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
127 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
128 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
129 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
132 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
133 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
134 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
135 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
136 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
137 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
138 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
139 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
140 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
141 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
144 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
145 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
146 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
147 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
148 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
149 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
150 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
151 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
152 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
153 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
154 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
155 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
156 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
157 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
158 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
159 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
160 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
161 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
162 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
163 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
164 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
165 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
166 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
167 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
168 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
169 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
170 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
171 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
172 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
173 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
174 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
175 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
176 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
177 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
178 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
179 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
180 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
181 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
182 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
183 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
184 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
185 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
186 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
187 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
188 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
189 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
190 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
191 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
192 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
193 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
194 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
215 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
216 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
217 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
218 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
219 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
220 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
221 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
222 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
223 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
224 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
225 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
226 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
227 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
228 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
229 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
230 2902792274 Mycolicibacterium sp. P9-64 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.79
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.58
Nodule 0
Rhizoplane 12.11
Rhizosphere 78.95
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0436364_0059440 3300037853 Bacteria 78275
2 JGI24740J21852_10000270 3300001979 Bacteria 21884
3 rootH2_10001145 3300003320 Bacteria 2642
4 JGI25404J52841_10003708 3300003659 Bacteria 3039
5 Ga0070683_100000226 3300005329 Bacteria 38469
6 Ga0070683_100001131 3300005329 Bacteria 20182
7 Ga0070683_100002346 3300005329 Bacteria 15022
8 Ga0070683_100009632 3300005329 Bacteria 8268
9 Ga0070690_100044430 3300005330 Bacteria 2820
10 Ga0070677_10000007 3300005333 Bacteria 74721
11 Ga0070666_10151379 3300005335 Bacteria 1618
12 Ga0070682_100000038 3300005337 Bacteria 145670
13 Ga0070682_100000072 3300005337 Bacteria 93808
14 Ga0070689_100070671 3300005340 Bacteria 2726
15 Ga0070661_100000204 3300005344 Bacteria 49187
16 Ga0070668_100026362 3300005347 Bacteria 4410
17 Ga0070675_100000008 3300005354 Bacteria 250004
18 Ga0070674_100000001 3300005356 Bacteria 277173
19 Ga0070688_100000018 3300005365 Bacteria 72357
20 Ga0070688_100000364 3300005365 Bacteria 22986
21 Ga0070659_100147564 3300005366 Bacteria 1917
22 Ga0070667_100001736 3300005367 Bacteria 19468
23 Ga0070667_100029164 3300005367 Bacteria 4595
24 Ga0070713_100000061 3300005436 Bacteria 68662
25 Ga0070663_100000274 3300005455 Bacteria 25997
26 Ga0070681_10059721 3300005458 Bacteria 3792
27 Ga0070685_10000114 3300005466 Bacteria 51524
28 Ga0070685_10000437 3300005466 Bacteria 24303
29 Ga0070698_100009101 3300005471 Bacteria 10669
30 Ga0070699_100023765 3300005518 Bacteria 5281
31 Ga0070684_100000718 3300005535 Bacteria 22923
32 Ga0070684_100135763 3300005535 Bacteria 2222
33 Ga0068853_100005229 3300005539 Bacteria 10153
34 Ga0068853_100206359 3300005539 Bacteria 1790
35 Ga0070672_100000018 3300005543 Bacteria 70205
36 Ga0070665_100000306 3300005548 Bacteria 76666
37 Ga0070665_100002847 3300005548 Bacteria 18730
38 Ga0070665_100130582 3300005548 Bacteria 2514
39 Ga0070704_100168095 3300005549 Bacteria 1741
40 Ga0070664_100003303 3300005564 Bacteria 13030
41 Ga0070664_100045649 3300005564 Bacteria 3701
42 Ga0070664_100113001 3300005564 Bacteria 2372
43 Ga0068857_100005813 3300005577 Bacteria 10541
44 Ga0068854_100000044 3300005578 Bacteria 91882
45 Ga0068854_100037363 3300005578 Bacteria 3408
46 Ga0068852_100000050 3300005616 Bacteria 84306
47 Ga0068852_100045197 3300005616 Bacteria 3744
48 Ga0068866_10000055 3300005718 Bacteria 44369
49 Ga0068866_10001565 3300005718 Bacteria 9730
50 Ga0068851_10000922 3300005834 Bacteria 12681
51 Ga0068863_100000039 3300005841 Bacteria 161450
52 Ga0068863_100018638 3300005841 Bacteria 6640
53 Ga0068863_100071809 3300005841 Bacteria 3275
54 Ga0068858_100000178 3300005842 Bacteria 67760
55 Ga0081455_10018222 3300005937 Bacteria 6699
56 Ga0081540_1000044 3300005983 Bacteria 134269
57 Ga0081540_1006561 3300005983 Bacteria 8445
58 Ga0081540_1055814 3300005983 Bacteria 1921
59 Ga0081539_10003996 3300005985 Bacteria 17009
60 Ga0070712_100007600 3300006175 Bacteria 6773
61 Ga0075369_10012311 3300006186 Bacteria 3380
62 Ga0097621_100230145 3300006237 Bacteria 1618
63 Ga0075370_10006024 3300006353 Bacteria 6074
64 Ga0075433_10002113 3300006852 Bacteria 15055
65 Ga0075434_100191540 3300006871 Bacteria 2065
66 Ga0068865_100000019 3300006881 Bacteria 105996
67 Ga0099795_10006880 3300007788 Bacteria 3133
68 Ga0105240_10261867 3300009093 Bacteria 1994
69 Ga0105245_10000012 3300009098 Bacteria 267151
70 Ga0105245_10000049 3300009098 Bacteria 128277
71 Ga0105245_10000508 3300009098 Bacteria 35724
72 Ga0105247_10000109 3300009101 Bacteria 84490
73 Ga0105241_10063354 3300009174 Bacteria 2852
74 Ga0105241_10107326 3300009174 Bacteria 2230
75 Ga0105242_10000403 3300009176 Bacteria 34337
76 Ga0105242_10001375 3300009176 Bacteria 19173
77 Ga0105242_10072294 3300009176 Bacteria 2864
78 Ga0105248_10000267 3300009177 Bacteria 61244
79 Ga0105249_10000039 3300009553 Bacteria 196325
80 Ga0105249_10046930 3300009553 Bacteria 3933
81 Ga0105239_10016740 3300010375 Bacteria 8104
82 Ga0105239_10140138 3300010375 Bacteria 2694
83 Ga0105246_10024015 3300011119 Bacteria 3953
84 Ga0157370_10017447 3300013104 Bacteria 7242
85 Ga0157370_10114450 3300013104 Bacteria 2520
86 Ga0157369_10000135 3300013105 Bacteria 105364
87 Ga0157372_10000128 3300013307 Bacteria 82571
88 Ga0157375_10000942 3300013308 Bacteria 25237
89 Ga0157380_10000009 3300014326 Bacteria 142155
90 Ga0157380_10177763 3300014326 Bacteria 1867
91 Ga0157379_10004635 3300014968 Bacteria 11797
92 Ga0157379_10009692 3300014968 Bacteria 8386
93 Ga0157376_10054696 3300014969 Bacteria 3329
94 Ga0163161_10000013 3300017792 Bacteria 258747
95 Ga0206350_10675713 3300020080 Bacteria 1500
96 Ga0213876_10014606 3300021384 Bacteria 4161
97 Ga0213875_10000140 3300021388 Bacteria 78573
98 Ga0213875_10034905 3300021388 Bacteria 2374
99 Ga0224712_10003634 3300022467 Bacteria 4043
100 Ga0224712_10012258 3300022467 Bacteria 2690
101 Ga0207656_10000153 3300025321 Bacteria 25555
102 Ga0207682_10000007 3300025893 Bacteria 88967
103 Ga0207642_10006378 3300025899 Bacteria 3918
104 Ga0207710_10006138 3300025900 Bacteria 5144
105 Ga0207710_10016361 3300025900 Bacteria 3137
106 Ga0207680_10014289 3300025903 Bacteria 4104
107 Ga0207647_10003815 3300025904 Bacteria 11266
108 Ga0207699_10019264 3300025906 Bacteria 3635
109 Ga0207643_10132053 3300025908 Bacteria 1486
110 Ga0207695_10105717 3300025913 Bacteria 2802
111 Ga0207671_10000589 3300025914 Bacteria 48540
112 Ga0207649_10000005 3300025920 Bacteria 356179
113 Ga0207652_10000138 3300025921 Bacteria 77564
114 Ga0207652_10001090 3300025921 Bacteria 24590
115 Ga0207646_10142704 3300025922 Bacteria 2157
116 Ga0207694_10000008 3300025924 Bacteria 484902
117 Ga0207694_10012306 3300025924 Bacteria 6450
118 Ga0207659_10000014 3300025926 Bacteria 168481
119 Ga0207687_10000011 3300025927 Bacteria 388349
120 Ga0207687_10000012 3300025927 Bacteria 370729
121 Ga0207687_10001866 3300025927 Bacteria 14507
122 Ga0207700_10000016 3300025928 Bacteria 202434
123 Ga0207690_10033814 3300025932 Bacteria 3290
124 Ga0207686_10000029 3300025934 Bacteria 160239
125 Ga0207686_10043464 3300025934 Bacteria 2753
126 Ga0207669_10000002 3300025937 Bacteria 377651
127 Ga0207704_10000009 3300025938 Bacteria 198266
128 Ga0207691_10000121 3300025940 Bacteria 70558
129 Ga0207711_10000024 3300025941 Bacteria 293596
130 Ga0207661_10000068 3300025944 Bacteria 70953
131 Ga0207661_10000925 3300025944 Bacteria 19251
132 Ga0207661_10009099 3300025944 Bacteria 7118
133 Ga0207679_10027004 3300025945 Bacteria 3966
134 Ga0207679_10037921 3300025945 Bacteria 3430
135 Ga0207712_10000003 3300025961 Bacteria 615314
136 Ga0207668_10051934 3300025972 Bacteria 2834
137 Ga0207640_10000517 3300025981 Bacteria 23263
138 Ga0207640_10085166 3300025981 Bacteria 2173
139 Ga0207658_10000708 3300025986 Bacteria 28881
140 Ga0207658_10004459 3300025986 Bacteria 9728
141 Ga0207677_10000671 3300026023 Bacteria 20346
142 Ga0207703_10000381 3300026035 Bacteria 47426
143 Ga0207639_10000838 3300026041 Bacteria 20868
144 Ga0207678_10007383 3300026067 Bacteria 9730
145 Ga0207702_10000099 3300026078 Bacteria 100461
146 Ga0207702_10038750 3300026078 Bacteria 3992
147 Ga0207641_10000065 3300026088 Bacteria 156066
148 Ga0207641_10001058 3300026088 Bacteria 27805
149 Ga0207641_10038257 3300026088 Bacteria 4010
150 Ga0207674_10003494 3300026116 Bacteria 19188
151 Ga0207698_10000009 3300026142 Bacteria 281300
152 Ga0207698_10098548 3300026142 Bacteria 2416
153 Ga0268266_10000023 3300028379 Bacteria 501899
154 Ga0268266_10001333 3300028379 Bacteria 29934
155 Ga0265319_1000091 3300028563 Bacteria 70394
156 Ga0265338_10000752 3300028800 Bacteria 55238
157 Ga0265325_10035447 3300031241 Bacteria 2650
158 Ga0373937_0021125 3300036401 Bacteria 5842
159 Ga0373925_0000167 3300037068 Bacteria 71153
160 Ga0436364_0652113 3300037853 Bacteria 6236
161 Ga0436364_1267366 3300037853 Bacteria 12866
162 Ga0436365_0675851 3300039437 Bacteria 5616
163 Ga0436365_1083994 3300039437 Bacteria 225582
164 Ga0466969_0029812 3300044656 Bacteria 2783
165 Ga0466966_0006122 3300044684 Bacteria 7949
166 Ga0466966_0010021 3300044684 Bacteria 6279
167 Ga0466961_0011260 3300044693 Bacteria 5719
168 Ga0466963_0000025 3300044694 Bacteria 51171
169 Ga0466963_0046846 3300044694 Bacteria 2852
170 Ga0466971_0014271 3300044719 Bacteria 3493
171 Ga0466957_0008376 3300044842 Bacteria 5881
172 Ga0466957_0091838 3300044842 Bacteria 1903
173 Ga0466959_0046934 3300045049 Bacteria 3178
174 Ga0466958_0000656 3300045836 Bacteria 14946
175 Ga0466967_0000123 3300045976 Bacteria 29223
176 Ga0495592_0009439 3300046454 Bacteria 7335
177 Ga0495592_0032740 3300046454 Bacteria 3920
178 Ga0495592_0041788 3300046454 Bacteria 3435
179 Ga0495592_0125127 3300046454 Bacteria 1805
180 Ga0495603_0057891 3300046455 Bacteria 2292
181 Ga0495629_0000377 3300046459 Bacteria 37247
182 Ga0495629_0002409 3300046459 Bacteria 14397
183 Ga0495629_0014026 3300046459 Bacteria 5775
184 Ga0495638_0021853 3300046460 Bacteria 4206
185 Ga0495641_0000095 3300046461 Bacteria 60441
186 Ga0495641_0006400 3300046461 Bacteria 7638
187 Ga0495641_0069210 3300046461 Bacteria 1586
188 Ga0495651_0062105 3300046462 Bacteria 2859
189 Ga0495653_0014053 3300046463 Bacteria 6529
190 Ga0495582_0000082 3300046473 Bacteria 48118
191 Ga0495662_0001723 3300046476 Bacteria 10927
192 Ga0495662_0005396 3300046476 Bacteria 6399
193 Ga0495594_0000345 3300046499 Bacteria 23182
194 Ga0495583_0067400 3300046506 Bacteria 1581
195 Ga0495606_0000294 3300046507 Bacteria 85998
196 Ga0495606_0077890 3300046507 Bacteria 2069
197 Ga0495608_0000010 3300046511 Bacteria 258660
198 Ga0495608_0001938 3300046511 Bacteria 14858
199 Ga0495610_0027067 3300046512 Bacteria 3054
200 Ga0495618_0000097 3300046514 Bacteria 63474
201 Ga0495618_0030365 3300046514 Bacteria 3375
202 Ga0495620_0000158 3300046515 Bacteria 54704
203 Ga0495620_0023507 3300046515 Bacteria 2945
204 Ga0495628_0000048 3300046516 Bacteria 96944
205 Ga0495628_0011205 3300046516 Bacteria 7586
206 Ga0495628_0139987 3300046516 Bacteria 1847
207 Ga0495630_0000011 3300046517 Bacteria 232063
208 Ga0495630_0000082 3300046517 Bacteria 75280
209 Ga0495630_0001301 3300046517 Bacteria 17211
210 Ga0495630_0065590 3300046517 Bacteria 2729
211 Ga0495644_0000404 3300046523 Bacteria 19389
212 Ga0495648_0006564 3300046524 Bacteria 9463
213 Ga0495652_0000003 3300046529 Bacteria 597094
214 Ga0495652_0022143 3300046529 Bacteria 5643
215 Ga0495652_0115779 3300046529 Bacteria 2147
216 Ga0495586_0000234 3300046535 Bacteria 36813
217 Ga0495587_0019204 3300046536 Bacteria 4234
218 Ga0495645_0002167 3300046543 Bacteria 13338
219 Ga0495645_0016538 3300046543 Bacteria 5270
220 Ga0495622_0000124 3300046557 Bacteria 66518
221 Ga0495634_0000092 3300046642 Bacteria 72088
222 Ga0495634_0000616 3300046642 Bacteria 34537
223 Ga0495634_0004570 3300046642 Bacteria 10809
224 Ga0495611_0013683 3300046648 Bacteria 3458
225 Ga0495625_0000095 3300046660 Bacteria 143468
226 Ga0495635_0000006 3300046663 Bacteria 301820
227 Ga0495588_0000218 3300046674 Bacteria 54328
228 Ga0495657_0000005 3300046675 Bacteria 254860
229 Ga0495657_0002455 3300046675 Bacteria 15608
230 Ga0495599_0014659 3300046678 Bacteria 4855
231 Ga0495647_0000010 3300046681 Bacteria 94696
232 Ga0495647_0000111 3300046681 Bacteria 20557
233 Ga0495647_0000938 3300046681 Bacteria 8769
234 Ga0495658_0000070 3300046683 Bacteria 52450
235 Ga0495658_0000965 3300046683 Bacteria 15281
236 Ga0495669_0000072 3300046684 Bacteria 66900
237 Ga0495669_0001896 3300046684 Bacteria 8575
238 Ga0495613_0000092 3300046689 Bacteria 86976
239 Ga0495613_0000131 3300046689 Bacteria 74262
240 Ga0495624_0000049 3300046690 Bacteria 75485
241 Ga0495624_0000455 3300046690 Bacteria 32215
242 Ga0495624_0083212 3300046690 Bacteria 1979
243 Ga0495649_0001406 3300046694 Bacteria 18177
244 Ga0495600_0000893 3300046809 Bacteria 15969
245 Ga0495600_0014621 3300046809 Bacteria 4948
246 Ga0495600_0053095 3300046809 Bacteria 2647
247 Ga0495604_0000038 3300047317 Bacteria 123703
248 Ga0495604_0000078 3300047317 Bacteria 83632
249 Ga0495604_0019608 3300047317 Bacteria 5412
250 Ga0495604_0066763 3300047317 Bacteria 2735
251 Ga0495674_0000063 3300047319 Bacteria 71737
252 Ga0495672_0008193 3300047320 Bacteria 7751
253 Ga0495676_0018845 3300047321 Bacteria 6083
254 Ga0495680_0000050 3300047322 Bacteria 95945
255 Ga0495680_0000873 3300047322 Bacteria 33510
256 Ga0495675_0000004 3300047444 Bacteria 211049
257 Ga0495673_0002889 3300047469 Bacteria 11664
258 Ga0495686_0002214 3300047472 Bacteria 18881
259 Ga0495602_0000009 3300048088 Bacteria 258991
260 Ga0495602_0006848 3300048088 Bacteria 11970
261 Ga0496100_0000004 3300048903 Bacteria 321778
262 Ga0496100_0000032 3300048903 Bacteria 99877
263 Ga0496100_0000592 3300048903 Bacteria 17134
264 Ga0496101_0000007 3300048904 Bacteria 321778
265 Ga0496101_0000012 3300048904 Bacteria 268127
266 Ga0496101_0000021 3300048904 Bacteria 217090
267 Ga0496102_0000001 3300048905 Bacteria 873433
268 Ga0496102_0000132 3300048905 Bacteria 103176
269 Ga0496102_0015854 3300048905 Bacteria 6571
270 Ga0496103_0000007 3300048906 Bacteria 354915
271 Ga0496103_0000077 3300048906 Bacteria 112223
272 Ga0496104_0000002 3300048907 Bacteria 686017
273 Ga0496104_0000003 3300048907 Bacteria 669219
274 Ga0496104_0001440 3300048907 Bacteria 20567
275 Ga0496104_0010316 3300048907 Bacteria 8341
276 Ga0496105_0000001 3300048908 Bacteria 1328178
277 Ga0496105_0000003 3300048908 Bacteria 713251
278 Ga0496105_0000095 3300048908 Bacteria 60866
279 Ga0496106_0000004 3300048909 Bacteria 279896
280 Ga0496106_0000092 3300048909 Bacteria 70312
281 Ga0496106_0000130 3300048909 Bacteria 57887
282 Ga0496106_0005962 3300048909 Bacteria 9001
283 Ga0496106_0154550 3300048909 Bacteria 1811
284 Ga0496107_0000001 3300048910 Bacteria 321778
285 Ga0496107_0000031 3300048910 Bacteria 100522
286 Ga0496108_0000002 3300048911 Bacteria 700890
287 Ga0496108_0000012 3300048911 Bacteria 258433
288 Ga0496108_0000202 3300048911 Bacteria 55115
289 Ga0496108_0003530 3300048911 Bacteria 12543
290 Ga0496108_0014574 3300048911 Bacteria 6417
291 Ga0496109_0000001 3300048912 Bacteria 700852
292 Ga0496109_0000076 3300048912 Bacteria 104273
293 Ga0496109_0000106 3300048912 Bacteria 86550
294 Ga0496109_0000131 3300048912 Bacteria 76860
295 Ga0496109_0150382 3300048912 Bacteria 2180
296 Ga0496110_0000015 3300048913 Bacteria 85373
297 Ga0496111_0000001 3300048914 Bacteria 194837
298 Ga0496111_0034952 3300048914 Bacteria 3590
299 Ga0496112_0000250 3300048915 Bacteria 34271
300 Ga0496113_0000039 3300048916 Bacteria 55926
301 Ga0496113_0011190 3300048916 Bacteria 5971
302 Ga0496114_0000003 3300048917 Bacteria 630981
303 Ga0496114_0016978 3300048917 Bacteria 5870
304 Ga0496114_0063654 3300048917 Bacteria 3088
305 Ga0496115_0000071 3300048918 Bacteria 91922
306 Ga0496115_0000183 3300048918 Bacteria 58406
307 Ga0496116_0000018 3300048919 Bacteria 545877
308 Ga0496116_0001727 3300048919 Bacteria 23857
309 Ga0496117_0000015 3300048920 Bacteria 583316
310 Ga0496117_0003031 3300048920 Bacteria 20148
311 Ga0496118_0000012 3300048921 Bacteria 583316
312 Ga0496118_0003573 3300048921 Bacteria 19378
313 Ga0496119_0001610 3300048922 Bacteria 26733
314 Ga0496119_0007872 3300048922 Bacteria 9487
315 Ga0496119_0011161 3300048922 Bacteria 7481
316 Ga0496120_0000195 3300048923 Bacteria 104031
317 Ga0496120_0002973 3300048923 Bacteria 16134
318 Ga0496121_0000809 3300048924 Bacteria 56983
319 Ga0496121_0020618 3300048924 Bacteria 6510
320 Ga0496124_0079803 3300048927 Bacteria 2694
321 Ga0496126_0000906 3300048929 Bacteria 51430
322 Ga0496126_0006739 3300048929 Bacteria 12750
323 Ga0496126_0009868 3300048929 Bacteria 10103
324 Ga0496126_0262888 3300048929 Bacteria 1434
325 Ga0501031_0001843 3300049568 Bacteria 13331
326 Ga0501032_0006154 3300049569 Bacteria 8832
327 Ga0501033_0006846 3300049570 Bacteria 8897
328 Ga0501034_0009884 3300049571 Bacteria 9972
329 Ga0501036_0007038 3300049572 Bacteria 9151
330 Ga0501037_0006130 3300049573 Bacteria 8782
331 Ga0501038_0004258 3300049574 Bacteria 13302
332 Ga0501039_0087983 3300049575 Bacteria 2420
333 Ga0501040_0098105 3300049576 Bacteria 2042
334 Ga0501043_0007126 3300049579 Bacteria 8895
335 Ga0501046_0004639 3300049580 Bacteria 12413
336 Ga0501047_0002598 3300049581 Bacteria 17193
337 Ga0501047_0012226 3300049581 Bacteria 8128
338 Ga0501047_0065722 3300049581 Bacteria 3496
339 Ga0501048_0002831 3300049582 Bacteria 13243
340 Ga0501070_0002436 3300049586 Bacteria 16316
341 Ga0501070_0162383 3300049586 Bacteria 1841
342 Ga0501071_0012097 3300049587 Bacteria 5836
343 Ga0501073_0007567 3300049589 Bacteria 8070
344 Ga0501074_0006028 3300049590 Bacteria 8750
345 Ga0501074_0049020 3300049590 Bacteria 3050
346 Ga0501075_0092048 3300049591 Bacteria 2301
347 Ga0501079_0008842 3300049741 Bacteria 7626
348 Ga0501080_0030272 3300049742 Bacteria 5043
349 Ga0501080_0082030 3300049742 Bacteria 2995
350 Ga0501083_0005791 3300049744 Bacteria 8752
351 Ga0501083_0141015 3300049744 Bacteria 1578
352 Ga0501035_0002544 3300049822 Bacteria 17838
353 Ga0501035_0002764 3300049822 Bacteria 17017
354 Ga0501044_0000568 3300049823 Bacteria 44963
355 Ga0501044_0003950 3300049823 Bacteria 16609
356 Ga0501044_0041151 3300049823 Bacteria 4811
357 Ga0501045_0089321 3300049824 Bacteria 2276
358 nmdc:mga0a205_1629_c2 3300050515 Bacteria 15476
359 Ga0495601_0000042 3300053077 Bacteria 77373
360 Ga0495601_0000296 3300053077 Bacteria 26491
361 Ga0495601_0118870 3300053077 Bacteria 1715
362 Ga0495612_0005189 3300053078 Bacteria 5384
363 Ga0495655_0000009 3300053083 Bacteria 150662
364 Ga0495595_0000005 3300053084 Bacteria 258660
365 Ga0495595_0000362 3300053084 Bacteria 17220
366 Ga0495595_0053699 3300053084 Bacteria 1873
367 Ga0495619_0000040 3300053085 Bacteria 118238
368 Ga0495619_0000060 3300053085 Bacteria 89377
369 Ga0495619_0000126 3300053085 Bacteria 56169
370 Ga0495619_0000896 3300053085 Bacteria 19523
371 Ga0495619_0001321 3300053085 Bacteria 16261
372 Ga0495619_0002266 3300053085 Bacteria 12712
373 Ga0500643_022356 3300053087 Bacteria 2036
374 Ga0500641_0002279 3300053096 Bacteria 6808
375 Ga0500614_000806 3300053123 Bacteria 7940
376 Ga0500628_000022 3300053129 Bacteria 77990
377 Ga0501082_0022029 3300060353 Bacteria 5494
378 Ga0466962_0009970 3300061719 Bacteria 4556
379 Ga0466962_0036103 3300061719 Bacteria 2365
380 2902795031 2902792274 Bacteria 7270173
381 Ga0436364_0059440
382 JGI24740J21852_10000270
383 rootH2_10001145
384 JGI25404J52841_10003708
385 Ga0070683_100000226
386 Ga0070683_100001131
387 Ga0070683_100002346
388 Ga0070683_100009632
389 Ga0070690_100044430
390 Ga0070677_10000007
391 Ga0070666_10151379
392 Ga0070682_100000038
393 Ga0070682_100000072
394 Ga0070689_100070671
395 Ga0070661_100000204
396 Ga0070668_100026362
397 Ga0070675_100000008
398 Ga0070674_100000001
399 Ga0070688_100000018
400 Ga0070688_100000364
401 Ga0070659_100147564
402 Ga0070667_100001736
403 Ga0070667_100029164
404 Ga0070713_100000061
405 Ga0070663_100000274
406 Ga0070681_10059721
407 Ga0070685_10000114
408 Ga0070685_10000437
409 Ga0070698_100009101
410 Ga0070699_100023765
411 Ga0070684_100000718
412 Ga0070684_100135763
413 Ga0068853_100005229
414 Ga0068853_100206359
415 Ga0070672_100000018
416 Ga0070665_100000306
417 Ga0070665_100002847
418 Ga0070665_100130582
419 Ga0070704_100168095
420 Ga0070664_100003303
421 Ga0070664_100045649
422 Ga0070664_100113001
423 Ga0068857_100005813
424 Ga0068854_100000044
425 Ga0068854_100037363
426 Ga0068852_100000050
427 Ga0068852_100045197
428 Ga0068866_10000055
429 Ga0068866_10001565
430 Ga0068851_10000922
431 Ga0068863_100000039
432 Ga0068863_100018638
433 Ga0068863_100071809
434 Ga0068858_100000178
435 Ga0081455_10018222
436 Ga0081540_1000044
437 Ga0081540_1006561
438 Ga0081540_1055814
439 Ga0081539_10003996
440 Ga0070712_100007600
441 Ga0075369_10012311
442 Ga0097621_100230145
443 Ga0075370_10006024
444 Ga0075433_10002113
445 Ga0075434_100191540
446 Ga0068865_100000019
447 Ga0099795_10006880
448 Ga0105240_10261867
449 Ga0105245_10000012
450 Ga0105245_10000049
451 Ga0105245_10000508
452 Ga0105247_10000109
453 Ga0105241_10063354
454 Ga0105241_10107326
455 Ga0105242_10000403
456 Ga0105242_10001375
457 Ga0105242_10072294
458 Ga0105248_10000267
459 Ga0105249_10000039
460 Ga0105249_10046930
461 Ga0105239_10016740
462 Ga0105239_10140138
463 Ga0105246_10024015
464 Ga0157370_10017447
465 Ga0157370_10114450
466 Ga0157369_10000135
467 Ga0157372_10000128
468 Ga0157375_10000942
469 Ga0157380_10000009
470 Ga0157380_10177763
471 Ga0157379_10004635
472 Ga0157379_10009692
473 Ga0157376_10054696
474 Ga0163161_10000013
475 Ga0206350_10675713
476 Ga0213876_10014606
477 Ga0213875_10000140
478 Ga0213875_10034905
479 Ga0224712_10003634
480 Ga0224712_10012258
481 Ga0207656_10000153
482 Ga0207682_10000007
483 Ga0207642_10006378
484 Ga0207710_10006138
485 Ga0207710_10016361
486 Ga0207680_10014289
487 Ga0207647_10003815
488 Ga0207699_10019264
489 Ga0207643_10132053
490 Ga0207695_10105717
491 Ga0207671_10000589
492 Ga0207649_10000005
493 Ga0207652_10000138
494 Ga0207652_10001090
495 Ga0207646_10142704
496 Ga0207694_10000008
497 Ga0207694_10012306
498 Ga0207659_10000014
499 Ga0207687_10000011
500 Ga0207687_10000012
501 Ga0207687_10001866
502 Ga0207700_10000016
503 Ga0207690_10033814
504 Ga0207686_10000029
505 Ga0207686_10043464
506 Ga0207669_10000002
507 Ga0207704_10000009
508 Ga0207691_10000121
509 Ga0207711_10000024
510 Ga0207661_10000068
511 Ga0207661_10000925
512 Ga0207661_10009099
513 Ga0207679_10027004
514 Ga0207679_10037921
515 Ga0207712_10000003
516 Ga0207668_10051934
517 Ga0207640_10000517
518 Ga0207640_10085166
519 Ga0207658_10000708
520 Ga0207658_10004459
521 Ga0207677_10000671
522 Ga0207703_10000381
523 Ga0207639_10000838
524 Ga0207678_10007383
525 Ga0207702_10000099
526 Ga0207702_10038750
527 Ga0207641_10000065
528 Ga0207641_10001058
529 Ga0207641_10038257
530 Ga0207674_10003494
531 Ga0207698_10000009
532 Ga0207698_10098548
533 Ga0268266_10000023
534 Ga0268266_10001333
535 Ga0265319_1000091
536 Ga0265338_10000752
537 Ga0265325_10035447
538 Ga0373937_0021125
539 Ga0373925_0000167
540 Ga0436364_0652113
541 Ga0436364_1267366
542 Ga0436365_0675851
543 Ga0436365_1083994
544 Ga0466969_0029812
545 Ga0466966_0006122
546 Ga0466966_0010021
547 Ga0466961_0011260
548 Ga0466963_0000025
549 Ga0466963_0046846
550 Ga0466971_0014271
551 Ga0466957_0008376
552 Ga0466957_0091838
553 Ga0466959_0046934
554 Ga0466958_0000656
555 Ga0466967_0000123
556 Ga0495592_0009439
557 Ga0495592_0032740
558 Ga0495592_0041788
559 Ga0495592_0125127
560 Ga0495603_0057891
561 Ga0495629_0000377
562 Ga0495629_0002409
563 Ga0495629_0014026
564 Ga0495638_0021853
565 Ga0495641_0000095
566 Ga0495641_0006400
567 Ga0495641_0069210
568 Ga0495651_0062105
569 Ga0495653_0014053
570 Ga0495582_0000082
571 Ga0495662_0001723
572 Ga0495662_0005396
573 Ga0495594_0000345
574 Ga0495583_0067400
575 Ga0495606_0000294
576 Ga0495606_0077890
577 Ga0495608_0000010
578 Ga0495608_0001938
579 Ga0495610_0027067
580 Ga0495618_0000097
581 Ga0495618_0030365
582 Ga0495620_0000158
583 Ga0495620_0023507
584 Ga0495628_0000048
585 Ga0495628_0011205
586 Ga0495628_0139987
587 Ga0495630_0000011
588 Ga0495630_0000082
589 Ga0495630_0001301
590 Ga0495630_0065590
591 Ga0495644_0000404
592 Ga0495648_0006564
593 Ga0495652_0000003
594 Ga0495652_0022143
595 Ga0495652_0115779
596 Ga0495586_0000234
597 Ga0495587_0019204
598 Ga0495645_0002167
599 Ga0495645_0016538
600 Ga0495622_0000124
601 Ga0495634_0000092
602 Ga0495634_0000616
603 Ga0495634_0004570
604 Ga0495611_0013683
605 Ga0495625_0000095
606 Ga0495635_0000006
607 Ga0495588_0000218
608 Ga0495657_0000005
609 Ga0495657_0002455
610 Ga0495599_0014659
611 Ga0495647_0000010
612 Ga0495647_0000111
613 Ga0495647_0000938
614 Ga0495658_0000070
615 Ga0495658_0000965
616 Ga0495669_0000072
617 Ga0495669_0001896
618 Ga0495613_0000092
619 Ga0495613_0000131
620 Ga0495624_0000049
621 Ga0495624_0000455
622 Ga0495624_0083212
623 Ga0495649_0001406
624 Ga0495600_0000893
625 Ga0495600_0014621
626 Ga0495600_0053095
627 Ga0495604_0000038
628 Ga0495604_0000078
629 Ga0495604_0019608
630 Ga0495604_0066763
631 Ga0495674_0000063
632 Ga0495672_0008193
633 Ga0495676_0018845
634 Ga0495680_0000050
635 Ga0495680_0000873
636 Ga0495675_0000004
637 Ga0495673_0002889
638 Ga0495686_0002214
639 Ga0495602_0000009
640 Ga0495602_0006848
641 Ga0496100_0000004
642 Ga0496100_0000032
643 Ga0496100_0000592
644 Ga0496101_0000007
645 Ga0496101_0000012
646 Ga0496101_0000021
647 Ga0496102_0000001
648 Ga0496102_0000132
649 Ga0496102_0015854
650 Ga0496103_0000007
651 Ga0496103_0000077
652 Ga0496104_0000002
653 Ga0496104_0000003
654 Ga0496104_0001440
655 Ga0496104_0010316
656 Ga0496105_0000001
657 Ga0496105_0000003
658 Ga0496105_0000095
659 Ga0496106_0000004
660 Ga0496106_0000092
661 Ga0496106_0000130
662 Ga0496106_0005962
663 Ga0496106_0154550
664 Ga0496107_0000001
665 Ga0496107_0000031
666 Ga0496108_0000002
667 Ga0496108_0000012
668 Ga0496108_0000202
669 Ga0496108_0003530
670 Ga0496108_0014574
671 Ga0496109_0000001
672 Ga0496109_0000076
673 Ga0496109_0000106
674 Ga0496109_0000131
675 Ga0496109_0150382
676 Ga0496110_0000015
677 Ga0496111_0000001
678 Ga0496111_0034952
679 Ga0496112_0000250
680 Ga0496113_0000039
681 Ga0496113_0011190
682 Ga0496114_0000003
683 Ga0496114_0016978
684 Ga0496114_0063654
685 Ga0496115_0000071
686 Ga0496115_0000183
687 Ga0496116_0000018
688 Ga0496116_0001727
689 Ga0496117_0000015
690 Ga0496117_0003031
691 Ga0496118_0000012
692 Ga0496118_0003573
693 Ga0496119_0001610
694 Ga0496119_0007872
695 Ga0496119_0011161
696 Ga0496120_0000195
697 Ga0496120_0002973
698 Ga0496121_0000809
699 Ga0496121_0020618
700 Ga0496124_0079803
701 Ga0496126_0000906
702 Ga0496126_0006739
703 Ga0496126_0009868
704 Ga0496126_0262888
705 Ga0501031_0001843
706 Ga0501032_0006154
707 Ga0501033_0006846
708 Ga0501034_0009884
709 Ga0501036_0007038
710 Ga0501037_0006130
711 Ga0501038_0004258
712 Ga0501039_0087983
713 Ga0501040_0098105
714 Ga0501043_0007126
715 Ga0501046_0004639
716 Ga0501047_0002598
717 Ga0501047_0012226
718 Ga0501047_0065722
719 Ga0501048_0002831
720 Ga0501070_0002436
721 Ga0501070_0162383
722 Ga0501071_0012097
723 Ga0501073_0007567
724 Ga0501074_0006028
725 Ga0501074_0049020
726 Ga0501075_0092048
727 Ga0501079_0008842
728 Ga0501080_0030272
729 Ga0501080_0082030
730 Ga0501083_0005791
731 Ga0501083_0141015
732 Ga0501035_0002544
733 Ga0501035_0002764
734 Ga0501044_0000568
735 Ga0501044_0003950
736 Ga0501044_0041151
737 Ga0501045_0089321
738 nmdc:mga0a205_1629_c2
739 Ga0495601_0000042
740 Ga0495601_0000296
741 Ga0495601_0118870
742 Ga0495612_0005189
743 Ga0495655_0000009
744 Ga0495595_0000005
745 Ga0495595_0000362
746 Ga0495595_0053699
747 Ga0495619_0000040
748 Ga0495619_0000060
749 Ga0495619_0000126
750 Ga0495619_0000896
751 Ga0495619_0001321
752 Ga0495619_0002266
753 Ga0500643_022356
754 Ga0500641_0002279
755 Ga0500614_000806
756 Ga0500628_000022
757 Ga0501082_0022029
758 Ga0466962_0009970
759 Ga0466962_0036103
760 2902795031

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00479

G6PD_N

Glucose-6-phosphate dehydrogenase, NAD binding domain

43

211

0.95

PF02781

G6PD_C

Glucose-6-phosphate dehydrogenase, C-terminal domain

213

489

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
8u2w-assembly1.cif.gz_A glucose-6-phosphate 1-dehydrogenase (g6pdh) from crithidia fasciculata (nadp bound) 0.7985 14 434
8fuy-assembly1.cif.gz_A glucose-6-phosphate 1-dehydrogenase (g6pdh) from crithidia fasciculata (citrate bound) 0.7935 14 434
8em2-assembly1.cif.gz_A cryo-em structure of the human gdh/6pgl endoplasmic bifunctional protein 0.7918 14 413
1dpg-assembly1.cif.gz_B glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides 0.7891 10 441
8fuy-assembly1.cif.gz_B glucose-6-phosphate 1-dehydrogenase (g6pdh) from crithidia fasciculata (citrate bound) 0.7872 14 434
ID Description Score Start End Superfamily
af_P9WN71_8_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9716 11 172 3.40.50.720
af_P9WN71_8_168_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9657 11 172 3.40.50.720
af_P0AC53_13_173_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9545 17 170 3.40.50.720
af_P9WN73_32_206_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9364 17 175 3.40.50.720
af_P0AC53_13_173_3.40.50.720 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain 0.9089 17 170 3.40.50.720
ID Description Score Start End GO Terms
AF-A0A6N9V909-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9857 213 328 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-X0XSA7-F1-model_v4 Glucose-6-phosphate dehydrogenase C-terminal domain-containing protein 0.9811 143 320 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A812TZ78-F1-model_v4 deleted 0.9805 8 115
AF-A0A659UKS1-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9795 198 311 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661
AF-A0A7W0T9B9-F1-model_v4 Glucose-6-phosphate dehydrogenase 0.9785 10 202 GO:0004345
GO:0005829
GO:0006006
GO:0009051
GO:0050661

Map