F428724
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 380 | 230 | 760 | 463 |
Family's Representative Sequence
| Representative Sequence | 3300037853|Ga0436364_0059440|Ga0436364_0059440_4998_6476 |
| Length | 492 |
| Sequence | VIAEQTAPAATTIMMMGRGYRSAAEEGSRMVSDGSNNAADLMVIFGITGDLARKMTLRALYRLECRKLLDCPILGVASRQRSDDELLQFARQSVSGSGEKIDEDVFNRLTSRLSYIFGDVTGDFLYTQLAERVRAHHRPLYYLETPPSLFGPIVQHLGKAQLVTNARVAVEKPFGYDLHSARELDAQLHQVLREDQILRVDHFLGKEPVMELEYLRFANLALAEIWDRKSISAVQITMAEDFGVEDRGRFYDPVGALRDVVQNHLLQVLALVAMEPPASASAEELQDKKAEVFRAMPTADPRRYVRGQYEGYLDVPGVAPGSTTETFVALQLEIDNWRWAGVPIFLRAGKELPHHVTEVRLLLRPTPRLAFLPHPTEVDPNQIVLRIDPDSGLRLQIITRSNDSWRSVHLDTLFRQELGEPWEPYERVLHAALVGDHQLFARQDSIEETWRIVQPLLDNPPAVQSYQRGSWGPPVAESFCGQYHWQQPWLAK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 4 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 7 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 8 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 19 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 26 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 31 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 32 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 33 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 34 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 35 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 36 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 37 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 38 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 39 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 40 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 42 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 43 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 44 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 45 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 46 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 47 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 48 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 49 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 50 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 51 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 52 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 53 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 54 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 55 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 56 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 57 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 58 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 59 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 60 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 61 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 62 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 63 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 64 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 65 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 66 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 67 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 68 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 69 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 70 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 71 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 72 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 73 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 74 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 76 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 77 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 79 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 81 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 82 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 83 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 84 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 90 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 97 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 108 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 109 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 110 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 111 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 112 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 113 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 114 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 115 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 116 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 117 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 118 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 119 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 120 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 121 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 122 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 123 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 124 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 125 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 126 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 127 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 128 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 129 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 130 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 131 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 132 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 133 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 134 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 135 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 136 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 137 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 138 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 139 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 140 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 141 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 142 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 143 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 144 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 145 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 146 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 147 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 148 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 149 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 150 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 151 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 152 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 153 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 154 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 155 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 156 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 157 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 158 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 159 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 160 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 161 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 162 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 163 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 164 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 165 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 166 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 167 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 168 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 169 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 170 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 171 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 172 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 173 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 174 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 175 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 176 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 177 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 178 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 179 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 180 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 181 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 182 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 183 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 184 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 185 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 186 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 187 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 188 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 189 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 190 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 191 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 192 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 193 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 194 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 195 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 196 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 197 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 198 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 199 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 200 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 201 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 202 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 203 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 204 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 205 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 206 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 207 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 208 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 209 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 210 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 211 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 212 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 213 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 214 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 215 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 216 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 217 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 218 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 219 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 220 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 221 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 222 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 223 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 224 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 225 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 226 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 227 | 3300053129 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere | Metagenome | Endosphere |
| 228 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 229 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 230 | 2902792274 | Mycolicibacterium sp. P9-64 | Isolate | Unclassified |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.95 |
| Metatranscriptomes | 0.79 |
| Isolates | 0.26 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.58 |
| Nodule | 0 |
| Rhizoplane | 12.11 |
| Rhizosphere | 78.95 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0436364_0059440 | 3300037853 | Bacteria | 78275 |
| 2 | JGI24740J21852_10000270 | 3300001979 | Bacteria | 21884 |
| 3 | rootH2_10001145 | 3300003320 | Bacteria | 2642 |
| 4 | JGI25404J52841_10003708 | 3300003659 | Bacteria | 3039 |
| 5 | Ga0070683_100000226 | 3300005329 | Bacteria | 38469 |
| 6 | Ga0070683_100001131 | 3300005329 | Bacteria | 20182 |
| 7 | Ga0070683_100002346 | 3300005329 | Bacteria | 15022 |
| 8 | Ga0070683_100009632 | 3300005329 | Bacteria | 8268 |
| 9 | Ga0070690_100044430 | 3300005330 | Bacteria | 2820 |
| 10 | Ga0070677_10000007 | 3300005333 | Bacteria | 74721 |
| 11 | Ga0070666_10151379 | 3300005335 | Bacteria | 1618 |
| 12 | Ga0070682_100000038 | 3300005337 | Bacteria | 145670 |
| 13 | Ga0070682_100000072 | 3300005337 | Bacteria | 93808 |
| 14 | Ga0070689_100070671 | 3300005340 | Bacteria | 2726 |
| 15 | Ga0070661_100000204 | 3300005344 | Bacteria | 49187 |
| 16 | Ga0070668_100026362 | 3300005347 | Bacteria | 4410 |
| 17 | Ga0070675_100000008 | 3300005354 | Bacteria | 250004 |
| 18 | Ga0070674_100000001 | 3300005356 | Bacteria | 277173 |
| 19 | Ga0070688_100000018 | 3300005365 | Bacteria | 72357 |
| 20 | Ga0070688_100000364 | 3300005365 | Bacteria | 22986 |
| 21 | Ga0070659_100147564 | 3300005366 | Bacteria | 1917 |
| 22 | Ga0070667_100001736 | 3300005367 | Bacteria | 19468 |
| 23 | Ga0070667_100029164 | 3300005367 | Bacteria | 4595 |
| 24 | Ga0070713_100000061 | 3300005436 | Bacteria | 68662 |
| 25 | Ga0070663_100000274 | 3300005455 | Bacteria | 25997 |
| 26 | Ga0070681_10059721 | 3300005458 | Bacteria | 3792 |
| 27 | Ga0070685_10000114 | 3300005466 | Bacteria | 51524 |
| 28 | Ga0070685_10000437 | 3300005466 | Bacteria | 24303 |
| 29 | Ga0070698_100009101 | 3300005471 | Bacteria | 10669 |
| 30 | Ga0070699_100023765 | 3300005518 | Bacteria | 5281 |
| 31 | Ga0070684_100000718 | 3300005535 | Bacteria | 22923 |
| 32 | Ga0070684_100135763 | 3300005535 | Bacteria | 2222 |
| 33 | Ga0068853_100005229 | 3300005539 | Bacteria | 10153 |
| 34 | Ga0068853_100206359 | 3300005539 | Bacteria | 1790 |
| 35 | Ga0070672_100000018 | 3300005543 | Bacteria | 70205 |
| 36 | Ga0070665_100000306 | 3300005548 | Bacteria | 76666 |
| 37 | Ga0070665_100002847 | 3300005548 | Bacteria | 18730 |
| 38 | Ga0070665_100130582 | 3300005548 | Bacteria | 2514 |
| 39 | Ga0070704_100168095 | 3300005549 | Bacteria | 1741 |
| 40 | Ga0070664_100003303 | 3300005564 | Bacteria | 13030 |
| 41 | Ga0070664_100045649 | 3300005564 | Bacteria | 3701 |
| 42 | Ga0070664_100113001 | 3300005564 | Bacteria | 2372 |
| 43 | Ga0068857_100005813 | 3300005577 | Bacteria | 10541 |
| 44 | Ga0068854_100000044 | 3300005578 | Bacteria | 91882 |
| 45 | Ga0068854_100037363 | 3300005578 | Bacteria | 3408 |
| 46 | Ga0068852_100000050 | 3300005616 | Bacteria | 84306 |
| 47 | Ga0068852_100045197 | 3300005616 | Bacteria | 3744 |
| 48 | Ga0068866_10000055 | 3300005718 | Bacteria | 44369 |
| 49 | Ga0068866_10001565 | 3300005718 | Bacteria | 9730 |
| 50 | Ga0068851_10000922 | 3300005834 | Bacteria | 12681 |
| 51 | Ga0068863_100000039 | 3300005841 | Bacteria | 161450 |
| 52 | Ga0068863_100018638 | 3300005841 | Bacteria | 6640 |
| 53 | Ga0068863_100071809 | 3300005841 | Bacteria | 3275 |
| 54 | Ga0068858_100000178 | 3300005842 | Bacteria | 67760 |
| 55 | Ga0081455_10018222 | 3300005937 | Bacteria | 6699 |
| 56 | Ga0081540_1000044 | 3300005983 | Bacteria | 134269 |
| 57 | Ga0081540_1006561 | 3300005983 | Bacteria | 8445 |
| 58 | Ga0081540_1055814 | 3300005983 | Bacteria | 1921 |
| 59 | Ga0081539_10003996 | 3300005985 | Bacteria | 17009 |
| 60 | Ga0070712_100007600 | 3300006175 | Bacteria | 6773 |
| 61 | Ga0075369_10012311 | 3300006186 | Bacteria | 3380 |
| 62 | Ga0097621_100230145 | 3300006237 | Bacteria | 1618 |
| 63 | Ga0075370_10006024 | 3300006353 | Bacteria | 6074 |
| 64 | Ga0075433_10002113 | 3300006852 | Bacteria | 15055 |
| 65 | Ga0075434_100191540 | 3300006871 | Bacteria | 2065 |
| 66 | Ga0068865_100000019 | 3300006881 | Bacteria | 105996 |
| 67 | Ga0099795_10006880 | 3300007788 | Bacteria | 3133 |
| 68 | Ga0105240_10261867 | 3300009093 | Bacteria | 1994 |
| 69 | Ga0105245_10000012 | 3300009098 | Bacteria | 267151 |
| 70 | Ga0105245_10000049 | 3300009098 | Bacteria | 128277 |
| 71 | Ga0105245_10000508 | 3300009098 | Bacteria | 35724 |
| 72 | Ga0105247_10000109 | 3300009101 | Bacteria | 84490 |
| 73 | Ga0105241_10063354 | 3300009174 | Bacteria | 2852 |
| 74 | Ga0105241_10107326 | 3300009174 | Bacteria | 2230 |
| 75 | Ga0105242_10000403 | 3300009176 | Bacteria | 34337 |
| 76 | Ga0105242_10001375 | 3300009176 | Bacteria | 19173 |
| 77 | Ga0105242_10072294 | 3300009176 | Bacteria | 2864 |
| 78 | Ga0105248_10000267 | 3300009177 | Bacteria | 61244 |
| 79 | Ga0105249_10000039 | 3300009553 | Bacteria | 196325 |
| 80 | Ga0105249_10046930 | 3300009553 | Bacteria | 3933 |
| 81 | Ga0105239_10016740 | 3300010375 | Bacteria | 8104 |
| 82 | Ga0105239_10140138 | 3300010375 | Bacteria | 2694 |
| 83 | Ga0105246_10024015 | 3300011119 | Bacteria | 3953 |
| 84 | Ga0157370_10017447 | 3300013104 | Bacteria | 7242 |
| 85 | Ga0157370_10114450 | 3300013104 | Bacteria | 2520 |
| 86 | Ga0157369_10000135 | 3300013105 | Bacteria | 105364 |
| 87 | Ga0157372_10000128 | 3300013307 | Bacteria | 82571 |
| 88 | Ga0157375_10000942 | 3300013308 | Bacteria | 25237 |
| 89 | Ga0157380_10000009 | 3300014326 | Bacteria | 142155 |
| 90 | Ga0157380_10177763 | 3300014326 | Bacteria | 1867 |
| 91 | Ga0157379_10004635 | 3300014968 | Bacteria | 11797 |
| 92 | Ga0157379_10009692 | 3300014968 | Bacteria | 8386 |
| 93 | Ga0157376_10054696 | 3300014969 | Bacteria | 3329 |
| 94 | Ga0163161_10000013 | 3300017792 | Bacteria | 258747 |
| 95 | Ga0206350_10675713 | 3300020080 | Bacteria | 1500 |
| 96 | Ga0213876_10014606 | 3300021384 | Bacteria | 4161 |
| 97 | Ga0213875_10000140 | 3300021388 | Bacteria | 78573 |
| 98 | Ga0213875_10034905 | 3300021388 | Bacteria | 2374 |
| 99 | Ga0224712_10003634 | 3300022467 | Bacteria | 4043 |
| 100 | Ga0224712_10012258 | 3300022467 | Bacteria | 2690 |
| 101 | Ga0207656_10000153 | 3300025321 | Bacteria | 25555 |
| 102 | Ga0207682_10000007 | 3300025893 | Bacteria | 88967 |
| 103 | Ga0207642_10006378 | 3300025899 | Bacteria | 3918 |
| 104 | Ga0207710_10006138 | 3300025900 | Bacteria | 5144 |
| 105 | Ga0207710_10016361 | 3300025900 | Bacteria | 3137 |
| 106 | Ga0207680_10014289 | 3300025903 | Bacteria | 4104 |
| 107 | Ga0207647_10003815 | 3300025904 | Bacteria | 11266 |
| 108 | Ga0207699_10019264 | 3300025906 | Bacteria | 3635 |
| 109 | Ga0207643_10132053 | 3300025908 | Bacteria | 1486 |
| 110 | Ga0207695_10105717 | 3300025913 | Bacteria | 2802 |
| 111 | Ga0207671_10000589 | 3300025914 | Bacteria | 48540 |
| 112 | Ga0207649_10000005 | 3300025920 | Bacteria | 356179 |
| 113 | Ga0207652_10000138 | 3300025921 | Bacteria | 77564 |
| 114 | Ga0207652_10001090 | 3300025921 | Bacteria | 24590 |
| 115 | Ga0207646_10142704 | 3300025922 | Bacteria | 2157 |
| 116 | Ga0207694_10000008 | 3300025924 | Bacteria | 484902 |
| 117 | Ga0207694_10012306 | 3300025924 | Bacteria | 6450 |
| 118 | Ga0207659_10000014 | 3300025926 | Bacteria | 168481 |
| 119 | Ga0207687_10000011 | 3300025927 | Bacteria | 388349 |
| 120 | Ga0207687_10000012 | 3300025927 | Bacteria | 370729 |
| 121 | Ga0207687_10001866 | 3300025927 | Bacteria | 14507 |
| 122 | Ga0207700_10000016 | 3300025928 | Bacteria | 202434 |
| 123 | Ga0207690_10033814 | 3300025932 | Bacteria | 3290 |
| 124 | Ga0207686_10000029 | 3300025934 | Bacteria | 160239 |
| 125 | Ga0207686_10043464 | 3300025934 | Bacteria | 2753 |
| 126 | Ga0207669_10000002 | 3300025937 | Bacteria | 377651 |
| 127 | Ga0207704_10000009 | 3300025938 | Bacteria | 198266 |
| 128 | Ga0207691_10000121 | 3300025940 | Bacteria | 70558 |
| 129 | Ga0207711_10000024 | 3300025941 | Bacteria | 293596 |
| 130 | Ga0207661_10000068 | 3300025944 | Bacteria | 70953 |
| 131 | Ga0207661_10000925 | 3300025944 | Bacteria | 19251 |
| 132 | Ga0207661_10009099 | 3300025944 | Bacteria | 7118 |
| 133 | Ga0207679_10027004 | 3300025945 | Bacteria | 3966 |
| 134 | Ga0207679_10037921 | 3300025945 | Bacteria | 3430 |
| 135 | Ga0207712_10000003 | 3300025961 | Bacteria | 615314 |
| 136 | Ga0207668_10051934 | 3300025972 | Bacteria | 2834 |
| 137 | Ga0207640_10000517 | 3300025981 | Bacteria | 23263 |
| 138 | Ga0207640_10085166 | 3300025981 | Bacteria | 2173 |
| 139 | Ga0207658_10000708 | 3300025986 | Bacteria | 28881 |
| 140 | Ga0207658_10004459 | 3300025986 | Bacteria | 9728 |
| 141 | Ga0207677_10000671 | 3300026023 | Bacteria | 20346 |
| 142 | Ga0207703_10000381 | 3300026035 | Bacteria | 47426 |
| 143 | Ga0207639_10000838 | 3300026041 | Bacteria | 20868 |
| 144 | Ga0207678_10007383 | 3300026067 | Bacteria | 9730 |
| 145 | Ga0207702_10000099 | 3300026078 | Bacteria | 100461 |
| 146 | Ga0207702_10038750 | 3300026078 | Bacteria | 3992 |
| 147 | Ga0207641_10000065 | 3300026088 | Bacteria | 156066 |
| 148 | Ga0207641_10001058 | 3300026088 | Bacteria | 27805 |
| 149 | Ga0207641_10038257 | 3300026088 | Bacteria | 4010 |
| 150 | Ga0207674_10003494 | 3300026116 | Bacteria | 19188 |
| 151 | Ga0207698_10000009 | 3300026142 | Bacteria | 281300 |
| 152 | Ga0207698_10098548 | 3300026142 | Bacteria | 2416 |
| 153 | Ga0268266_10000023 | 3300028379 | Bacteria | 501899 |
| 154 | Ga0268266_10001333 | 3300028379 | Bacteria | 29934 |
| 155 | Ga0265319_1000091 | 3300028563 | Bacteria | 70394 |
| 156 | Ga0265338_10000752 | 3300028800 | Bacteria | 55238 |
| 157 | Ga0265325_10035447 | 3300031241 | Bacteria | 2650 |
| 158 | Ga0373937_0021125 | 3300036401 | Bacteria | 5842 |
| 159 | Ga0373925_0000167 | 3300037068 | Bacteria | 71153 |
| 160 | Ga0436364_0652113 | 3300037853 | Bacteria | 6236 |
| 161 | Ga0436364_1267366 | 3300037853 | Bacteria | 12866 |
| 162 | Ga0436365_0675851 | 3300039437 | Bacteria | 5616 |
| 163 | Ga0436365_1083994 | 3300039437 | Bacteria | 225582 |
| 164 | Ga0466969_0029812 | 3300044656 | Bacteria | 2783 |
| 165 | Ga0466966_0006122 | 3300044684 | Bacteria | 7949 |
| 166 | Ga0466966_0010021 | 3300044684 | Bacteria | 6279 |
| 167 | Ga0466961_0011260 | 3300044693 | Bacteria | 5719 |
| 168 | Ga0466963_0000025 | 3300044694 | Bacteria | 51171 |
| 169 | Ga0466963_0046846 | 3300044694 | Bacteria | 2852 |
| 170 | Ga0466971_0014271 | 3300044719 | Bacteria | 3493 |
| 171 | Ga0466957_0008376 | 3300044842 | Bacteria | 5881 |
| 172 | Ga0466957_0091838 | 3300044842 | Bacteria | 1903 |
| 173 | Ga0466959_0046934 | 3300045049 | Bacteria | 3178 |
| 174 | Ga0466958_0000656 | 3300045836 | Bacteria | 14946 |
| 175 | Ga0466967_0000123 | 3300045976 | Bacteria | 29223 |
| 176 | Ga0495592_0009439 | 3300046454 | Bacteria | 7335 |
| 177 | Ga0495592_0032740 | 3300046454 | Bacteria | 3920 |
| 178 | Ga0495592_0041788 | 3300046454 | Bacteria | 3435 |
| 179 | Ga0495592_0125127 | 3300046454 | Bacteria | 1805 |
| 180 | Ga0495603_0057891 | 3300046455 | Bacteria | 2292 |
| 181 | Ga0495629_0000377 | 3300046459 | Bacteria | 37247 |
| 182 | Ga0495629_0002409 | 3300046459 | Bacteria | 14397 |
| 183 | Ga0495629_0014026 | 3300046459 | Bacteria | 5775 |
| 184 | Ga0495638_0021853 | 3300046460 | Bacteria | 4206 |
| 185 | Ga0495641_0000095 | 3300046461 | Bacteria | 60441 |
| 186 | Ga0495641_0006400 | 3300046461 | Bacteria | 7638 |
| 187 | Ga0495641_0069210 | 3300046461 | Bacteria | 1586 |
| 188 | Ga0495651_0062105 | 3300046462 | Bacteria | 2859 |
| 189 | Ga0495653_0014053 | 3300046463 | Bacteria | 6529 |
| 190 | Ga0495582_0000082 | 3300046473 | Bacteria | 48118 |
| 191 | Ga0495662_0001723 | 3300046476 | Bacteria | 10927 |
| 192 | Ga0495662_0005396 | 3300046476 | Bacteria | 6399 |
| 193 | Ga0495594_0000345 | 3300046499 | Bacteria | 23182 |
| 194 | Ga0495583_0067400 | 3300046506 | Bacteria | 1581 |
| 195 | Ga0495606_0000294 | 3300046507 | Bacteria | 85998 |
| 196 | Ga0495606_0077890 | 3300046507 | Bacteria | 2069 |
| 197 | Ga0495608_0000010 | 3300046511 | Bacteria | 258660 |
| 198 | Ga0495608_0001938 | 3300046511 | Bacteria | 14858 |
| 199 | Ga0495610_0027067 | 3300046512 | Bacteria | 3054 |
| 200 | Ga0495618_0000097 | 3300046514 | Bacteria | 63474 |
| 201 | Ga0495618_0030365 | 3300046514 | Bacteria | 3375 |
| 202 | Ga0495620_0000158 | 3300046515 | Bacteria | 54704 |
| 203 | Ga0495620_0023507 | 3300046515 | Bacteria | 2945 |
| 204 | Ga0495628_0000048 | 3300046516 | Bacteria | 96944 |
| 205 | Ga0495628_0011205 | 3300046516 | Bacteria | 7586 |
| 206 | Ga0495628_0139987 | 3300046516 | Bacteria | 1847 |
| 207 | Ga0495630_0000011 | 3300046517 | Bacteria | 232063 |
| 208 | Ga0495630_0000082 | 3300046517 | Bacteria | 75280 |
| 209 | Ga0495630_0001301 | 3300046517 | Bacteria | 17211 |
| 210 | Ga0495630_0065590 | 3300046517 | Bacteria | 2729 |
| 211 | Ga0495644_0000404 | 3300046523 | Bacteria | 19389 |
| 212 | Ga0495648_0006564 | 3300046524 | Bacteria | 9463 |
| 213 | Ga0495652_0000003 | 3300046529 | Bacteria | 597094 |
| 214 | Ga0495652_0022143 | 3300046529 | Bacteria | 5643 |
| 215 | Ga0495652_0115779 | 3300046529 | Bacteria | 2147 |
| 216 | Ga0495586_0000234 | 3300046535 | Bacteria | 36813 |
| 217 | Ga0495587_0019204 | 3300046536 | Bacteria | 4234 |
| 218 | Ga0495645_0002167 | 3300046543 | Bacteria | 13338 |
| 219 | Ga0495645_0016538 | 3300046543 | Bacteria | 5270 |
| 220 | Ga0495622_0000124 | 3300046557 | Bacteria | 66518 |
| 221 | Ga0495634_0000092 | 3300046642 | Bacteria | 72088 |
| 222 | Ga0495634_0000616 | 3300046642 | Bacteria | 34537 |
| 223 | Ga0495634_0004570 | 3300046642 | Bacteria | 10809 |
| 224 | Ga0495611_0013683 | 3300046648 | Bacteria | 3458 |
| 225 | Ga0495625_0000095 | 3300046660 | Bacteria | 143468 |
| 226 | Ga0495635_0000006 | 3300046663 | Bacteria | 301820 |
| 227 | Ga0495588_0000218 | 3300046674 | Bacteria | 54328 |
| 228 | Ga0495657_0000005 | 3300046675 | Bacteria | 254860 |
| 229 | Ga0495657_0002455 | 3300046675 | Bacteria | 15608 |
| 230 | Ga0495599_0014659 | 3300046678 | Bacteria | 4855 |
| 231 | Ga0495647_0000010 | 3300046681 | Bacteria | 94696 |
| 232 | Ga0495647_0000111 | 3300046681 | Bacteria | 20557 |
| 233 | Ga0495647_0000938 | 3300046681 | Bacteria | 8769 |
| 234 | Ga0495658_0000070 | 3300046683 | Bacteria | 52450 |
| 235 | Ga0495658_0000965 | 3300046683 | Bacteria | 15281 |
| 236 | Ga0495669_0000072 | 3300046684 | Bacteria | 66900 |
| 237 | Ga0495669_0001896 | 3300046684 | Bacteria | 8575 |
| 238 | Ga0495613_0000092 | 3300046689 | Bacteria | 86976 |
| 239 | Ga0495613_0000131 | 3300046689 | Bacteria | 74262 |
| 240 | Ga0495624_0000049 | 3300046690 | Bacteria | 75485 |
| 241 | Ga0495624_0000455 | 3300046690 | Bacteria | 32215 |
| 242 | Ga0495624_0083212 | 3300046690 | Bacteria | 1979 |
| 243 | Ga0495649_0001406 | 3300046694 | Bacteria | 18177 |
| 244 | Ga0495600_0000893 | 3300046809 | Bacteria | 15969 |
| 245 | Ga0495600_0014621 | 3300046809 | Bacteria | 4948 |
| 246 | Ga0495600_0053095 | 3300046809 | Bacteria | 2647 |
| 247 | Ga0495604_0000038 | 3300047317 | Bacteria | 123703 |
| 248 | Ga0495604_0000078 | 3300047317 | Bacteria | 83632 |
| 249 | Ga0495604_0019608 | 3300047317 | Bacteria | 5412 |
| 250 | Ga0495604_0066763 | 3300047317 | Bacteria | 2735 |
| 251 | Ga0495674_0000063 | 3300047319 | Bacteria | 71737 |
| 252 | Ga0495672_0008193 | 3300047320 | Bacteria | 7751 |
| 253 | Ga0495676_0018845 | 3300047321 | Bacteria | 6083 |
| 254 | Ga0495680_0000050 | 3300047322 | Bacteria | 95945 |
| 255 | Ga0495680_0000873 | 3300047322 | Bacteria | 33510 |
| 256 | Ga0495675_0000004 | 3300047444 | Bacteria | 211049 |
| 257 | Ga0495673_0002889 | 3300047469 | Bacteria | 11664 |
| 258 | Ga0495686_0002214 | 3300047472 | Bacteria | 18881 |
| 259 | Ga0495602_0000009 | 3300048088 | Bacteria | 258991 |
| 260 | Ga0495602_0006848 | 3300048088 | Bacteria | 11970 |
| 261 | Ga0496100_0000004 | 3300048903 | Bacteria | 321778 |
| 262 | Ga0496100_0000032 | 3300048903 | Bacteria | 99877 |
| 263 | Ga0496100_0000592 | 3300048903 | Bacteria | 17134 |
| 264 | Ga0496101_0000007 | 3300048904 | Bacteria | 321778 |
| 265 | Ga0496101_0000012 | 3300048904 | Bacteria | 268127 |
| 266 | Ga0496101_0000021 | 3300048904 | Bacteria | 217090 |
| 267 | Ga0496102_0000001 | 3300048905 | Bacteria | 873433 |
| 268 | Ga0496102_0000132 | 3300048905 | Bacteria | 103176 |
| 269 | Ga0496102_0015854 | 3300048905 | Bacteria | 6571 |
| 270 | Ga0496103_0000007 | 3300048906 | Bacteria | 354915 |
| 271 | Ga0496103_0000077 | 3300048906 | Bacteria | 112223 |
| 272 | Ga0496104_0000002 | 3300048907 | Bacteria | 686017 |
| 273 | Ga0496104_0000003 | 3300048907 | Bacteria | 669219 |
| 274 | Ga0496104_0001440 | 3300048907 | Bacteria | 20567 |
| 275 | Ga0496104_0010316 | 3300048907 | Bacteria | 8341 |
| 276 | Ga0496105_0000001 | 3300048908 | Bacteria | 1328178 |
| 277 | Ga0496105_0000003 | 3300048908 | Bacteria | 713251 |
| 278 | Ga0496105_0000095 | 3300048908 | Bacteria | 60866 |
| 279 | Ga0496106_0000004 | 3300048909 | Bacteria | 279896 |
| 280 | Ga0496106_0000092 | 3300048909 | Bacteria | 70312 |
| 281 | Ga0496106_0000130 | 3300048909 | Bacteria | 57887 |
| 282 | Ga0496106_0005962 | 3300048909 | Bacteria | 9001 |
| 283 | Ga0496106_0154550 | 3300048909 | Bacteria | 1811 |
| 284 | Ga0496107_0000001 | 3300048910 | Bacteria | 321778 |
| 285 | Ga0496107_0000031 | 3300048910 | Bacteria | 100522 |
| 286 | Ga0496108_0000002 | 3300048911 | Bacteria | 700890 |
| 287 | Ga0496108_0000012 | 3300048911 | Bacteria | 258433 |
| 288 | Ga0496108_0000202 | 3300048911 | Bacteria | 55115 |
| 289 | Ga0496108_0003530 | 3300048911 | Bacteria | 12543 |
| 290 | Ga0496108_0014574 | 3300048911 | Bacteria | 6417 |
| 291 | Ga0496109_0000001 | 3300048912 | Bacteria | 700852 |
| 292 | Ga0496109_0000076 | 3300048912 | Bacteria | 104273 |
| 293 | Ga0496109_0000106 | 3300048912 | Bacteria | 86550 |
| 294 | Ga0496109_0000131 | 3300048912 | Bacteria | 76860 |
| 295 | Ga0496109_0150382 | 3300048912 | Bacteria | 2180 |
| 296 | Ga0496110_0000015 | 3300048913 | Bacteria | 85373 |
| 297 | Ga0496111_0000001 | 3300048914 | Bacteria | 194837 |
| 298 | Ga0496111_0034952 | 3300048914 | Bacteria | 3590 |
| 299 | Ga0496112_0000250 | 3300048915 | Bacteria | 34271 |
| 300 | Ga0496113_0000039 | 3300048916 | Bacteria | 55926 |
| 301 | Ga0496113_0011190 | 3300048916 | Bacteria | 5971 |
| 302 | Ga0496114_0000003 | 3300048917 | Bacteria | 630981 |
| 303 | Ga0496114_0016978 | 3300048917 | Bacteria | 5870 |
| 304 | Ga0496114_0063654 | 3300048917 | Bacteria | 3088 |
| 305 | Ga0496115_0000071 | 3300048918 | Bacteria | 91922 |
| 306 | Ga0496115_0000183 | 3300048918 | Bacteria | 58406 |
| 307 | Ga0496116_0000018 | 3300048919 | Bacteria | 545877 |
| 308 | Ga0496116_0001727 | 3300048919 | Bacteria | 23857 |
| 309 | Ga0496117_0000015 | 3300048920 | Bacteria | 583316 |
| 310 | Ga0496117_0003031 | 3300048920 | Bacteria | 20148 |
| 311 | Ga0496118_0000012 | 3300048921 | Bacteria | 583316 |
| 312 | Ga0496118_0003573 | 3300048921 | Bacteria | 19378 |
| 313 | Ga0496119_0001610 | 3300048922 | Bacteria | 26733 |
| 314 | Ga0496119_0007872 | 3300048922 | Bacteria | 9487 |
| 315 | Ga0496119_0011161 | 3300048922 | Bacteria | 7481 |
| 316 | Ga0496120_0000195 | 3300048923 | Bacteria | 104031 |
| 317 | Ga0496120_0002973 | 3300048923 | Bacteria | 16134 |
| 318 | Ga0496121_0000809 | 3300048924 | Bacteria | 56983 |
| 319 | Ga0496121_0020618 | 3300048924 | Bacteria | 6510 |
| 320 | Ga0496124_0079803 | 3300048927 | Bacteria | 2694 |
| 321 | Ga0496126_0000906 | 3300048929 | Bacteria | 51430 |
| 322 | Ga0496126_0006739 | 3300048929 | Bacteria | 12750 |
| 323 | Ga0496126_0009868 | 3300048929 | Bacteria | 10103 |
| 324 | Ga0496126_0262888 | 3300048929 | Bacteria | 1434 |
| 325 | Ga0501031_0001843 | 3300049568 | Bacteria | 13331 |
| 326 | Ga0501032_0006154 | 3300049569 | Bacteria | 8832 |
| 327 | Ga0501033_0006846 | 3300049570 | Bacteria | 8897 |
| 328 | Ga0501034_0009884 | 3300049571 | Bacteria | 9972 |
| 329 | Ga0501036_0007038 | 3300049572 | Bacteria | 9151 |
| 330 | Ga0501037_0006130 | 3300049573 | Bacteria | 8782 |
| 331 | Ga0501038_0004258 | 3300049574 | Bacteria | 13302 |
| 332 | Ga0501039_0087983 | 3300049575 | Bacteria | 2420 |
| 333 | Ga0501040_0098105 | 3300049576 | Bacteria | 2042 |
| 334 | Ga0501043_0007126 | 3300049579 | Bacteria | 8895 |
| 335 | Ga0501046_0004639 | 3300049580 | Bacteria | 12413 |
| 336 | Ga0501047_0002598 | 3300049581 | Bacteria | 17193 |
| 337 | Ga0501047_0012226 | 3300049581 | Bacteria | 8128 |
| 338 | Ga0501047_0065722 | 3300049581 | Bacteria | 3496 |
| 339 | Ga0501048_0002831 | 3300049582 | Bacteria | 13243 |
| 340 | Ga0501070_0002436 | 3300049586 | Bacteria | 16316 |
| 341 | Ga0501070_0162383 | 3300049586 | Bacteria | 1841 |
| 342 | Ga0501071_0012097 | 3300049587 | Bacteria | 5836 |
| 343 | Ga0501073_0007567 | 3300049589 | Bacteria | 8070 |
| 344 | Ga0501074_0006028 | 3300049590 | Bacteria | 8750 |
| 345 | Ga0501074_0049020 | 3300049590 | Bacteria | 3050 |
| 346 | Ga0501075_0092048 | 3300049591 | Bacteria | 2301 |
| 347 | Ga0501079_0008842 | 3300049741 | Bacteria | 7626 |
| 348 | Ga0501080_0030272 | 3300049742 | Bacteria | 5043 |
| 349 | Ga0501080_0082030 | 3300049742 | Bacteria | 2995 |
| 350 | Ga0501083_0005791 | 3300049744 | Bacteria | 8752 |
| 351 | Ga0501083_0141015 | 3300049744 | Bacteria | 1578 |
| 352 | Ga0501035_0002544 | 3300049822 | Bacteria | 17838 |
| 353 | Ga0501035_0002764 | 3300049822 | Bacteria | 17017 |
| 354 | Ga0501044_0000568 | 3300049823 | Bacteria | 44963 |
| 355 | Ga0501044_0003950 | 3300049823 | Bacteria | 16609 |
| 356 | Ga0501044_0041151 | 3300049823 | Bacteria | 4811 |
| 357 | Ga0501045_0089321 | 3300049824 | Bacteria | 2276 |
| 358 | nmdc:mga0a205_1629_c2 | 3300050515 | Bacteria | 15476 |
| 359 | Ga0495601_0000042 | 3300053077 | Bacteria | 77373 |
| 360 | Ga0495601_0000296 | 3300053077 | Bacteria | 26491 |
| 361 | Ga0495601_0118870 | 3300053077 | Bacteria | 1715 |
| 362 | Ga0495612_0005189 | 3300053078 | Bacteria | 5384 |
| 363 | Ga0495655_0000009 | 3300053083 | Bacteria | 150662 |
| 364 | Ga0495595_0000005 | 3300053084 | Bacteria | 258660 |
| 365 | Ga0495595_0000362 | 3300053084 | Bacteria | 17220 |
| 366 | Ga0495595_0053699 | 3300053084 | Bacteria | 1873 |
| 367 | Ga0495619_0000040 | 3300053085 | Bacteria | 118238 |
| 368 | Ga0495619_0000060 | 3300053085 | Bacteria | 89377 |
| 369 | Ga0495619_0000126 | 3300053085 | Bacteria | 56169 |
| 370 | Ga0495619_0000896 | 3300053085 | Bacteria | 19523 |
| 371 | Ga0495619_0001321 | 3300053085 | Bacteria | 16261 |
| 372 | Ga0495619_0002266 | 3300053085 | Bacteria | 12712 |
| 373 | Ga0500643_022356 | 3300053087 | Bacteria | 2036 |
| 374 | Ga0500641_0002279 | 3300053096 | Bacteria | 6808 |
| 375 | Ga0500614_000806 | 3300053123 | Bacteria | 7940 |
| 376 | Ga0500628_000022 | 3300053129 | Bacteria | 77990 |
| 377 | Ga0501082_0022029 | 3300060353 | Bacteria | 5494 |
| 378 | Ga0466962_0009970 | 3300061719 | Bacteria | 4556 |
| 379 | Ga0466962_0036103 | 3300061719 | Bacteria | 2365 |
| 380 | 2902795031 | 2902792274 | Bacteria | 7270173 |
| 381 | Ga0436364_0059440 | |||
| 382 | JGI24740J21852_10000270 | |||
| 383 | rootH2_10001145 | |||
| 384 | JGI25404J52841_10003708 | |||
| 385 | Ga0070683_100000226 | |||
| 386 | Ga0070683_100001131 | |||
| 387 | Ga0070683_100002346 | |||
| 388 | Ga0070683_100009632 | |||
| 389 | Ga0070690_100044430 | |||
| 390 | Ga0070677_10000007 | |||
| 391 | Ga0070666_10151379 | |||
| 392 | Ga0070682_100000038 | |||
| 393 | Ga0070682_100000072 | |||
| 394 | Ga0070689_100070671 | |||
| 395 | Ga0070661_100000204 | |||
| 396 | Ga0070668_100026362 | |||
| 397 | Ga0070675_100000008 | |||
| 398 | Ga0070674_100000001 | |||
| 399 | Ga0070688_100000018 | |||
| 400 | Ga0070688_100000364 | |||
| 401 | Ga0070659_100147564 | |||
| 402 | Ga0070667_100001736 | |||
| 403 | Ga0070667_100029164 | |||
| 404 | Ga0070713_100000061 | |||
| 405 | Ga0070663_100000274 | |||
| 406 | Ga0070681_10059721 | |||
| 407 | Ga0070685_10000114 | |||
| 408 | Ga0070685_10000437 | |||
| 409 | Ga0070698_100009101 | |||
| 410 | Ga0070699_100023765 | |||
| 411 | Ga0070684_100000718 | |||
| 412 | Ga0070684_100135763 | |||
| 413 | Ga0068853_100005229 | |||
| 414 | Ga0068853_100206359 | |||
| 415 | Ga0070672_100000018 | |||
| 416 | Ga0070665_100000306 | |||
| 417 | Ga0070665_100002847 | |||
| 418 | Ga0070665_100130582 | |||
| 419 | Ga0070704_100168095 | |||
| 420 | Ga0070664_100003303 | |||
| 421 | Ga0070664_100045649 | |||
| 422 | Ga0070664_100113001 | |||
| 423 | Ga0068857_100005813 | |||
| 424 | Ga0068854_100000044 | |||
| 425 | Ga0068854_100037363 | |||
| 426 | Ga0068852_100000050 | |||
| 427 | Ga0068852_100045197 | |||
| 428 | Ga0068866_10000055 | |||
| 429 | Ga0068866_10001565 | |||
| 430 | Ga0068851_10000922 | |||
| 431 | Ga0068863_100000039 | |||
| 432 | Ga0068863_100018638 | |||
| 433 | Ga0068863_100071809 | |||
| 434 | Ga0068858_100000178 | |||
| 435 | Ga0081455_10018222 | |||
| 436 | Ga0081540_1000044 | |||
| 437 | Ga0081540_1006561 | |||
| 438 | Ga0081540_1055814 | |||
| 439 | Ga0081539_10003996 | |||
| 440 | Ga0070712_100007600 | |||
| 441 | Ga0075369_10012311 | |||
| 442 | Ga0097621_100230145 | |||
| 443 | Ga0075370_10006024 | |||
| 444 | Ga0075433_10002113 | |||
| 445 | Ga0075434_100191540 | |||
| 446 | Ga0068865_100000019 | |||
| 447 | Ga0099795_10006880 | |||
| 448 | Ga0105240_10261867 | |||
| 449 | Ga0105245_10000012 | |||
| 450 | Ga0105245_10000049 | |||
| 451 | Ga0105245_10000508 | |||
| 452 | Ga0105247_10000109 | |||
| 453 | Ga0105241_10063354 | |||
| 454 | Ga0105241_10107326 | |||
| 455 | Ga0105242_10000403 | |||
| 456 | Ga0105242_10001375 | |||
| 457 | Ga0105242_10072294 | |||
| 458 | Ga0105248_10000267 | |||
| 459 | Ga0105249_10000039 | |||
| 460 | Ga0105249_10046930 | |||
| 461 | Ga0105239_10016740 | |||
| 462 | Ga0105239_10140138 | |||
| 463 | Ga0105246_10024015 | |||
| 464 | Ga0157370_10017447 | |||
| 465 | Ga0157370_10114450 | |||
| 466 | Ga0157369_10000135 | |||
| 467 | Ga0157372_10000128 | |||
| 468 | Ga0157375_10000942 | |||
| 469 | Ga0157380_10000009 | |||
| 470 | Ga0157380_10177763 | |||
| 471 | Ga0157379_10004635 | |||
| 472 | Ga0157379_10009692 | |||
| 473 | Ga0157376_10054696 | |||
| 474 | Ga0163161_10000013 | |||
| 475 | Ga0206350_10675713 | |||
| 476 | Ga0213876_10014606 | |||
| 477 | Ga0213875_10000140 | |||
| 478 | Ga0213875_10034905 | |||
| 479 | Ga0224712_10003634 | |||
| 480 | Ga0224712_10012258 | |||
| 481 | Ga0207656_10000153 | |||
| 482 | Ga0207682_10000007 | |||
| 483 | Ga0207642_10006378 | |||
| 484 | Ga0207710_10006138 | |||
| 485 | Ga0207710_10016361 | |||
| 486 | Ga0207680_10014289 | |||
| 487 | Ga0207647_10003815 | |||
| 488 | Ga0207699_10019264 | |||
| 489 | Ga0207643_10132053 | |||
| 490 | Ga0207695_10105717 | |||
| 491 | Ga0207671_10000589 | |||
| 492 | Ga0207649_10000005 | |||
| 493 | Ga0207652_10000138 | |||
| 494 | Ga0207652_10001090 | |||
| 495 | Ga0207646_10142704 | |||
| 496 | Ga0207694_10000008 | |||
| 497 | Ga0207694_10012306 | |||
| 498 | Ga0207659_10000014 | |||
| 499 | Ga0207687_10000011 | |||
| 500 | Ga0207687_10000012 | |||
| 501 | Ga0207687_10001866 | |||
| 502 | Ga0207700_10000016 | |||
| 503 | Ga0207690_10033814 | |||
| 504 | Ga0207686_10000029 | |||
| 505 | Ga0207686_10043464 | |||
| 506 | Ga0207669_10000002 | |||
| 507 | Ga0207704_10000009 | |||
| 508 | Ga0207691_10000121 | |||
| 509 | Ga0207711_10000024 | |||
| 510 | Ga0207661_10000068 | |||
| 511 | Ga0207661_10000925 | |||
| 512 | Ga0207661_10009099 | |||
| 513 | Ga0207679_10027004 | |||
| 514 | Ga0207679_10037921 | |||
| 515 | Ga0207712_10000003 | |||
| 516 | Ga0207668_10051934 | |||
| 517 | Ga0207640_10000517 | |||
| 518 | Ga0207640_10085166 | |||
| 519 | Ga0207658_10000708 | |||
| 520 | Ga0207658_10004459 | |||
| 521 | Ga0207677_10000671 | |||
| 522 | Ga0207703_10000381 | |||
| 523 | Ga0207639_10000838 | |||
| 524 | Ga0207678_10007383 | |||
| 525 | Ga0207702_10000099 | |||
| 526 | Ga0207702_10038750 | |||
| 527 | Ga0207641_10000065 | |||
| 528 | Ga0207641_10001058 | |||
| 529 | Ga0207641_10038257 | |||
| 530 | Ga0207674_10003494 | |||
| 531 | Ga0207698_10000009 | |||
| 532 | Ga0207698_10098548 | |||
| 533 | Ga0268266_10000023 | |||
| 534 | Ga0268266_10001333 | |||
| 535 | Ga0265319_1000091 | |||
| 536 | Ga0265338_10000752 | |||
| 537 | Ga0265325_10035447 | |||
| 538 | Ga0373937_0021125 | |||
| 539 | Ga0373925_0000167 | |||
| 540 | Ga0436364_0652113 | |||
| 541 | Ga0436364_1267366 | |||
| 542 | Ga0436365_0675851 | |||
| 543 | Ga0436365_1083994 | |||
| 544 | Ga0466969_0029812 | |||
| 545 | Ga0466966_0006122 | |||
| 546 | Ga0466966_0010021 | |||
| 547 | Ga0466961_0011260 | |||
| 548 | Ga0466963_0000025 | |||
| 549 | Ga0466963_0046846 | |||
| 550 | Ga0466971_0014271 | |||
| 551 | Ga0466957_0008376 | |||
| 552 | Ga0466957_0091838 | |||
| 553 | Ga0466959_0046934 | |||
| 554 | Ga0466958_0000656 | |||
| 555 | Ga0466967_0000123 | |||
| 556 | Ga0495592_0009439 | |||
| 557 | Ga0495592_0032740 | |||
| 558 | Ga0495592_0041788 | |||
| 559 | Ga0495592_0125127 | |||
| 560 | Ga0495603_0057891 | |||
| 561 | Ga0495629_0000377 | |||
| 562 | Ga0495629_0002409 | |||
| 563 | Ga0495629_0014026 | |||
| 564 | Ga0495638_0021853 | |||
| 565 | Ga0495641_0000095 | |||
| 566 | Ga0495641_0006400 | |||
| 567 | Ga0495641_0069210 | |||
| 568 | Ga0495651_0062105 | |||
| 569 | Ga0495653_0014053 | |||
| 570 | Ga0495582_0000082 | |||
| 571 | Ga0495662_0001723 | |||
| 572 | Ga0495662_0005396 | |||
| 573 | Ga0495594_0000345 | |||
| 574 | Ga0495583_0067400 | |||
| 575 | Ga0495606_0000294 | |||
| 576 | Ga0495606_0077890 | |||
| 577 | Ga0495608_0000010 | |||
| 578 | Ga0495608_0001938 | |||
| 579 | Ga0495610_0027067 | |||
| 580 | Ga0495618_0000097 | |||
| 581 | Ga0495618_0030365 | |||
| 582 | Ga0495620_0000158 | |||
| 583 | Ga0495620_0023507 | |||
| 584 | Ga0495628_0000048 | |||
| 585 | Ga0495628_0011205 | |||
| 586 | Ga0495628_0139987 | |||
| 587 | Ga0495630_0000011 | |||
| 588 | Ga0495630_0000082 | |||
| 589 | Ga0495630_0001301 | |||
| 590 | Ga0495630_0065590 | |||
| 591 | Ga0495644_0000404 | |||
| 592 | Ga0495648_0006564 | |||
| 593 | Ga0495652_0000003 | |||
| 594 | Ga0495652_0022143 | |||
| 595 | Ga0495652_0115779 | |||
| 596 | Ga0495586_0000234 | |||
| 597 | Ga0495587_0019204 | |||
| 598 | Ga0495645_0002167 | |||
| 599 | Ga0495645_0016538 | |||
| 600 | Ga0495622_0000124 | |||
| 601 | Ga0495634_0000092 | |||
| 602 | Ga0495634_0000616 | |||
| 603 | Ga0495634_0004570 | |||
| 604 | Ga0495611_0013683 | |||
| 605 | Ga0495625_0000095 | |||
| 606 | Ga0495635_0000006 | |||
| 607 | Ga0495588_0000218 | |||
| 608 | Ga0495657_0000005 | |||
| 609 | Ga0495657_0002455 | |||
| 610 | Ga0495599_0014659 | |||
| 611 | Ga0495647_0000010 | |||
| 612 | Ga0495647_0000111 | |||
| 613 | Ga0495647_0000938 | |||
| 614 | Ga0495658_0000070 | |||
| 615 | Ga0495658_0000965 | |||
| 616 | Ga0495669_0000072 | |||
| 617 | Ga0495669_0001896 | |||
| 618 | Ga0495613_0000092 | |||
| 619 | Ga0495613_0000131 | |||
| 620 | Ga0495624_0000049 | |||
| 621 | Ga0495624_0000455 | |||
| 622 | Ga0495624_0083212 | |||
| 623 | Ga0495649_0001406 | |||
| 624 | Ga0495600_0000893 | |||
| 625 | Ga0495600_0014621 | |||
| 626 | Ga0495600_0053095 | |||
| 627 | Ga0495604_0000038 | |||
| 628 | Ga0495604_0000078 | |||
| 629 | Ga0495604_0019608 | |||
| 630 | Ga0495604_0066763 | |||
| 631 | Ga0495674_0000063 | |||
| 632 | Ga0495672_0008193 | |||
| 633 | Ga0495676_0018845 | |||
| 634 | Ga0495680_0000050 | |||
| 635 | Ga0495680_0000873 | |||
| 636 | Ga0495675_0000004 | |||
| 637 | Ga0495673_0002889 | |||
| 638 | Ga0495686_0002214 | |||
| 639 | Ga0495602_0000009 | |||
| 640 | Ga0495602_0006848 | |||
| 641 | Ga0496100_0000004 | |||
| 642 | Ga0496100_0000032 | |||
| 643 | Ga0496100_0000592 | |||
| 644 | Ga0496101_0000007 | |||
| 645 | Ga0496101_0000012 | |||
| 646 | Ga0496101_0000021 | |||
| 647 | Ga0496102_0000001 | |||
| 648 | Ga0496102_0000132 | |||
| 649 | Ga0496102_0015854 | |||
| 650 | Ga0496103_0000007 | |||
| 651 | Ga0496103_0000077 | |||
| 652 | Ga0496104_0000002 | |||
| 653 | Ga0496104_0000003 | |||
| 654 | Ga0496104_0001440 | |||
| 655 | Ga0496104_0010316 | |||
| 656 | Ga0496105_0000001 | |||
| 657 | Ga0496105_0000003 | |||
| 658 | Ga0496105_0000095 | |||
| 659 | Ga0496106_0000004 | |||
| 660 | Ga0496106_0000092 | |||
| 661 | Ga0496106_0000130 | |||
| 662 | Ga0496106_0005962 | |||
| 663 | Ga0496106_0154550 | |||
| 664 | Ga0496107_0000001 | |||
| 665 | Ga0496107_0000031 | |||
| 666 | Ga0496108_0000002 | |||
| 667 | Ga0496108_0000012 | |||
| 668 | Ga0496108_0000202 | |||
| 669 | Ga0496108_0003530 | |||
| 670 | Ga0496108_0014574 | |||
| 671 | Ga0496109_0000001 | |||
| 672 | Ga0496109_0000076 | |||
| 673 | Ga0496109_0000106 | |||
| 674 | Ga0496109_0000131 | |||
| 675 | Ga0496109_0150382 | |||
| 676 | Ga0496110_0000015 | |||
| 677 | Ga0496111_0000001 | |||
| 678 | Ga0496111_0034952 | |||
| 679 | Ga0496112_0000250 | |||
| 680 | Ga0496113_0000039 | |||
| 681 | Ga0496113_0011190 | |||
| 682 | Ga0496114_0000003 | |||
| 683 | Ga0496114_0016978 | |||
| 684 | Ga0496114_0063654 | |||
| 685 | Ga0496115_0000071 | |||
| 686 | Ga0496115_0000183 | |||
| 687 | Ga0496116_0000018 | |||
| 688 | Ga0496116_0001727 | |||
| 689 | Ga0496117_0000015 | |||
| 690 | Ga0496117_0003031 | |||
| 691 | Ga0496118_0000012 | |||
| 692 | Ga0496118_0003573 | |||
| 693 | Ga0496119_0001610 | |||
| 694 | Ga0496119_0007872 | |||
| 695 | Ga0496119_0011161 | |||
| 696 | Ga0496120_0000195 | |||
| 697 | Ga0496120_0002973 | |||
| 698 | Ga0496121_0000809 | |||
| 699 | Ga0496121_0020618 | |||
| 700 | Ga0496124_0079803 | |||
| 701 | Ga0496126_0000906 | |||
| 702 | Ga0496126_0006739 | |||
| 703 | Ga0496126_0009868 | |||
| 704 | Ga0496126_0262888 | |||
| 705 | Ga0501031_0001843 | |||
| 706 | Ga0501032_0006154 | |||
| 707 | Ga0501033_0006846 | |||
| 708 | Ga0501034_0009884 | |||
| 709 | Ga0501036_0007038 | |||
| 710 | Ga0501037_0006130 | |||
| 711 | Ga0501038_0004258 | |||
| 712 | Ga0501039_0087983 | |||
| 713 | Ga0501040_0098105 | |||
| 714 | Ga0501043_0007126 | |||
| 715 | Ga0501046_0004639 | |||
| 716 | Ga0501047_0002598 | |||
| 717 | Ga0501047_0012226 | |||
| 718 | Ga0501047_0065722 | |||
| 719 | Ga0501048_0002831 | |||
| 720 | Ga0501070_0002436 | |||
| 721 | Ga0501070_0162383 | |||
| 722 | Ga0501071_0012097 | |||
| 723 | Ga0501073_0007567 | |||
| 724 | Ga0501074_0006028 | |||
| 725 | Ga0501074_0049020 | |||
| 726 | Ga0501075_0092048 | |||
| 727 | Ga0501079_0008842 | |||
| 728 | Ga0501080_0030272 | |||
| 729 | Ga0501080_0082030 | |||
| 730 | Ga0501083_0005791 | |||
| 731 | Ga0501083_0141015 | |||
| 732 | Ga0501035_0002544 | |||
| 733 | Ga0501035_0002764 | |||
| 734 | Ga0501044_0000568 | |||
| 735 | Ga0501044_0003950 | |||
| 736 | Ga0501044_0041151 | |||
| 737 | Ga0501045_0089321 | |||
| 738 | nmdc:mga0a205_1629_c2 | |||
| 739 | Ga0495601_0000042 | |||
| 740 | Ga0495601_0000296 | |||
| 741 | Ga0495601_0118870 | |||
| 742 | Ga0495612_0005189 | |||
| 743 | Ga0495655_0000009 | |||
| 744 | Ga0495595_0000005 | |||
| 745 | Ga0495595_0000362 | |||
| 746 | Ga0495595_0053699 | |||
| 747 | Ga0495619_0000040 | |||
| 748 | Ga0495619_0000060 | |||
| 749 | Ga0495619_0000126 | |||
| 750 | Ga0495619_0000896 | |||
| 751 | Ga0495619_0001321 | |||
| 752 | Ga0495619_0002266 | |||
| 753 | Ga0500643_022356 | |||
| 754 | Ga0500641_0002279 | |||
| 755 | Ga0500614_000806 | |||
| 756 | Ga0500628_000022 | |||
| 757 | Ga0501082_0022029 | |||
| 758 | Ga0466962_0009970 | |||
| 759 | Ga0466962_0036103 | |||
| 760 | 2902795031 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8u2w-assembly1.cif.gz_A | glucose-6-phosphate 1-dehydrogenase (g6pdh) from crithidia fasciculata (nadp bound) | 0.7985 | 14 | 434 |
| 8fuy-assembly1.cif.gz_A | glucose-6-phosphate 1-dehydrogenase (g6pdh) from crithidia fasciculata (citrate bound) | 0.7935 | 14 | 434 |
| 8em2-assembly1.cif.gz_A | cryo-em structure of the human gdh/6pgl endoplasmic bifunctional protein | 0.7918 | 14 | 413 |
| 1dpg-assembly1.cif.gz_B | glucose 6-phosphate dehydrogenase from leuconostoc mesenteroides | 0.7891 | 10 | 441 |
| 8fuy-assembly1.cif.gz_B | glucose-6-phosphate 1-dehydrogenase (g6pdh) from crithidia fasciculata (citrate bound) | 0.7872 | 14 | 434 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P9WN71_8_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9716 | 11 | 172 | 3.40.50.720 |
| af_P9WN71_8_168_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9657 | 11 | 172 | 3.40.50.720 |
| af_P0AC53_13_173_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9545 | 17 | 170 | 3.40.50.720 |
| af_P9WN73_32_206_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9364 | 17 | 175 | 3.40.50.720 |
| af_P0AC53_13_173_3.40.50.720 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;NAD(P)-binding Rossmann-like Domain | 0.9089 | 17 | 170 | 3.40.50.720 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6N9V909-F1-model_v4 | Glucose-6-phosphate dehydrogenase | 0.9857 | 213 | 328 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
| AF-X0XSA7-F1-model_v4 | Glucose-6-phosphate dehydrogenase C-terminal domain-containing protein | 0.9811 | 143 | 320 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
| AF-A0A812TZ78-F1-model_v4 | deleted | 0.9805 | 8 | 115 |
|
| AF-A0A659UKS1-F1-model_v4 | Glucose-6-phosphate dehydrogenase | 0.9795 | 198 | 311 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |
| AF-A0A7W0T9B9-F1-model_v4 | Glucose-6-phosphate dehydrogenase | 0.9785 | 10 | 202 |
GO:0004345
GO:0005829 GO:0006006 GO:0009051 GO:0050661 |