F428710

General Info

Members Datasets Scaffolds Average Seq Length
380 176 760 285

Family's Representative Sequence

Representative Sequence 3300031901|Ga0307406_10060613|Ga0307406_100606133
Length 325
Sequence MDWLPAICARHHVSSSTLRPSGVANSFMRPSARSSTSRSNSVKHTVAFDDFAAQKTRDAAAARIEQLSTVFDRRGGSRVQGIGNEWSRLHYGGEFGLVPPTRTTTAVSLVFVQTKNGNTGGPNPGAFGGGATDQHLIYEGLSRVAADAVLAGAGSVHRDAFFSVWHPELVALRASLGLPRHPAQIVVSKRGSLDLDARLFNVPDVRVFLIGGNECLARHASAFRARPWVRLLPLNGDDLRRAFESLRVEEGIQRVSAIGGRFTATQLVHAGLIQDIYLTTTSREGGEPGTPWYSGANPPRLTAITSKQWDESGSSVVFDHCLISR

Samples

Sample ID Description Type Environment
1 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
8 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
9 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
10 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
11 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
12 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
13 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
30 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
31 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
34 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
35 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
36 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
37 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
38 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
39 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
40 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
41 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
42 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
43 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
44 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
45 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
46 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
47 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
48 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
49 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
50 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
51 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
52 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
53 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
54 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
55 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
56 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
57 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
58 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
59 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
60 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
61 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
62 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
63 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
64 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
66 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
67 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
68 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
69 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
70 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
71 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
72 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
73 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
74 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
75 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
76 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
77 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
81 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
82 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
83 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
84 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
85 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
114 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
115 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
117 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
118 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
119 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
120 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
123 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
127 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
128 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
129 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
130 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
131 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
132 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
133 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
134 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
135 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
136 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
137 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
138 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
139 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
140 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
141 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
142 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
143 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
144 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
145 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
146 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
147 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
148 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
149 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
150 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
151 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
152 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
153 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
154 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
155 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
156 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
157 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
158 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
160 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
161 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
162 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
163 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
164 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
165 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
166 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
167 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
168 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
169 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
170 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
171 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
172 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
173 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
174 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
175 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
176 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 3.16
Rhizosphere 96.05
Stem 0
Stem Tuber 0
Unclassified 20

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0307406_10060613 3300031901 Unclassified 2441
2 MRS1b_contig_4998443 2162886011 Bacteria 2676
3 MBSR1b_contig_4909881 2162886012 Unclassified 998
4 Ga0065712_10074563 3300005290 Bacteria 4062
5 Ga0065712_10083831 3300005290 Bacteria 2807
6 Ga0065712_10147539 3300005290 Unclassified 1396
7 Ga0065715_10102494 3300005293 Bacteria 3110
8 Ga0065715_10181055 3300005293 Bacteria 1476
9 Ga0065715_10323681 3300005293 Unclassified 997
10 Ga0065707_10124185 3300005295 Bacteria 2049
11 Ga0070676_10012304 3300005328 Bacteria 4666
12 Ga0070676_10021900 3300005328 Bacteria 3580
13 Ga0070683_100000964 3300005329 Bacteria 21385
14 Ga0070690_100041974 3300005330 Unclassified 2897
15 Ga0070690_100333710 3300005330 Bacteria 1096
16 Ga0070670_100014509 3300005331 Bacteria 6764
17 Ga0070670_100021353 3300005331 Bacteria 5570
18 Ga0070677_10015948 3300005333 Unclassified 2668
19 Ga0070677_10076367 3300005333 Bacteria 1422
20 Ga0068869_100005831 3300005334 Bacteria 7774
21 Ga0070666_10097628 3300005335 Unclassified 2023
22 Ga0070666_10133027 3300005335 Bacteria 1729
23 Ga0070680_100163026 3300005336 Bacteria 1874
24 Ga0068868_100180533 3300005338 Bacteria 1751
25 Ga0070689_100066220 3300005340 Bacteria 2814
26 Ga0070691_10001787 3300005341 Bacteria 9349
27 Ga0070661_100272558 3300005344 Unclassified 1311
28 Ga0070692_10056173 3300005345 Bacteria 2061
29 Ga0070668_100091473 3300005347 Bacteria 2399
30 Ga0070668_100115784 3300005347 Bacteria 2137
31 Ga0070669_100000442 3300005353 Bacteria 31705
32 Ga0070669_100044304 3300005353 Bacteria 3242
33 Ga0070669_100116944 3300005353 Bacteria 2030
34 Ga0070675_100008362 3300005354 Bacteria 8031
35 Ga0070675_100038475 3300005354 Bacteria 3899
36 Ga0070675_100258155 3300005354 Bacteria 1526
37 Ga0070675_100274217 3300005354 Unclassified 1481
38 Ga0070675_100294704 3300005354 Unclassified 1428
39 Ga0070671_100024141 3300005355 Bacteria 4977
40 Ga0070671_100068470 3300005355 Bacteria 2960
41 Ga0070674_100007144 3300005356 Bacteria 6570
42 Ga0070674_100017376 3300005356 Bacteria 4524
43 Ga0070674_100136198 3300005356 Unclassified 1837
44 Ga0070674_100206605 3300005356 Unclassified 1520
45 Ga0070673_100007218 3300005364 Bacteria 7308
46 Ga0070673_100023809 3300005364 Bacteria 4479
47 Ga0070673_100037937 3300005364 Bacteria 3676
48 Ga0070673_100098593 3300005364 Bacteria 2402
49 Ga0070673_100140913 3300005364 Bacteria 2034
50 Ga0070673_100220098 3300005364 Unclassified 1643
51 Ga0070673_100232198 3300005364 Bacteria 1601
52 Ga0070673_100565253 3300005364 Unclassified 1034
53 Ga0070688_100028298 3300005365 Bacteria 3344
54 Ga0070688_100228869 3300005365 Bacteria 1314
55 Ga0070659_100382851 3300005366 Unclassified 1185
56 Ga0070667_100270259 3300005367 Bacteria 1524
57 Ga0070667_100310944 3300005367 Bacteria 1420
58 Ga0070667_100531071 3300005367 Unclassified 1080
59 Ga0070701_10011322 3300005438 Bacteria 3984
60 Ga0070701_10131602 3300005438 Bacteria 1422
61 Ga0070700_100015246 3300005441 Bacteria 4355
62 Ga0070700_100018755 3300005441 Bacteria 3982
63 Ga0070700_100192487 3300005441 Bacteria 1427
64 Ga0070700_100198712 3300005441 Bacteria 1407
65 Ga0070694_100124398 3300005444 Bacteria 1855
66 Ga0070678_100186862 3300005456 Bacteria 1701
67 Ga0070678_100625864 3300005456 Bacteria 963
68 Ga0070662_100052632 3300005457 Bacteria 2944
69 Ga0070662_100121556 3300005457 Bacteria 2002
70 Ga0068867_100008240 3300005459 Bacteria 7360
71 Ga0068867_100026800 3300005459 Bacteria 4140
72 Ga0068867_100440990 3300005459 Unclassified 1107
73 Ga0070699_100129403 3300005518 Bacteria 2225
74 Ga0070679_100111998 3300005530 Bacteria 2715
75 Ga0070684_100001702 3300005535 Bacteria 16017
76 Ga0070672_100009275 3300005543 Bacteria 6778
77 Ga0070672_100085044 3300005543 Unclassified 2541
78 Ga0070672_100219369 3300005543 Unclassified 1595
79 Ga0070686_100093729 3300005544 Bacteria 2014
80 Ga0070696_100049044 3300005546 Bacteria 2932
81 Ga0070696_100064177 3300005546 Bacteria 2573
82 Ga0070696_100215347 3300005546 Unclassified 1439
83 Ga0070693_100058144 3300005547 Bacteria 2237
84 Ga0070665_100026520 3300005548 Bacteria 5835
85 Ga0070665_100065525 3300005548 Bacteria 3644
86 Ga0070704_100015315 3300005549 Bacteria 4815
87 Ga0070664_100008076 3300005564 Bacteria 8506
88 Ga0070664_100051479 3300005564 Bacteria 3487
89 Ga0070664_100052769 3300005564 Unclassified 3444
90 Ga0070664_100122344 3300005564 Bacteria 2279
91 Ga0070664_100145147 3300005564 Bacteria 2092
92 Ga0070664_100414943 3300005564 Bacteria 1232
93 Ga0068857_100087904 3300005577 Archaea 2780
94 Ga0070702_100001216 3300005615 Bacteria 10423
95 Ga0068859_100007532 3300005617 Bacteria 11053
96 Ga0068859_100056899 3300005617 Bacteria 3938
97 Ga0068859_100144305 3300005617 Bacteria 2455
98 Ga0068859_100249551 3300005617 Bacteria 1865
99 Ga0068864_100042421 3300005618 Bacteria 3893
100 Ga0068864_100042871 3300005618 Bacteria 3873
101 Ga0068864_100073974 3300005618 Bacteria 2972
102 Ga0068864_100223797 3300005618 Bacteria 1737
103 Ga0068866_10002576 3300005718 Bacteria 7477
104 Ga0068866_10110567 3300005718 Unclassified 1532
105 Ga0068866_10139145 3300005718 Bacteria 1391
106 Ga0068861_100000837 3300005719 Bacteria 18612
107 Ga0068861_100053795 3300005719 Unclassified 3064
108 Ga0068870_10093640 3300005840 Bacteria 1685
109 Ga0068858_100005100 3300005842 Bacteria 12868
110 Ga0068858_100026322 3300005842 Bacteria 5406
111 Ga0068858_100120838 3300005842 Unclassified 2450
112 Ga0068860_100170041 3300005843 Unclassified 2105
113 Ga0068860_100378030 3300005843 Bacteria 1398
114 Ga0068862_100330219 3300005844 Unclassified 1410
115 Ga0075365_10125863 3300006038 Bacteria 1771
116 Ga0097621_100034135 3300006237 Bacteria 4056
117 Ga0097621_100044313 3300006237 Bacteria 3589
118 Ga0097621_100054007 3300006237 Unclassified 3275
119 Ga0068871_100022947 3300006358 Bacteria 4818
120 Ga0068871_100184378 3300006358 Bacteria 1795
121 Ga0075428_100011641 3300006844 Bacteria 9787
122 Ga0075428_100049557 3300006844 Bacteria 4607
123 Ga0075428_100580988 3300006844 Unclassified 1197
124 Ga0075431_100017023 3300006847 Bacteria 7382
125 Ga0075433_10048030 3300006852 Bacteria 3711
126 Ga0075434_100028510 3300006871 Bacteria 5486
127 Ga0075434_100069847 3300006871 Unclassified 3502
128 Ga0075429_100008601 3300006880 Bacteria 8879
129 Ga0075429_100328980 3300006880 Bacteria 1337
130 Ga0075429_100615155 3300006880 Unclassified 952
131 Ga0068865_100014065 3300006881 Bacteria 5077
132 Ga0068865_100046173 3300006881 Bacteria 2988
133 Ga0068865_100112938 3300006881 Bacteria 2007
134 Ga0097620_100007532 3300006931 Bacteria 11053
135 Ga0097620_100056898 3300006931 Bacteria 3938
136 Ga0097620_100144303 3300006931 Bacteria 2455
137 Ga0097620_100249581 3300006931 Bacteria 1865
138 Ga0075435_100318896 3300007076 Bacteria 1330
139 Ga0105240_10019447 3300009093 Bacteria 9074
140 Ga0105240_10033592 3300009093 Bacteria 6623
141 Ga0105240_10153890 3300009093 Bacteria 2737
142 Ga0111539_10000973 3300009094 Bacteria 37589
143 Ga0111539_10001435 3300009094 Bacteria 31809
144 Ga0111539_10002579 3300009094 Bacteria 23990
145 Ga0111539_10002597 3300009094 Bacteria 23925
146 Ga0111539_10005216 3300009094 Bacteria 16826
147 Ga0111539_10029673 3300009094 Bacteria 6658
148 Ga0111539_10051691 3300009094 Bacteria 4893
149 Ga0111539_10069373 3300009094 Bacteria 4162
150 Ga0111539_10093843 3300009094 Unclassified 3525
151 Ga0111539_10110510 3300009094 Bacteria 3225
152 Ga0111539_10260817 3300009094 Bacteria 2017
153 Ga0105245_10029698 3300009098 Bacteria 4833
154 Ga0105245_10113480 3300009098 Unclassified 2523
155 Ga0105245_10482757 3300009098 Unclassified 1253
156 Ga0105247_10215051 3300009101 Bacteria 1298
157 Ga0114129_10005947 3300009147 Bacteria 17271
158 Ga0114129_10120982 3300009147 Bacteria 3603
159 Ga0114129_10171496 3300009147 Bacteria 2958
160 Ga0114129_10174658 3300009147 Bacteria 2927
161 Ga0114129_10184922 3300009147 Bacteria 2833
162 Ga0114129_10277252 3300009147 Bacteria 2241
163 Ga0114129_10490259 3300009147 Unclassified 1606
164 Ga0114129_10909234 3300009147 Unclassified 1115
165 Ga0105243_10006809 3300009148 Bacteria 8810
166 Ga0105243_10011032 3300009148 Bacteria 6834
167 Ga0105243_10032148 3300009148 Bacteria 4052
168 Ga0105243_10793381 3300009148 Unclassified 933
169 Ga0105242_10018431 3300009176 Bacteria 5457
170 Ga0105242_10034608 3300009176 Bacteria 4050
171 Ga0105242_10097511 3300009176 Bacteria 2485
172 Ga0105242_10168966 3300009176 Bacteria 1920
173 Ga0105242_10201949 3300009176 Bacteria 1766
174 Ga0105248_10028367 3300009177 Bacteria 6236
175 Ga0105248_10029385 3300009177 Bacteria 6131
176 Ga0105248_10058610 3300009177 Unclassified 4324
177 Ga0105248_10085348 3300009177 Bacteria 3553
178 Ga0105248_10111836 3300009177 Bacteria 3080
179 Ga0105248_10324664 3300009177 Unclassified 1734
180 Ga0105248_10454332 3300009177 Bacteria 1444
181 Ga0105249_10006672 3300009553 Bacteria 10051
182 Ga0105249_10499722 3300009553 Bacteria 1261
183 Ga0105249_10566372 3300009553 Bacteria 1188
184 Ga0105246_10489361 3300011119 Unclassified 1042
185 Ga0157370_10425865 3300013104 Bacteria 1221
186 Ga0157369_10365011 3300013105 Bacteria 1499
187 Ga0157378_10813558 3300013297 Unclassified 961
188 Ga0163162_10027275 3300013306 Bacteria 5647
189 Ga0163162_10027506 3300013306 Bacteria 5625
190 Ga0163162_10042245 3300013306 Bacteria 4563
191 Ga0163162_10189337 3300013306 Bacteria 2185
192 Ga0157375_10118218 3300013308 Unclassified 2757
193 Ga0157375_10851593 3300013308 Bacteria 1058
194 Ga0163163_10004564 3300014325 Bacteria 11821
195 Ga0157380_10204580 3300014326 Bacteria 1754
196 Ga0157380_10215340 3300014326 Bacteria 1715
197 Ga0157380_10318173 3300014326 Unclassified 1441
198 Ga0157380_10325090 3300014326 Bacteria 1428
199 Ga0157377_10102256 3300014745 Bacteria 1710
200 Ga0157376_10023017 3300014969 Bacteria 4868
201 Ga0157376_10041168 3300014969 Unclassified 3781
202 Ga0157376_10089464 3300014969 Unclassified 2662
203 Ga0157376_10638870 3300014969 Bacteria 1063
204 Ga0207682_10026033 3300025893 Unclassified 2322
205 Ga0207642_10094320 3300025899 Bacteria 1486
206 Ga0207680_10028296 3300025903 Bacteria 3133
207 Ga0207645_10011509 3300025907 Bacteria 6037
208 Ga0207645_10043254 3300025907 Bacteria 2883
209 Ga0207707_10343431 3300025912 Unclassified 1287
210 Ga0207695_10339445 3300025913 Bacteria 1390
211 Ga0207649_10110426 3300025920 Bacteria 1836
212 Ga0207646_10053511 3300025922 Bacteria 3611
213 Ga0207681_10008449 3300025923 Bacteria 6293
214 Ga0207681_10044232 3300025923 Bacteria 2984
215 Ga0207681_10046707 3300025923 Bacteria 2913
216 Ga0207650_10007845 3300025925 Bacteria 7272
217 Ga0207650_10040406 3300025925 Bacteria 3413
218 Ga0207650_10307433 3300025925 Bacteria 1296
219 Ga0207659_10139962 3300025926 Bacteria 1878
220 Ga0207659_10156849 3300025926 Bacteria 1783
221 Ga0207687_10072811 3300025927 Unclassified 2459
222 Ga0207644_10108860 3300025931 Bacteria 2092
223 Ga0207706_10018677 3300025933 Bacteria 6239
224 Ga0207706_10296046 3300025933 Unclassified 1410
225 Ga0207686_10047366 3300025934 Bacteria 2657
226 Ga0207686_10053474 3300025934 Bacteria 2525
227 Ga0207709_10024639 3300025935 Bacteria 3437
228 Ga0207709_10035794 3300025935 Bacteria 2938
229 Ga0207709_10055999 3300025935 Unclassified 2439
230 Ga0207670_10130234 3300025936 Bacteria 1842
231 Ga0207669_10003312 3300025937 Bacteria 6967
232 Ga0207669_10025139 3300025937 Bacteria 3212
233 Ga0207704_10032364 3300025938 Bacteria 2959
234 Ga0207704_10112476 3300025938 Unclassified 1844
235 Ga0207704_10161595 3300025938 Bacteria 1594
236 Ga0207691_10006758 3300025940 Bacteria 11062
237 Ga0207691_10055609 3300025940 Bacteria 3605
238 Ga0207691_10165658 3300025940 Unclassified 1937
239 Ga0207711_10055014 3300025941 Unclassified 3416
240 Ga0207711_10111803 3300025941 Unclassified 2430
241 Ga0207711_10128467 3300025941 Bacteria 2269
242 Ga0207711_10206123 3300025941 Bacteria 1795
243 Ga0207711_10252159 3300025941 Bacteria 1621
244 Ga0207689_10003508 3300025942 Bacteria 14325
245 Ga0207689_10199732 3300025942 Bacteria 1650
246 Ga0207689_10277360 3300025942 Bacteria 1388
247 Ga0207689_10306443 3300025942 Unclassified 1317
248 Ga0207661_10004251 3300025944 Bacteria 10026
249 Ga0207679_10007887 3300025945 Bacteria 6765
250 Ga0207679_10039421 3300025945 Bacteria 3373
251 Ga0207679_10071139 3300025945 Bacteria 2623
252 Ga0207679_10335874 3300025945 Bacteria 1313
253 Ga0207651_10052294 3300025960 Bacteria 2784
254 Ga0207651_10148943 3300025960 Bacteria 1819
255 Ga0207651_10170639 3300025960 Bacteria 1715
256 Ga0207651_10314606 3300025960 Bacteria 1307
257 Ga0207712_10117052 3300025961 Bacteria 2009
258 Ga0207668_10083219 3300025972 Bacteria 2328
259 Ga0207668_10084517 3300025972 Bacteria 2313
260 Ga0207658_10277876 3300025986 Bacteria 1434
261 Ga0207658_10608686 3300025986 Unclassified 982
262 Ga0207677_10064774 3300026023 Bacteria 2547
263 Ga0207677_10200636 3300026023 Unclassified 1585
264 Ga0207703_10007132 3300026035 Bacteria 8892
265 Ga0207703_10045773 3300026035 Bacteria 3521
266 Ga0207703_10461853 3300026035 Unclassified 1187
267 Ga0207708_10001688 3300026075 Bacteria 16340
268 Ga0207708_10075786 3300026075 Bacteria 2579
269 Ga0207708_10355090 3300026075 Bacteria 1203
270 Ga0207702_10123692 3300026078 Bacteria 2319
271 Ga0207648_10000122 3300026089 Bacteria 76231
272 Ga0207648_10003506 3300026089 Bacteria 16433
273 Ga0207648_10078585 3300026089 Bacteria 2878
274 Ga0207648_10269250 3300026089 Unclassified 1521
275 Ga0207676_10091338 3300026095 Bacteria 2501
276 Ga0207676_10232969 3300026095 Bacteria 1647
277 Ga0207676_10274128 3300026095 Bacteria 1529
278 Ga0207674_10103090 3300026116 Bacteria 2832
279 Ga0207675_100002022 3300026118 Bacteria 20216
280 Ga0207675_100004792 3300026118 Bacteria 13032
281 Ga0207675_100018194 3300026118 Bacteria 6551
282 Ga0207675_100025303 3300026118 Bacteria 5524
283 Ga0207683_10079265 3300026121 Bacteria 2912
284 Ga0207683_10301041 3300026121 Bacteria 1467
285 Ga0207428_10004445 3300027907 Bacteria 13324
286 Ga0207428_10007103 3300027907 Bacteria 10250
287 Ga0207428_10023460 3300027907 Bacteria 5189
288 Ga0207428_10058769 3300027907 Bacteria 3050
289 Ga0207428_10067401 3300027907 Bacteria 2818
290 Ga0268266_10005990 3300028379 Bacteria 11220
291 Ga0268265_10015035 3300028380 Bacteria 5286
292 Ga0268265_10428892 3300028380 Bacteria 1229
293 Ga0268264_10162018 3300028381 Unclassified 2016
294 Ga0265332_10143455 3300031238 Bacteria 1000
295 Ga0307405_10023823 3300031731 Bacteria 3486
296 Ga0307413_10089982 3300031824 Bacteria 1996
297 Ga0307413_10119837 3300031824 Bacteria 1780
298 Ga0307410_10044376 3300031852 Bacteria 2953
299 Ga0307407_10109446 3300031903 Bacteria 1732
300 Ga0307407_10186173 3300031903 Bacteria 1380
301 Ga0307412_10117182 3300031911 Bacteria 1912
302 Ga0307412_10467543 3300031911 Bacteria 1043
303 Ga0307409_100012880 3300031995 Bacteria 5352
304 Ga0307409_100026753 3300031995 Bacteria 4075
305 Ga0307409_100194377 3300031995 Bacteria 1809
306 Ga0307416_100035992 3300032002 Bacteria 3790
307 Ga0307416_100036221 3300032002 Unclassified 3781
308 Ga0307416_100220034 3300032002 Unclassified 1820
309 Ga0307416_100476436 3300032002 Unclassified 1307
310 Ga0307416_100800046 3300032002 Bacteria 1038
311 Ga0307414_10060572 3300032004 Bacteria 2678
312 Ga0307411_10021794 3300032005 Bacteria 3758
313 Ga0307411_10054399 3300032005 Bacteria 2628
314 Ga0307411_10085388 3300032005 Bacteria 2186
315 Ga0307411_10170304 3300032005 Bacteria 1641
316 Ga0307415_100109559 3300032126 Bacteria 2046
317 Ga0373941_0035018 3300035115 Bacteria 1518
318 Ga0373925_0240520 3300037068 Bacteria 1450
319 Ga0439464_0054934 3300042439 Bacteria 1158
320 Ga0466963_0060818 3300044694 Bacteria 2523
321 Ga0495598_0029491 3300046537 Bacteria 1530
322 Ga0495674_0368761 3300047319 Bacteria 1163
323 Ga0495676_0205948 3300047321 Bacteria 1364
324 Ga0496101_0131080 3300048904 Bacteria 1904
325 Ga0496104_0166090 3300048907 Bacteria 2117
326 Ga0496105_0031720 3300048908 Bacteria 4333
327 Ga0496105_0102377 3300048908 Bacteria 2365
328 Ga0496108_0011751 3300048911 Bacteria 7121
329 Ga0496109_0020011 3300048912 Bacteria 5909
330 Ga0496109_0232969 3300048912 Bacteria 1733
331 Ga0496110_0001675 3300048913 Bacteria 16260
332 Ga0496110_0102400 3300048913 Plasmid 2568
333 Ga0496112_0026859 3300048915 Bacteria 5547
334 Ga0496112_0269219 3300048915 Bacteria 1652
335 Ga0496115_0187890 3300048918 Unclassified 1707
336 Ga0501031_0184158 3300049568 Bacteria 1364
337 Ga0501033_0069626 3300049570 Unclassified 2586
338 Ga0501036_0095787 3300049572 Unclassified 2509
339 Ga0501041_0020834 3300049577 Bacteria 3924
340 Ga0501042_0134901 3300049578 Unclassified 1780
341 Ga0501046_0211052 3300049580 Unclassified 1441
342 Ga0501048_0324806 3300049582 Unclassified 1096
343 Ga0501067_0191937 3300049583 Bacteria 1138
344 Ga0501068_0129604 3300049584 Unclassified 1577
345 Ga0501071_0175547 3300049587 Bacteria 1605
346 Ga0501072_0031294 3300049588 Bacteria 4164
347 Ga0501072_0036135 3300049588 Bacteria 3872
348 Ga0501075_0025895 3300049591 Bacteria 4312
349 Ga0501075_0062355 3300049591 Bacteria 2810
350 Ga0501077_0209918 3300049593 Unclassified 1237
351 Ga0501079_0045796 3300049741 Unclassified 3376
352 Ga0501081_0015709 3300049743 Unclassified 4998
353 Ga0501045_0046035 3300049824 Bacteria 3177
354 Ga0501045_0088629 3300049824 Bacteria 2285
355 nmdc:mga0yw44_116517_c1 3300050492 Bacteria 1717
356 nmdc:mga06z11_201060_c1 3300050494 Bacteria 1157
357 nmdc:mga05p37_110854_c1 3300050507 Bacteria 3375
358 nmdc:mga05p37_161219_c1 3300050507 Bacteria 2739
359 nmdc:mga05p37_40846_c1 3300050507 Bacteria 5695
360 nmdc:mga05p37_502258_c1 3300050507 Bacteria 1391
361 nmdc:mga05p37_51283_c1 3300050507 Bacteria 5074
362 nmdc:mga05p37_58980_c1 3300050507 Bacteria 4727
363 nmdc:mga05p37_61540_c1 3300050507 Bacteria 4621
364 nmdc:mga05p37_671010_c1 3300050507 Unclassified 1157
365 nmdc:mga09592_176284_c1 3300050508 Unclassified 1849
366 nmdc:mga09592_6596_c1 3300050508 Bacteria 9452
367 nmdc:mga06r32_20151_c1 3300050510 Bacteria 6136
368 nmdc:mga06r32_8971_c1 3300050510 Bacteria 9009
369 nmdc:mga08y16_11798_c1 3300050511 Bacteria 9180
370 nmdc:mga08y16_131969_c1 3300050511 Bacteria 2597
371 nmdc:mga08y16_228785_c1 3300050511 Unclassified 1923
372 nmdc:mga08y16_231984_c1 3300050511 Unclassified 1909
373 nmdc:mga08y16_35860_c1 3300050511 Bacteria 5210
374 nmdc:mga08y16_80652_c1 3300050511 Bacteria 3393
375 nmdc:mga08y16_9075_c1 3300050511 Bacteria 10439
376 nmdc:mga0n895_2257_c1 3300050512 Bacteria 14931
377 nmdc:mga0a205_101984_c1 3300050515 Bacteria 2768
378 nmdc:mga0a205_33403_c1 3300050515 Bacteria 4933
379 nmdc:mga0a205_354617_c1 3300050515 Bacteria 1334
380 Ga0530510_0004679 3300061734 Bacteria 9465
381 Ga0307406_10060613
382 MRS1b_contig_4998443
383 MBSR1b_contig_4909881
384 Ga0065712_10074563
385 Ga0065712_10083831
386 Ga0065712_10147539
387 Ga0065715_10102494
388 Ga0065715_10181055
389 Ga0065715_10323681
390 Ga0065707_10124185
391 Ga0070676_10012304
392 Ga0070676_10021900
393 Ga0070683_100000964
394 Ga0070690_100041974
395 Ga0070690_100333710
396 Ga0070670_100014509
397 Ga0070670_100021353
398 Ga0070677_10015948
399 Ga0070677_10076367
400 Ga0068869_100005831
401 Ga0070666_10097628
402 Ga0070666_10133027
403 Ga0070680_100163026
404 Ga0068868_100180533
405 Ga0070689_100066220
406 Ga0070691_10001787
407 Ga0070661_100272558
408 Ga0070692_10056173
409 Ga0070668_100091473
410 Ga0070668_100115784
411 Ga0070669_100000442
412 Ga0070669_100044304
413 Ga0070669_100116944
414 Ga0070675_100008362
415 Ga0070675_100038475
416 Ga0070675_100258155
417 Ga0070675_100274217
418 Ga0070675_100294704
419 Ga0070671_100024141
420 Ga0070671_100068470
421 Ga0070674_100007144
422 Ga0070674_100017376
423 Ga0070674_100136198
424 Ga0070674_100206605
425 Ga0070673_100007218
426 Ga0070673_100023809
427 Ga0070673_100037937
428 Ga0070673_100098593
429 Ga0070673_100140913
430 Ga0070673_100220098
431 Ga0070673_100232198
432 Ga0070673_100565253
433 Ga0070688_100028298
434 Ga0070688_100228869
435 Ga0070659_100382851
436 Ga0070667_100270259
437 Ga0070667_100310944
438 Ga0070667_100531071
439 Ga0070701_10011322
440 Ga0070701_10131602
441 Ga0070700_100015246
442 Ga0070700_100018755
443 Ga0070700_100192487
444 Ga0070700_100198712
445 Ga0070694_100124398
446 Ga0070678_100186862
447 Ga0070678_100625864
448 Ga0070662_100052632
449 Ga0070662_100121556
450 Ga0068867_100008240
451 Ga0068867_100026800
452 Ga0068867_100440990
453 Ga0070699_100129403
454 Ga0070679_100111998
455 Ga0070684_100001702
456 Ga0070672_100009275
457 Ga0070672_100085044
458 Ga0070672_100219369
459 Ga0070686_100093729
460 Ga0070696_100049044
461 Ga0070696_100064177
462 Ga0070696_100215347
463 Ga0070693_100058144
464 Ga0070665_100026520
465 Ga0070665_100065525
466 Ga0070704_100015315
467 Ga0070664_100008076
468 Ga0070664_100051479
469 Ga0070664_100052769
470 Ga0070664_100122344
471 Ga0070664_100145147
472 Ga0070664_100414943
473 Ga0068857_100087904
474 Ga0070702_100001216
475 Ga0068859_100007532
476 Ga0068859_100056899
477 Ga0068859_100144305
478 Ga0068859_100249551
479 Ga0068864_100042421
480 Ga0068864_100042871
481 Ga0068864_100073974
482 Ga0068864_100223797
483 Ga0068866_10002576
484 Ga0068866_10110567
485 Ga0068866_10139145
486 Ga0068861_100000837
487 Ga0068861_100053795
488 Ga0068870_10093640
489 Ga0068858_100005100
490 Ga0068858_100026322
491 Ga0068858_100120838
492 Ga0068860_100170041
493 Ga0068860_100378030
494 Ga0068862_100330219
495 Ga0075365_10125863
496 Ga0097621_100034135
497 Ga0097621_100044313
498 Ga0097621_100054007
499 Ga0068871_100022947
500 Ga0068871_100184378
501 Ga0075428_100011641
502 Ga0075428_100049557
503 Ga0075428_100580988
504 Ga0075431_100017023
505 Ga0075433_10048030
506 Ga0075434_100028510
507 Ga0075434_100069847
508 Ga0075429_100008601
509 Ga0075429_100328980
510 Ga0075429_100615155
511 Ga0068865_100014065
512 Ga0068865_100046173
513 Ga0068865_100112938
514 Ga0097620_100007532
515 Ga0097620_100056898
516 Ga0097620_100144303
517 Ga0097620_100249581
518 Ga0075435_100318896
519 Ga0105240_10019447
520 Ga0105240_10033592
521 Ga0105240_10153890
522 Ga0111539_10000973
523 Ga0111539_10001435
524 Ga0111539_10002579
525 Ga0111539_10002597
526 Ga0111539_10005216
527 Ga0111539_10029673
528 Ga0111539_10051691
529 Ga0111539_10069373
530 Ga0111539_10093843
531 Ga0111539_10110510
532 Ga0111539_10260817
533 Ga0105245_10029698
534 Ga0105245_10113480
535 Ga0105245_10482757
536 Ga0105247_10215051
537 Ga0114129_10005947
538 Ga0114129_10120982
539 Ga0114129_10171496
540 Ga0114129_10174658
541 Ga0114129_10184922
542 Ga0114129_10277252
543 Ga0114129_10490259
544 Ga0114129_10909234
545 Ga0105243_10006809
546 Ga0105243_10011032
547 Ga0105243_10032148
548 Ga0105243_10793381
549 Ga0105242_10018431
550 Ga0105242_10034608
551 Ga0105242_10097511
552 Ga0105242_10168966
553 Ga0105242_10201949
554 Ga0105248_10028367
555 Ga0105248_10029385
556 Ga0105248_10058610
557 Ga0105248_10085348
558 Ga0105248_10111836
559 Ga0105248_10324664
560 Ga0105248_10454332
561 Ga0105249_10006672
562 Ga0105249_10499722
563 Ga0105249_10566372
564 Ga0105246_10489361
565 Ga0157370_10425865
566 Ga0157369_10365011
567 Ga0157378_10813558
568 Ga0163162_10027275
569 Ga0163162_10027506
570 Ga0163162_10042245
571 Ga0163162_10189337
572 Ga0157375_10118218
573 Ga0157375_10851593
574 Ga0163163_10004564
575 Ga0157380_10204580
576 Ga0157380_10215340
577 Ga0157380_10318173
578 Ga0157380_10325090
579 Ga0157377_10102256
580 Ga0157376_10023017
581 Ga0157376_10041168
582 Ga0157376_10089464
583 Ga0157376_10638870
584 Ga0207682_10026033
585 Ga0207642_10094320
586 Ga0207680_10028296
587 Ga0207645_10011509
588 Ga0207645_10043254
589 Ga0207707_10343431
590 Ga0207695_10339445
591 Ga0207649_10110426
592 Ga0207646_10053511
593 Ga0207681_10008449
594 Ga0207681_10044232
595 Ga0207681_10046707
596 Ga0207650_10007845
597 Ga0207650_10040406
598 Ga0207650_10307433
599 Ga0207659_10139962
600 Ga0207659_10156849
601 Ga0207687_10072811
602 Ga0207644_10108860
603 Ga0207706_10018677
604 Ga0207706_10296046
605 Ga0207686_10047366
606 Ga0207686_10053474
607 Ga0207709_10024639
608 Ga0207709_10035794
609 Ga0207709_10055999
610 Ga0207670_10130234
611 Ga0207669_10003312
612 Ga0207669_10025139
613 Ga0207704_10032364
614 Ga0207704_10112476
615 Ga0207704_10161595
616 Ga0207691_10006758
617 Ga0207691_10055609
618 Ga0207691_10165658
619 Ga0207711_10055014
620 Ga0207711_10111803
621 Ga0207711_10128467
622 Ga0207711_10206123
623 Ga0207711_10252159
624 Ga0207689_10003508
625 Ga0207689_10199732
626 Ga0207689_10277360
627 Ga0207689_10306443
628 Ga0207661_10004251
629 Ga0207679_10007887
630 Ga0207679_10039421
631 Ga0207679_10071139
632 Ga0207679_10335874
633 Ga0207651_10052294
634 Ga0207651_10148943
635 Ga0207651_10170639
636 Ga0207651_10314606
637 Ga0207712_10117052
638 Ga0207668_10083219
639 Ga0207668_10084517
640 Ga0207658_10277876
641 Ga0207658_10608686
642 Ga0207677_10064774
643 Ga0207677_10200636
644 Ga0207703_10007132
645 Ga0207703_10045773
646 Ga0207703_10461853
647 Ga0207708_10001688
648 Ga0207708_10075786
649 Ga0207708_10355090
650 Ga0207702_10123692
651 Ga0207648_10000122
652 Ga0207648_10003506
653 Ga0207648_10078585
654 Ga0207648_10269250
655 Ga0207676_10091338
656 Ga0207676_10232969
657 Ga0207676_10274128
658 Ga0207674_10103090
659 Ga0207675_100002022
660 Ga0207675_100004792
661 Ga0207675_100018194
662 Ga0207675_100025303
663 Ga0207683_10079265
664 Ga0207683_10301041
665 Ga0207428_10004445
666 Ga0207428_10007103
667 Ga0207428_10023460
668 Ga0207428_10058769
669 Ga0207428_10067401
670 Ga0268266_10005990
671 Ga0268265_10015035
672 Ga0268265_10428892
673 Ga0268264_10162018
674 Ga0265332_10143455
675 Ga0307405_10023823
676 Ga0307413_10089982
677 Ga0307413_10119837
678 Ga0307410_10044376
679 Ga0307407_10109446
680 Ga0307407_10186173
681 Ga0307412_10117182
682 Ga0307412_10467543
683 Ga0307409_100012880
684 Ga0307409_100026753
685 Ga0307409_100194377
686 Ga0307416_100035992
687 Ga0307416_100036221
688 Ga0307416_100220034
689 Ga0307416_100476436
690 Ga0307416_100800046
691 Ga0307414_10060572
692 Ga0307411_10021794
693 Ga0307411_10054399
694 Ga0307411_10085388
695 Ga0307411_10170304
696 Ga0307415_100109559
697 Ga0373941_0035018
698 Ga0373925_0240520
699 Ga0439464_0054934
700 Ga0466963_0060818
701 Ga0495598_0029491
702 Ga0495674_0368761
703 Ga0495676_0205948
704 Ga0496101_0131080
705 Ga0496104_0166090
706 Ga0496105_0031720
707 Ga0496105_0102377
708 Ga0496108_0011751
709 Ga0496109_0020011
710 Ga0496109_0232969
711 Ga0496110_0001675
712 Ga0496110_0102400
713 Ga0496112_0026859
714 Ga0496112_0269219
715 Ga0496115_0187890
716 Ga0501031_0184158
717 Ga0501033_0069626
718 Ga0501036_0095787
719 Ga0501041_0020834
720 Ga0501042_0134901
721 Ga0501046_0211052
722 Ga0501048_0324806
723 Ga0501067_0191937
724 Ga0501068_0129604
725 Ga0501071_0175547
726 Ga0501072_0031294
727 Ga0501072_0036135
728 Ga0501075_0025895
729 Ga0501075_0062355
730 Ga0501077_0209918
731 Ga0501079_0045796
732 Ga0501081_0015709
733 Ga0501045_0046035
734 Ga0501045_0088629
735 nmdc:mga0yw44_116517_c1
736 nmdc:mga06z11_201060_c1
737 nmdc:mga05p37_110854_c1
738 nmdc:mga05p37_161219_c1
739 nmdc:mga05p37_40846_c1
740 nmdc:mga05p37_502258_c1
741 nmdc:mga05p37_51283_c1
742 nmdc:mga05p37_58980_c1
743 nmdc:mga05p37_61540_c1
744 nmdc:mga05p37_671010_c1
745 nmdc:mga09592_176284_c1
746 nmdc:mga09592_6596_c1
747 nmdc:mga06r32_20151_c1
748 nmdc:mga06r32_8971_c1
749 nmdc:mga08y16_11798_c1
750 nmdc:mga08y16_131969_c1
751 nmdc:mga08y16_228785_c1
752 nmdc:mga08y16_231984_c1
753 nmdc:mga08y16_35860_c1
754 nmdc:mga08y16_80652_c1
755 nmdc:mga08y16_9075_c1
756 nmdc:mga0n895_2257_c1
757 nmdc:mga0a205_101984_c1
758 nmdc:mga0a205_33403_c1
759 nmdc:mga0a205_354617_c1
760 Ga0530510_0004679

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01872

RibD_C

RibD C-terminal domain

131

318

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
7mie-assembly1.cif.gz_A crystal structure of the borreliella burgdorferi plza protein in complex with c-di-gmp 0.8532 261 285
2p4g-assembly1.cif.gz_A-2 crystal structure of a pyrimidine reductase-like protein (dip1392) from corynebacterium diphtheriae nctc at 2.30 a resolution 0.8041 66 285
4xt6-assembly1.cif.gz_A-2 crystal structure of rv2671 from mycobacterium tuberculosis in complex with the tetrahydropteridine ring of tetrahydrofolate (thf) 0.7927 60 285
4xrb-assembly1.cif.gz_A-2 crystal structure of rv2671 from mycobacterium tuberculosis 0.7875 59 285
4xt4-assembly1.cif.gz_A crystal structure of rv2671 from mycobacteirum tuberculosis in complex with dihydropteridine ring of dihydropteroic acid 0.7761 60 285
ID Description Score Start End Superfamily
af_I1LS39_91_211_3.30.70.260 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;ACT domain 0.8351 261 285 3.30.70.260
af_A0A0N7KQ21_7_143_3.40.50.2000 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glycogen Phosphorylase B; 0.8271 165 195 3.40.50.2000
2b3zA02 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7845 65 279 3.40.430.10
6de5A00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7839 60 284 3.40.430.10
2p4gA00 Alpha Beta;3-Layer(aba) Sandwich;Dihydrofolate Reductase, subunit A;Dihydrofolate Reductase, subunit A 0.7828 66 285 3.40.430.10
ID Description Score Start End GO Terms
AF-A0A2V8HEH6-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9724 1 284 GO:0008703
GO:0009231
AF-A0A2V8J6I8-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9682 4 285 GO:0008703
GO:0009231
AF-A0A2V8HEH6-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9657 1 284 GO:0008703
GO:0009231
AF-A0A1F2TLJ8-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9599 9 284 GO:0008703
GO:0009231
AF-A0A1Q7GXX5-F1-model_v4 Bacterial bifunctional deaminase-reductase C-terminal domain-containing protein 0.9551 1 285 GO:0008703
GO:0009231

Map