F428698

General Info

Members Datasets Scaffolds Average Seq Length
380 220 379 343

Family's Representative Sequence

Representative Sequence 3300028379|Ga0268266_10002541|Ga0268266_1000254119
Length 400
Sequence MAITITSCNPGAMPAILSRVAGVHKGVQAGSNPSFFPSNLPGSIYLTLTMPTASIPSPKPPSKARRRWKAATLKVRELASIGWALASTGHPYMAQIVPMRRCNLACTYCNEYDDFSDPVPLDEMLRRIDHLGRLGTSVITISGGEPLLNPHLDEIIARIRKNGAIAGMITNGYLLMPDRIHRLNKAGLDHMQISIDNVMPDAVSKKSLKVLDKKLQMLADHAEFHVNINSVVGGGIANPDDARVVSERALGLGFSSTIGIIHDGSGQLKPLGDAERKVWDKVRSMTRRSYSRFNHFQEAIANGKTNDWRCRAGGRYLYVCENGLVHYCSQQRGFPGVPLSNYTTADVKREFLTEKGCAPSCTISCVHQVSYIDHWRAPQKDSVTPNSSHGAGEQELVQIQ

Samples

Sample ID Description Type Environment
1 2884215851 Edaphobacter sp. 12200R-103 Isolate Rhizosphere
2 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
3 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
4 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
5 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
8 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
13 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
14 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
15 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
16 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
17 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
18 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
19 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
22 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
23 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
24 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
25 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
26 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
27 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
28 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
34 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
35 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
36 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
37 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
38 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
39 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
40 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
41 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
46 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
47 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
48 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
49 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
50 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
51 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
52 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
53 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
54 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
55 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
56 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
57 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
58 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
88 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
89 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
90 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
91 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
92 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
93 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
94 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
95 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
96 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
97 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
98 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
99 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
100 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
101 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
102 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
103 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
104 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
105 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
106 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
107 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
108 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
111 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
112 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
113 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
114 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
115 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
116 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
117 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
118 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
119 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
120 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
121 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
122 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
123 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
124 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
125 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
126 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
127 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
128 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
129 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
130 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
131 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
132 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
133 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
134 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
135 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
136 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
137 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
138 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
139 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
140 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
141 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
142 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
143 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
144 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
145 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
146 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
147 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
148 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
149 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
150 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
151 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
152 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
153 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
154 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
155 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
156 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
157 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
158 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
159 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
160 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
161 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
164 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
165 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
166 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
167 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
168 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
169 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
173 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
174 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
175 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
176 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
177 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
178 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
179 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
180 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
192 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
193 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
194 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
195 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
196 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
197 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
198 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
199 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
200 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
201 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
202 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
203 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
204 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
205 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
206 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
207 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
208 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
209 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
210 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
211 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
212 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
213 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
214 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
215 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
216 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
217 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
218 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
219 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
220 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0
Isolates 0.26

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.84
Nodule 0
Rhizoplane 4.74
Rhizosphere 89.74
Stem 0
Stem Tuber 0
Unclassified 3.68

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 rootH1_10049638 3300003316 Bacteria 3791
2 rootH2_10162621 3300003320 Bacteria 1528
3 Ga0070658_10000101 3300005327 Bacteria 75550
4 Ga0070658_10026098 3300005327 Bacteria 4686
5 Ga0070658_10063392 3300005327 Bacteria 3013
6 Ga0070683_100045717 3300005329 Bacteria 4041
7 Ga0070680_100029891 3300005336 Bacteria 4375
8 Ga0068868_100013663 3300005338 Bacteria 5962
9 Ga0070661_100050778 3300005344 Bacteria 3035
10 Ga0070668_100400164 3300005347 Bacteria 1172
11 Ga0070671_100216904 3300005355 Bacteria 1623
12 Ga0070673_100246045 3300005364 Bacteria 1557
13 Ga0070659_100018303 3300005366 Bacteria 5286
14 Ga0070659_100066297 3300005366 Bacteria 2861
15 Ga0070659_100209575 3300005366 Bacteria 1606
16 Ga0070714_100000338 3300005435 Bacteria 35168
17 Ga0070714_100272213 3300005435 Bacteria 1571
18 Ga0070713_100016676 3300005436 Bacteria 5527
19 Ga0070713_100043699 3300005436 Bacteria 3665
20 Ga0070713_100060805 3300005436 Bacteria 3159
21 Ga0070711_100192003 3300005439 Unclassified 1570
22 Ga0070663_100022896 3300005455 Bacteria 4181
23 Ga0070662_100343407 3300005457 Bacteria 1222
24 Ga0070681_10056765 3300005458 Bacteria 3896
25 Ga0070706_100171319 3300005467 Bacteria 2027
26 Ga0070679_100001106 3300005530 Bacteria 23586
27 Ga0068853_100000087 3300005539 Bacteria 64293
28 Ga0068853_100010354 3300005539 Bacteria 7544
29 Ga0068853_100120350 3300005539 Bacteria 2341
30 Ga0068853_100233665 3300005539 Bacteria 1683
31 Ga0070665_100042719 3300005548 Bacteria 4557
32 Ga0070665_100063399 3300005548 Bacteria 3706
33 Ga0070665_100067214 3300005548 Bacteria 3594
34 Ga0070665_100094330 3300005548 Bacteria 2997
35 Ga0068855_100028854 3300005563 Bacteria 6638
36 Ga0068855_100056118 3300005563 Bacteria 4623
37 Ga0068855_100198390 3300005563 Bacteria 2260
38 Ga0068857_100003186 3300005577 Bacteria 13605
39 Ga0068854_100000037 3300005578 Bacteria 100242
40 Ga0068854_100012049 3300005578 Bacteria 5653
41 Ga0068856_100196015 3300005614 Bacteria 2034
42 Ga0068852_100024010 3300005616 Bacteria 4920
43 Ga0068851_10053821 3300005834 Bacteria 2050
44 Ga0068851_10096141 3300005834 Bacteria 1566
45 Ga0068863_100025950 3300005841 Bacteria 5590
46 Ga0081540_1007286 3300005983 Bacteria 7919
47 Ga0070717_10033376 3300006028 Bacteria 4153
48 Ga0070717_10085981 3300006028 Unclassified 2647
49 Ga0070715_10024527 3300006163 Unclassified 2378
50 Ga0070712_100012127 3300006175 Bacteria 5477
51 Ga0070712_100096935 3300006175 Unclassified 2172
52 Ga0075430_100019532 3300006846 Bacteria 5764
53 Ga0075431_100081732 3300006847 Bacteria 3336
54 Ga0075433_10081749 3300006852 Bacteria 2849
55 Ga0075436_100032651 3300006914 Bacteria 3588
56 Ga0105240_10000001 3300009093 Bacteria 2887840
57 Ga0105240_10000284 3300009093 Bacteria 99440
58 Ga0105240_10012026 3300009093 Bacteria 11997
59 Ga0105240_10012499 3300009093 Bacteria 11715
60 Ga0105240_10022438 3300009093 Bacteria 8366
61 Ga0105240_10111156 3300009093 Bacteria 3315
62 Ga0105240_10157977 3300009093 Bacteria 2695
63 Ga0105240_10229904 3300009093 Bacteria 2156
64 Ga0111539_10062125 3300009094 Bacteria 4423
65 Ga0105245_10007271 3300009098 Bacteria 9696
66 Ga0105245_10023721 3300009098 Bacteria 5385
67 Ga0114129_10458113 3300009147 Bacteria 1671
68 Ga0105248_10000666 3300009177 Bacteria 39007
69 Ga0105248_10023865 3300009177 Bacteria 6797
70 Ga0105248_10061490 3300009177 Bacteria 4217
71 Ga0105248_10203428 3300009177 Bacteria 2231
72 Ga0105237_10005705 3300009545 Bacteria 13994
73 Ga0105237_10197615 3300009545 Bacteria 2010
74 Ga0105238_10028771 3300009551 Bacteria 5660
75 Ga0105238_10062700 3300009551 Bacteria 3718
76 Ga0105238_10383272 3300009551 Bacteria 1397
77 Ga0105239_10000334 3300010375 Bacteria 68928
78 Ga0105239_10074740 3300010375 Unclassified 3726
79 Ga0157370_10022847 3300013104 Bacteria 6218
80 Ga0157370_10024705 3300013104 Bacteria 5950
81 Ga0157370_10030637 3300013104 Bacteria 5269
82 Ga0157370_10081865 3300013104 Bacteria 3037
83 Ga0157370_10092680 3300013104 Bacteria 2835
84 Ga0157370_10316553 3300013104 Bacteria 1440
85 Ga0157369_10000493 3300013105 Bacteria 52265
86 Ga0157369_10014314 3300013105 Bacteria 8959
87 Ga0157369_10036136 3300013105 Bacteria 5414
88 Ga0157369_10074160 3300013105 Bacteria 3650
89 Ga0157369_10169297 3300013105 Bacteria 2302
90 Ga0157374_10009573 3300013296 Bacteria 8322
91 Ga0157374_10219923 3300013296 Bacteria 1863
92 Ga0157378_10026245 3300013297 Bacteria 5135
93 Ga0163162_10026438 3300013306 Bacteria 5734
94 Ga0163162_10138976 3300013306 Bacteria 2541
95 Ga0157372_10007624 3300013307 Bacteria 11508
96 Ga0157372_10013516 3300013307 Bacteria 8724
97 Ga0157372_10111373 3300013307 Bacteria 3136
98 Ga0157372_10226892 3300013307 Bacteria 2165
99 Ga0157372_10349679 3300013307 Bacteria 1722
100 Ga0163163_10318946 3300014325 Bacteria 1608
101 Ga0157376_10010898 3300014969 Bacteria 6677
102 Ga0157376_10017216 3300014969 Bacteria 5507
103 Ga0157376_10049914 3300014969 Bacteria 3468
104 Ga0213872_10096404 3300021361 Bacteria 1320
105 Ga0213875_10005551 3300021388 Bacteria 6753
106 Ga0224572_1002416 3300024225 Bacteria 3009
107 Ga0209233_1002583 3300025261 Bacteria 6584
108 Ga0209233_1007762 3300025261 Bacteria 3371
109 Ga0207680_10009735 3300025903 Bacteria 4781
110 Ga0207647_10002648 3300025904 Bacteria 13523
111 Ga0207647_10013174 3300025904 Bacteria 5743
112 Ga0207699_10045527 3300025906 Unclassified 2561
113 Ga0207705_10000109 3300025909 Bacteria 93256
114 Ga0207705_10009375 3300025909 Bacteria 7117
115 Ga0207705_10019360 3300025909 Bacteria 4866
116 Ga0207705_10024264 3300025909 Bacteria 4329
117 Ga0207707_10142041 3300025912 Bacteria 2099
118 Ga0207707_10232448 3300025912 Bacteria 1604
119 Ga0207707_10286783 3300025912 Bacteria 1425
120 Ga0207695_10000001 3300025913 Bacteria 2888630
121 Ga0207695_10014790 3300025913 Bacteria 9219
122 Ga0207695_10020263 3300025913 Bacteria 7623
123 Ga0207695_10051710 3300025913 Bacteria 4311
124 Ga0207695_10072415 3300025913 Bacteria 3516
125 Ga0207695_10079222 3300025913 Bacteria 3331
126 Ga0207693_10240440 3300025915 Unclassified 1421
127 Ga0207657_10004594 3300025919 Bacteria 14591
128 Ga0207657_10077410 3300025919 Bacteria 2803
129 Ga0207657_10134899 3300025919 Bacteria 2021
130 Ga0207652_10001024 3300025921 Bacteria 25651
131 Ga0207652_10094372 3300025921 Bacteria 2634
132 Ga0207652_10305242 3300025921 Bacteria 1436
133 Ga0207646_10000044 3300025922 Bacteria 183369
134 Ga0207694_10000105 3300025924 Bacteria 89920
135 Ga0207694_10006015 3300025924 Bacteria 9283
136 Ga0207694_10044474 3300025924 Bacteria 3429
137 Ga0207650_10169832 3300025925 Bacteria 1733
138 Ga0207687_10034262 3300025927 Bacteria 3447
139 Ga0207687_10063381 3300025927 Bacteria 2617
140 Ga0207700_10010139 3300025928 Bacteria 5925
141 Ga0207700_10057132 3300025928 Bacteria 2941
142 Ga0207664_10131293 3300025929 Bacteria 2109
143 Ga0207644_10084107 3300025931 Bacteria 2358
144 Ga0207690_10001283 3300025932 Bacteria 15872
145 Ga0207690_10100334 3300025932 Bacteria 2066
146 Ga0207665_10002689 3300025939 Bacteria 11926
147 Ga0207665_10083780 3300025939 Bacteria 2200
148 Ga0207711_10000014 3300025941 Bacteria 506753
149 Ga0207711_10000606 3300025941 Bacteria 36174
150 Ga0207711_10017586 3300025941 Bacteria 5939
151 Ga0207661_10024098 3300025944 Unclassified 4606
152 Ga0207679_10173366 3300025945 Bacteria 1778
153 Ga0207667_10005429 3300025949 Bacteria 15542
154 Ga0207667_10043023 3300025949 Bacteria 4795
155 Ga0207667_10056370 3300025949 Bacteria 4128
156 Ga0207667_10219203 3300025949 Bacteria 1950
157 Ga0207640_10000002 3300025981 Bacteria 524211
158 Ga0207640_10003704 3300025981 Bacteria 8241
159 Ga0207640_10135897 3300025981 Bacteria 1785
160 Ga0207639_10000071 3300026041 Bacteria 94980
161 Ga0207639_10022782 3300026041 Unclassified 4515
162 Ga0207639_10064133 3300026041 Bacteria 2847
163 Ga0207639_10178497 3300026041 Bacteria 1804
164 Ga0207678_10011984 3300026067 Bacteria 7613
165 Ga0207678_10189674 3300026067 Bacteria 1756
166 Ga0207678_10222031 3300026067 Bacteria 1618
167 Ga0207702_10066294 3300026078 Bacteria 3094
168 Ga0207641_10006824 3300026088 Bacteria 9562
169 Ga0207674_10002385 3300026116 Bacteria 23750
170 Ga0207698_10045026 3300026142 Bacteria 3321
171 Ga0268266_10002541 3300028379 Bacteria 19375
172 Ga0268266_10024683 3300028379 Bacteria 5114
173 Ga0265323_10032855 3300028653 Bacteria 1924
174 Ga0265336_10001922 3300028666 Bacteria 8976
175 Ga0265338_10118311 3300028800 Bacteria 2118
176 Ga0265338_10121980 3300028800 Bacteria 2075
177 Ga0265330_10114389 3300031235 Unclassified 1151
178 Ga0265340_10015697 3300031247 Unclassified 3932
179 Ga0265339_10004422 3300031249 Bacteria 9594
180 Ga0265316_10023873 3300031344 Bacteria 5135
181 Ga0265316_10025821 3300031344 Bacteria 4895
182 Ga0265316_10182656 3300031344 Bacteria 1561
183 Ga0265316_10199062 3300031344 Bacteria 1486
184 Ga0265316_10207386 3300031344 Bacteria 1451
185 Ga0265314_10090549 3300031711 Bacteria 1992
186 Ga0265342_10014307 3300031712 Bacteria 5272
187 Ga0265342_10064194 3300031712 Bacteria 2156
188 Ga0265342_10149178 3300031712 Bacteria 1299
189 Ga0307510_10027300 3300033180 Bacteria 6543
190 Ga0373955_0007765 3300035172 Unclassified 4944
191 Ga0373955_0069357 3300035172 Bacteria 1967
192 Ga0373924_0000480 3300035410 Bacteria 12207
193 Ga0373924_0017803 3300035410 Bacteria 2731
194 Ga0373924_0112556 3300035410 Bacteria 1177
195 Ga0373935_0002908 3300035692 Bacteria 9862
196 Ga0373927_0090353 3300035695 Bacteria 1989
197 Ga0373933_0191727 3300035724 Bacteria 1306
198 Ga0373947_0002500 3300035725 Bacteria 11052
199 Ga0373937_0005568 3300036401 Bacteria 10806
200 Ga0373937_0045966 3300036401 Bacteria 3991
201 Ga0373925_0010869 3300037068 Bacteria 6601
202 Ga0373925_0028029 3300037068 Bacteria 4125
203 Ga0395900_0155592 3300037418 Bacteria 2335
204 Ga0395898_0100335 3300037466 Bacteria 2780
205 Ga0395905_0021089 3300037471 Bacteria 6170
206 Ga0436364_0220151 3300037853 Unclassified 1986
207 Ga0436364_0350882 3300037853 Bacteria 5317
208 Ga0436365_0702050 3300039437 Bacteria 4020
209 Ga0436360_1093448 3300039438 Bacteria 6148
210 Ga0436361_0927715 3300039447 Bacteria 13008
211 Ga0436363_0305441 3300039450 Bacteria 3047
212 Ga0436363_0317733 3300039450 Bacteria 4505
213 Ga0436363_1719984 3300039450 Bacteria 2626
214 Ga0436362_1024607 3300039453 Bacteria 5517
215 Ga0466966_0102499 3300044684 Bacteria 1769
216 Ga0466957_0000190 3300044842 Bacteria 28163
217 Ga0466959_0044258 3300045049 Bacteria 3281
218 Ga0466959_0045149 3300045049 Bacteria 3246
219 Ga0451576_0213212 3300045051 Unclassified 2017
220 Ga0466958_0043520 3300045836 Bacteria 2705
221 Ga0466967_0236164 3300045976 Bacteria 1742
222 Ga0495592_0013833 3300046454 Bacteria 6135
223 Ga0495603_0001136 3300046455 Bacteria 15542
224 Ga0495629_0005458 3300046459 Bacteria 9485
225 Ga0495629_0007756 3300046459 Bacteria 7898
226 Ga0495651_0011980 3300046462 Bacteria 6674
227 Ga0495651_0040058 3300046462 Unclassified 3645
228 Ga0495651_0074686 3300046462 Bacteria 2572
229 Ga0495651_0082832 3300046462 Bacteria 2420
230 Ga0495653_0000990 3300046463 Bacteria 21873
231 Ga0495650_0000037 3300046471 Bacteria 390090
232 Ga0495650_0003543 3300046471 Bacteria 11304
233 Ga0495580_0006575 3300046472 Bacteria 9450
234 Ga0495580_0011991 3300046472 Bacteria 6678
235 Ga0495580_0012833 3300046472 Bacteria 6420
236 Ga0495582_0001593 3300046473 Bacteria 12794
237 Ga0495582_0021365 3300046473 Bacteria 3543
238 Ga0495639_0001600 3300046475 Bacteria 10075
239 Ga0495639_0062174 3300046475 Bacteria 1713
240 Ga0495639_0068792 3300046475 Bacteria 1633
241 Ga0495662_0001212 3300046476 Bacteria 12703
242 Ga0495664_0038969 3300046477 Bacteria 2807
243 Ga0495664_0060156 3300046477 Bacteria 2261
244 Ga0495585_0014002 3300046492 Bacteria 4684
245 Ga0495585_0088320 3300046492 Bacteria 1672
246 Ga0495594_0000357 3300046499 Bacteria 22945
247 Ga0495594_0001145 3300046499 Bacteria 13845
248 Ga0495583_0045346 3300046506 Bacteria 2034
249 Ga0495606_0100233 3300046507 Bacteria 1765
250 Ga0495606_0183406 3300046507 Bacteria 1205
251 Ga0495628_0021455 3300046516 Bacteria 5312
252 Ga0495628_0043748 3300046516 Bacteria 3565
253 Ga0495630_0195270 3300046517 Bacteria 1544
254 Ga0495630_0295553 3300046517 Bacteria 1238
255 Ga0495643_0062087 3300046522 Bacteria 1979
256 Ga0495644_0000004 3300046523 Bacteria 158166
257 Ga0495666_0001214 3300046526 Bacteria 12453
258 Ga0495642_0031077 3300046528 Bacteria 2140
259 Ga0495652_0002436 3300046529 Bacteria 19168
260 Ga0495665_0004967 3300046531 Bacteria 7166
261 Ga0495665_0193255 3300046531 Bacteria 1056
262 Ga0495640_0009155 3300046533 Bacteria 7728
263 Ga0495586_0000610 3300046535 Bacteria 20684
264 Ga0495587_0036728 3300046536 Bacteria 2946
265 Ga0495609_0007019 3300046538 Bacteria 5677
266 Ga0495645_0003197 3300046543 Bacteria 11104
267 Ga0495645_0011176 3300046543 Bacteria 6314
268 Ga0495645_0022866 3300046543 Bacteria 4525
269 Ga0495622_0026289 3300046557 Bacteria 2719
270 Ga0495633_0016249 3300046558 Bacteria 3844
271 Ga0495667_0003403 3300046559 Bacteria 10659
272 Ga0495668_0030486 3300046616 Bacteria 3045
273 Ga0495634_0003182 3300046642 Bacteria 13283
274 Ga0495611_0060758 3300046648 Bacteria 1717
275 Ga0495625_0000166 3300046660 Bacteria 102927
276 Ga0495625_0003450 3300046660 Bacteria 15757
277 Ga0495625_0012010 3300046660 Bacteria 7030
278 Ga0495625_0041280 3300046660 Bacteria 3359
279 Ga0495635_0005990 3300046663 Bacteria 8485
280 Ga0495635_0064550 3300046663 Bacteria 2513
281 Ga0495661_0200063 3300046665 Bacteria 1047
282 Ga0495657_0046027 3300046675 Bacteria 2957
283 Ga0495599_0039228 3300046678 Bacteria 2975
284 Ga0495623_0033016 3300046679 Bacteria 3323
285 Ga0495623_0216596 3300046679 Bacteria 1093
286 Ga0495646_0034039 3300046680 Bacteria 3165
287 Ga0495658_0088096 3300046683 Bacteria 1834
288 Ga0495669_0001203 3300046684 Bacteria 10764
289 Ga0495669_0077092 3300046684 Bacteria 1526
290 Ga0495613_0013042 3300046689 Bacteria 6177
291 Ga0495613_0058457 3300046689 Bacteria 2829
292 Ga0495624_0005056 3300046690 Bacteria 9541
293 Ga0495670_0014600 3300046691 Bacteria 3862
294 Ga0495670_0149111 3300046691 Bacteria 1226
295 Ga0495671_0124204 3300046692 Bacteria 1259
296 Ga0495649_0020989 3300046694 Bacteria 3661
297 Ga0495649_0062838 3300046694 Bacteria 1996
298 Ga0495600_0006144 3300046809 Bacteria 7278
299 Ga0495581_0000872 3300047315 Bacteria 16106
300 Ga0495581_0125375 3300047315 Bacteria 1495
301 Ga0495604_0006716 3300047317 Bacteria 9120
302 Ga0495604_0046086 3300047317 Bacteria 3400
303 Ga0495604_0114489 3300047317 Bacteria 1961
304 Ga0495674_0050585 3300047319 Bacteria 3666
305 Ga0495674_0078675 3300047319 Bacteria 2833
306 Ga0495672_0004803 3300047320 Bacteria 10899
307 Ga0495676_0004397 3300047321 Bacteria 12878
308 Ga0495680_0005428 3300047322 Bacteria 12004
309 Ga0495675_0001672 3300047444 Bacteria 13294
310 Ga0495684_0059910 3300047471 Bacteria 2898
311 Ga0495684_0099679 3300047471 Bacteria 2196
312 Ga0495684_0225375 3300047471 Bacteria 1373
313 Ga0495686_0000009 3300047472 Bacteria 661643
314 Ga0495686_0002116 3300047472 Bacteria 19445
315 Ga0495686_0032716 3300047472 Bacteria 3364
316 Ga0495686_0042323 3300047472 Bacteria 2897
317 Ga0495593_0024129 3300047673 Bacteria 3374
318 Ga0495614_0005797 3300048089 Bacteria 5563
319 Ga0495614_0015701 3300048089 Bacteria 3299
320 Ga0495614_0048383 3300048089 Unclassified 1823
321 Ga0496102_0059469 3300048905 Bacteria 3495
322 Ga0496103_0046981 3300048906 Bacteria 2666
323 Ga0496104_0000031 3300048907 Bacteria 194537
324 Ga0496104_0155423 3300048907 Bacteria 2195
325 Ga0496105_0011971 3300048908 Bacteria 6869
326 Ga0496105_0033714 3300048908 Bacteria 4207
327 Ga0496105_0136835 3300048908 Bacteria 2018
328 Ga0496108_0096180 3300048911 Bacteria 2522
329 Ga0496108_0427374 3300048911 Bacteria 1157
330 Ga0496109_0049253 3300048912 Bacteria 3835
331 Ga0496110_0051871 3300048913 Unclassified 3605
332 Ga0496111_0005350 3300048914 Bacteria 8206
333 Ga0496112_0006152 3300048915 Bacteria 10493
334 Ga0496112_0041195 3300048915 Bacteria 4517
335 Ga0496112_0077168 3300048915 Bacteria 3295
336 Ga0496113_0001005 3300048916 Bacteria 15120
337 Ga0496113_0029410 3300048916 Bacteria 3967
338 Ga0496115_0063980 3300048918 Bacteria 2969
339 Ga0496126_0000024 3300048929 Bacteria 462877
340 Ga0496126_0000111 3300048929 Bacteria 195620
341 Ga0496126_0000855 3300048929 Bacteria 53653
342 Ga0496126_0001781 3300048929 Bacteria 31809
343 Ga0495682_0035298 3300049460 Bacteria 1842
344 Ga0495682_0039735 3300049460 Bacteria 1727
345 Ga0501296_001888 3300049519 Bacteria 2139
346 Ga0501032_0002119 3300049569 Bacteria 15644
347 Ga0501033_0018089 3300049570 Bacteria 5324
348 Ga0501034_0030535 3300049571 Bacteria 5478
349 Ga0501036_0001980 3300049572 Bacteria 15885
350 Ga0501037_0043247 3300049573 Bacteria 3311
351 Ga0501037_0189575 3300049573 Bacteria 1456
352 Ga0501038_0017174 3300049574 Bacteria 6542
353 Ga0501038_0065445 3300049574 Bacteria 3097
354 Ga0501039_0044004 3300049575 Bacteria 3449
355 Ga0501041_0121186 3300049577 Bacteria 1626
356 Ga0501043_0000430 3300049579 Bacteria 37723
357 Ga0501046_0000371 3300049580 Bacteria 45434
358 Ga0501047_0013169 3300049581 Bacteria 7833
359 Ga0501070_0102455 3300049586 Bacteria 2368
360 Ga0501073_0008963 3300049589 Bacteria 7390
361 Ga0501079_0120750 3300049741 Bacteria 2038
362 Ga0501080_0096673 3300049742 Bacteria 2742
363 Ga0501080_0207214 3300049742 Bacteria 1798
364 Ga0501035_0002370 3300049822 Bacteria 18512
365 Ga0501035_0158172 3300049822 Bacteria 1963
366 Ga0501044_0012096 3300049823 Bacteria 9347
367 Ga0501044_0139960 3300049823 Bacteria 2409
368 nmdc:mga08y16_67519_c1 3300050511 Unclassified 3729
369 nmdc:mga08x19_230034_c1 3300050514 Bacteria 1276
370 nmdc:mga08x19_5161_c1 3300050514 Bacteria 7722
371 nmdc:mga08x19_91282_c1 3300050514 Unclassified 2010
372 nmdc:mga0a205_81826_c1 3300050515 Bacteria 3119
373 Ga0495601_0005560 3300053077 Bacteria 7350
374 Ga0495601_0039003 3300053077 Bacteria 2973
375 Ga0500644_0005231 3300053088 Bacteria 3268
376 Ga0500651_0000009 3300053093 Bacteria 270362
377 Ga0500572_019872 3300053111 Bacteria 1760
378 Ga0500595_000072 3300053119 Bacteria 71795
379 Ga0500661_001132 3300055283 Bacteria 4996

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300037853 Ga0436364_0220151 Ga0436364_0220151_637_1605 303
2 3300037853 Ga0436364_0350882 Ga0436364_0350882_4060_5028 303
3 3300010375 Ga0105239_10074740 Ga0105239_100747402 311
4 3300046477 Ga0495664_0038969 Ga0495664_0038969_1640_2608 312
5 3300046675 Ga0495657_0046027 Ga0495657_0046027_1287_2255 312
6 3300046684 Ga0495669_0077092 Ga0495669_0077092_351_1319 312
7 3300048918 Ga0496115_0063980 Ga0496115_0063980_1933_2901 312
8 3300005436 Ga0070713_100060805 Ga0070713_1000608051 313
9 3300005834 Ga0068851_10096141 Ga0068851_100961412 314
10 3300006847 Ga0075431_100081732 Ga0075431_1000817324 314
11 3300009147 Ga0114129_10458113 Ga0114129_104581132 314
12 3300013105 Ga0157369_10000493 Ga0157369_100004931 314
13 3300025945 Ga0207679_10173366 Ga0207679_101733661 314
14 3300046691 Ga0495670_0149111 Ga0495670_0149111_210_1187 314
15 3300031235 Ga0265330_10114389 Ga0265330_101143891 315
16 3300031247 Ga0265340_10015697 Ga0265340_100156974 315
17 3300031249 Ga0265339_10004422 Ga0265339_100044228 315
18 3300009093 Ga0105240_10111156 Ga0105240_101111562 316
19 3300026041 Ga0207639_10178497 Ga0207639_101784971 316
20 3300035410 Ga0373924_0000480 Ga0373924_0000480_2413_3408 316
21 3300035692 Ga0373935_0002908 Ga0373935_0002908_6409_7404 316
22 3300046683 Ga0495658_0088096 Ga0495658_0088096_767_1762 316
23 3300048089 Ga0495614_0048383 Ga0495614_0048383_422_1417 316
24 3300028666 Ga0265336_10001922 Ga0265336_100019226 317
25 3300039450 Ga0436363_0305441 Ga0436363_0305441_84_1091 317
26 3300045051 Ga0451576_0213212 Ga0451576_0213212_989_1969 317
27 3300045976 Ga0466967_0236164 Ga0466967_0236164_658_1653 317
28 3300046475 Ga0495639_0062174 Ga0495639_0062174_502_1473 317
29 3300050515 nmdc:mga0a205_81826_c1 nmdc:mga0a205_81826_c1_110_1090 317
30 3300046665 Ga0495661_0200063 Ga0495661_0200063_14_991 320
31 3300024225 Ga0224572_1002416 Ga0224572_10024162 321
32 3300025941 Ga0207711_10000014 Ga0207711_1000001491 321
33 3300053088 Ga0500644_0005231 Ga0500644_0005231_1485_2513 321
34 3300053111 Ga0500572_019872 Ga0500572_019872_100_1128 321
35 3300053093 Ga0500651_0000009 Ga0500651_0000009_51112_52092 322
36 3300046471 Ga0495650_0003543 Ga0495650_0003543_273_1253 323
37 3300046507 Ga0495606_0100233 Ga0495606_0100233_716_1699 323
38 3300046660 Ga0495625_0000166 Ga0495625_0000166_80676_81656 323
39 3300047320 Ga0495672_0004803 Ga0495672_0004803_9778_10758 323
40 3300046507 Ga0495606_0183406 Ga0495606_0183406_61_1035 324
41 3300046522 Ga0495643_0062087 Ga0495643_0062087_604_1578 324
42 3300046694 Ga0495649_0020989 Ga0495649_0020989_1602_2576 324
43 3300009177 Ga0105248_10203428 Ga0105248_102034282 325
44 3300021388 Ga0213875_10005551 Ga0213875_100055515 326
45 3300037471 Ga0395905_0021089 Ga0395905_0021089_728_1738 326
46 3300009093 Ga0105240_10229904 Ga0105240_102299041 328
47 3300009177 Ga0105248_10023865 Ga0105248_100238656 328
48 3300009545 Ga0105237_10197615 Ga0105237_101976153 328
49 3300013306 Ga0163162_10026438 Ga0163162_100264384 328
50 3300046462 Ga0495651_0082832 Ga0495651_0082832_55_1074 328
51 3300047317 Ga0495604_0046086 Ga0495604_0046086_2104_3123 328
52 3300047319 Ga0495674_0078675 Ga0495674_0078675_1565_2584 328
53 3300048908 Ga0496105_0136835 Ga0496105_0136835_658_1677 328
54 3300048911 Ga0496108_0427374 Ga0496108_0427374_59_1078 328
55 3300005467 Ga0070706_100171319 Ga0070706_1001713192 329
56 3300049577 Ga0501041_0121186 Ga0501041_0121186_511_1554 329
57 3300049741 Ga0501079_0120750 Ga0501079_0120750_934_1977 329
58 3300006852 Ga0075433_10081749 Ga0075433_100817493 330
59 3300039450 Ga0436363_1719984 Ga0436363_1719984_1407_2402 330
60 3300046454 Ga0495592_0013833 Ga0495592_0013833_1387_2391 330
61 3300046459 Ga0495629_0005458 Ga0495629_0005458_4464_5468 330
62 3300046462 Ga0495651_0011980 Ga0495651_0011980_653_1657 330
63 3300046463 Ga0495653_0000990 Ga0495653_0000990_5121_6125 330
64 3300046472 Ga0495580_0011991 Ga0495580_0011991_258_1262 330
65 3300046473 Ga0495582_0001593 Ga0495582_0001593_5365_6369 330
66 3300046475 Ga0495639_0001600 Ga0495639_0001600_4360_5364 330
67 3300046476 Ga0495662_0001212 Ga0495662_0001212_1483_2487 330
68 3300046477 Ga0495664_0060156 Ga0495664_0060156_1003_2007 330
69 3300046492 Ga0495585_0088320 Ga0495585_0088320_63_1067 330
70 3300046499 Ga0495594_0001145 Ga0495594_0001145_4177_5181 330
71 3300046516 Ga0495628_0043748 Ga0495628_0043748_910_1914 330
72 3300046517 Ga0495630_0195270 Ga0495630_0195270_350_1354 330
73 3300046526 Ga0495666_0001214 Ga0495666_0001214_5152_6156 330
74 3300046529 Ga0495652_0002436 Ga0495652_0002436_15675_16679 330
75 3300046531 Ga0495665_0004967 Ga0495665_0004967_5032_6036 330
76 3300046533 Ga0495640_0009155 Ga0495640_0009155_2691_3695 330
77 3300046535 Ga0495586_0000610 Ga0495586_0000610_4344_5348 330
78 3300046543 Ga0495645_0003197 Ga0495645_0003197_4854_5858 330
79 3300046557 Ga0495622_0026289 Ga0495622_0026289_1702_2706 330
80 3300046559 Ga0495667_0003403 Ga0495667_0003403_4961_5965 330
81 3300046642 Ga0495634_0003182 Ga0495634_0003182_10504_11508 330
82 3300046660 Ga0495625_0003450 Ga0495625_0003450_5023_6036 330
83 3300046663 Ga0495635_0005990 Ga0495635_0005990_4365_5369 330
84 3300046678 Ga0495599_0039228 Ga0495599_0039228_1350_2354 330
85 3300046679 Ga0495623_0033016 Ga0495623_0033016_2041_3045 330
86 3300046680 Ga0495646_0034039 Ga0495646_0034039_1654_2658 330
87 3300046689 Ga0495613_0013042 Ga0495613_0013042_997_2001 330
88 3300046690 Ga0495624_0005056 Ga0495624_0005056_3358_4362 330
89 3300046809 Ga0495600_0006144 Ga0495600_0006144_4471_5475 330
90 3300047315 Ga0495581_0000872 Ga0495581_0000872_5282_6286 330
91 3300047317 Ga0495604_0006716 Ga0495604_0006716_4473_5477 330
92 3300047319 Ga0495674_0050585 Ga0495674_0050585_383_1387 330
93 3300047321 Ga0495676_0004397 Ga0495676_0004397_11278_12282 330
94 3300047322 Ga0495680_0005428 Ga0495680_0005428_6815_7819 330
95 3300047444 Ga0495675_0001672 Ga0495675_0001672_11136_12140 330
96 3300047471 Ga0495684_0059910 Ga0495684_0059910_1806_2810 330
97 3300047673 Ga0495593_0024129 Ga0495593_0024129_1130_2134 330
98 3300048089 Ga0495614_0005797 Ga0495614_0005797_3938_4942 330
99 3300009094 Ga0111539_10062125 Ga0111539_100621253 331
100 3300025913 Ga0207695_10000001 Ga0207695_100000011854 331
101 3300031711 Ga0265314_10090549 Ga0265314_100905492 331
102 3300050511 nmdc:mga08y16_67519_c1 nmdc:mga08y16_67519_c1_2007_3023 331
103 3300050514 nmdc:mga08x19_5161_c1 nmdc:mga08x19_5161_c1_5237_6262 332
104 3300031344 Ga0265316_10023873 Ga0265316_100238735 333
105 3300031712 Ga0265342_10064194 Ga0265342_100641943 333
106 3300046471 Ga0495650_0000037 Ga0495650_0000037_234496_235512 333
107 3300046506 Ga0495583_0045346 Ga0495583_0045346_522_1538 333
108 3300049460 Ga0495682_0035298 Ga0495682_0035298_752_1768 333
109 3300055283 Ga0500661_001132 Ga0500661_001132_753_1766 333
110 3300005329 Ga0070683_100045717 Ga0070683_1000457173 334
111 3300005336 Ga0070680_100029891 Ga0070680_1000298913 334
112 3300005344 Ga0070661_100050778 Ga0070661_1000507781 334
113 3300005366 Ga0070659_100066297 Ga0070659_1000662972 334
114 3300005458 Ga0070681_10056765 Ga0070681_100567653 334
115 3300005539 Ga0068853_100010354 Ga0068853_1000103543 334
116 3300005577 Ga0068857_100003186 Ga0068857_1000031862 334
117 3300005578 Ga0068854_100012049 Ga0068854_1000120492 334
118 3300009093 Ga0105240_10022438 Ga0105240_100224388 334
119 3300009545 Ga0105237_10005705 Ga0105237_100057058 334
120 3300013105 Ga0157369_10169297 Ga0157369_101692972 334
121 3300025904 Ga0207647_10002648 Ga0207647_1000264812 334
122 3300025909 Ga0207705_10009375 Ga0207705_100093758 334
123 3300025913 Ga0207695_10079222 Ga0207695_100792223 334
124 3300025919 Ga0207657_10004594 Ga0207657_100045947 334
125 3300025932 Ga0207690_10100334 Ga0207690_101003341 334
126 3300025981 Ga0207640_10003704 Ga0207640_100037046 334
127 3300026067 Ga0207678_10011984 Ga0207678_100119842 334
128 3300026116 Ga0207674_10002385 Ga0207674_1000238517 334
129 3300005327 Ga0070658_10000101 Ga0070658_1000010125 335
130 3300005327 Ga0070658_10063392 Ga0070658_100633922 335
131 3300005364 Ga0070673_100246045 Ga0070673_1002460452 335
132 3300005457 Ga0070662_100343407 Ga0070662_1003434071 335
133 3300005563 Ga0068855_100198390 Ga0068855_1001983901 335
134 3300013104 Ga0157370_10022847 Ga0157370_100228474 335
135 3300013105 Ga0157369_10074160 Ga0157369_100741602 335
136 3300013307 Ga0157372_10007624 Ga0157372_100076247 335
137 3300025909 Ga0207705_10000109 Ga0207705_1000010944 335
138 3300025909 Ga0207705_10019360 Ga0207705_100193604 335
139 3300025924 Ga0207694_10006015 Ga0207694_100060154 335
140 3300025928 Ga0207700_10010139 Ga0207700_100101394 335
141 3300046462 Ga0495651_0074686 Ga0495651_0074686_611_1621 335
142 3300046516 Ga0495628_0021455 Ga0495628_0021455_3309_4319 335
143 3300046536 Ga0495587_0036728 Ga0495587_0036728_1119_2129 335
144 3300046543 Ga0495645_0011176 Ga0495645_0011176_3134_4144 335
145 3300046663 Ga0495635_0064550 Ga0495635_0064550_1319_2329 335
146 3300047317 Ga0495604_0114489 Ga0495604_0114489_608_1618 335
147 3300047471 Ga0495684_0099679 Ga0495684_0099679_112_1122 335
148 3300048929 Ga0496126_0000024 Ga0496126_0000024_339690_340709 335
149 3300048929 Ga0496126_0001781 Ga0496126_0001781_6551_7561 335
150 3300003320 rootH2_10162621 rootH2_101626211 336
151 3300005366 Ga0070659_100018303 Ga0070659_1000183036 336
152 3300005539 Ga0068853_100000087 Ga0068853_10000008736 336
153 3300005548 Ga0070665_100067214 Ga0070665_1000672143 336
154 3300005563 Ga0068855_100056118 Ga0068855_1000561184 336
155 3300005578 Ga0068854_100000037 Ga0068854_10000003772 336
156 3300005841 Ga0068863_100025950 Ga0068863_1000259504 336
157 3300006846 Ga0075430_100019532 Ga0075430_1000195325 336
158 3300009093 Ga0105240_10000001 Ga0105240_100000011850 336
159 3300009093 Ga0105240_10012499 Ga0105240_100124991 336
160 3300009177 Ga0105248_10061490 Ga0105248_100614903 336
161 3300013104 Ga0157370_10024705 Ga0157370_100247054 336
162 3300013296 Ga0157374_10009573 Ga0157374_100095733 336
163 3300014969 Ga0157376_10010898 Ga0157376_100108986 336
164 3300025903 Ga0207680_10009735 Ga0207680_100097354 336
165 3300025909 Ga0207705_10024264 Ga0207705_100242642 336
166 3300025912 Ga0207707_10142041 Ga0207707_101420413 336
167 3300025913 Ga0207695_10020263 Ga0207695_100202637 336
168 3300025919 Ga0207657_10134899 Ga0207657_101348991 336
169 3300025932 Ga0207690_10001283 Ga0207690_100012833 336
170 3300025949 Ga0207667_10056370 Ga0207667_100563703 336
171 3300025981 Ga0207640_10000002 Ga0207640_1000000270 336
172 3300025981 Ga0207640_10135897 Ga0207640_101358971 336
173 3300026041 Ga0207639_10000071 Ga0207639_1000007118 336
174 3300046455 Ga0495603_0001136 Ga0495603_0001136_1037_2059 336
175 3300046459 Ga0495629_0007756 Ga0495629_0007756_1302_2324 336
176 3300046472 Ga0495580_0006575 Ga0495580_0006575_7068_8090 336
177 3300046472 Ga0495580_0012833 Ga0495580_0012833_2080_3102 336
178 3300046473 Ga0495582_0021365 Ga0495582_0021365_1958_2980 336
179 3300046492 Ga0495585_0014002 Ga0495585_0014002_57_1079 336
180 3300046499 Ga0495594_0000357 Ga0495594_0000357_12400_13422 336
181 3300046523 Ga0495644_0000004 Ga0495644_0000004_116856_117878 336
182 3300046528 Ga0495642_0031077 Ga0495642_0031077_949_1971 336
183 3300046538 Ga0495609_0007019 Ga0495609_0007019_487_1509 336
184 3300046558 Ga0495633_0016249 Ga0495633_0016249_795_1817 336
185 3300046616 Ga0495668_0030486 Ga0495668_0030486_1035_2054 336
186 3300046648 Ga0495611_0060758 Ga0495611_0060758_344_1366 336
187 3300046660 Ga0495625_0012010 Ga0495625_0012010_364_1386 336
188 3300046660 Ga0495625_0041280 Ga0495625_0041280_1405_2424 336
189 3300046684 Ga0495669_0001203 Ga0495669_0001203_8122_9144 336
190 3300046689 Ga0495613_0058457 Ga0495613_0058457_15_1037 336
191 3300046691 Ga0495670_0014600 Ga0495670_0014600_767_1789 336
192 3300046692 Ga0495671_0124204 Ga0495671_0124204_145_1164 336
193 3300046694 Ga0495649_0062838 Ga0495649_0062838_433_1452 336
194 3300047315 Ga0495581_0125375 Ga0495581_0125375_27_1049 336
195 3300047471 Ga0495684_0225375 Ga0495684_0225375_288_1310 336
196 3300047472 Ga0495686_0002116 Ga0495686_0002116_13822_14838 336
197 3300047472 Ga0495686_0032716 Ga0495686_0032716_330_1346 336
198 3300048089 Ga0495614_0015701 Ga0495614_0015701_1592_2614 336
199 3300048929 Ga0496126_0000855 Ga0496126_0000855_52392_53414 336
200 3300049460 Ga0495682_0039735 Ga0495682_0039735_480_1499 336
201 3300053119 Ga0500595_000072 Ga0500595_000072_12649_13671 336
202 3300005355 Ga0070671_100216904 Ga0070671_1002169041 337
203 3300005435 Ga0070714_100272213 Ga0070714_1002722132 337
204 3300009093 Ga0105240_10000284 Ga0105240_1000028480 337
205 3300009093 Ga0105240_10157977 Ga0105240_101579772 337
206 3300009098 Ga0105245_10023721 Ga0105245_100237212 337
207 3300009177 Ga0105248_10000666 Ga0105248_1000066611 337
208 3300009551 Ga0105238_10028771 Ga0105238_100287711 337
209 3300010375 Ga0105239_10000334 Ga0105239_1000033411 337
210 3300013306 Ga0163162_10138976 Ga0163162_101389762 337
211 3300013307 Ga0157372_10349679 Ga0157372_103496791 337
212 3300025922 Ga0207646_10000044 Ga0207646_10000044136 337
213 3300025924 Ga0207694_10000105 Ga0207694_100001055 337
214 3300025927 Ga0207687_10063381 Ga0207687_100633812 337
215 3300025931 Ga0207644_10084107 Ga0207644_100841071 337
216 3300025941 Ga0207711_10000606 Ga0207711_1000060611 337
217 3300026067 Ga0207678_10189674 Ga0207678_101896742 337
218 3300026067 Ga0207678_10222031 Ga0207678_102220311 337
219 3300035724 Ga0373933_0191727 Ga0373933_0191727_261_1289 337
220 3300046517 Ga0495630_0295553 Ga0495630_0295553_19_1047 337
221 3300046531 Ga0495665_0193255 Ga0495665_0193255_18_1046 337
222 3300046679 Ga0495623_0216596 Ga0495623_0216596_46_1074 337
223 3300005539 Ga0068853_100120350 Ga0068853_1001203502 338
224 3300006028 Ga0070717_10033376 Ga0070717_100333762 338
225 3300006175 Ga0070712_100012127 Ga0070712_1000121272 338
226 3300013104 Ga0157370_10081865 Ga0157370_100818651 338
227 3300025921 Ga0207652_10094372 Ga0207652_100943723 338
228 3300025939 Ga0207665_10083780 Ga0207665_100837802 338
229 3300026041 Ga0207639_10064133 Ga0207639_100641333 338
230 3300026078 Ga0207702_10066294 Ga0207702_100662943 338
231 3300028800 Ga0265338_10121980 Ga0265338_101219801 338
232 3300031344 Ga0265316_10207386 Ga0265316_102073861 338
233 3300035410 Ga0373924_0017803 Ga0373924_0017803_807_1868 338
234 3300048906 Ga0496103_0046981 Ga0496103_0046981_1289_2347 338
235 3300048913 Ga0496110_0051871 Ga0496110_0051871_461_1519 338
236 3300048914 Ga0496111_0005350 Ga0496111_0005350_5666_6724 338
237 3300005338 Ga0068868_100013663 Ga0068868_1000136633 339
238 3300005436 Ga0070713_100043699 Ga0070713_1000436991 339
239 3300005439 Ga0070711_100192003 Ga0070711_1001920032 339
240 3300005539 Ga0068853_100233665 Ga0068853_1002336652 339
241 3300005834 Ga0068851_10053821 Ga0068851_100538212 339
242 3300006028 Ga0070717_10085981 Ga0070717_100859812 339
243 3300006175 Ga0070712_100096935 Ga0070712_1000969352 339
244 3300009098 Ga0105245_10007271 Ga0105245_100072712 339
245 3300009551 Ga0105238_10062700 Ga0105238_100627003 339
246 3300013297 Ga0157378_10026245 Ga0157378_100262452 339
247 3300013307 Ga0157372_10226892 Ga0157372_102268922 339
248 3300025912 Ga0207707_10232448 Ga0207707_102324482 339
249 3300025912 Ga0207707_10286783 Ga0207707_102867832 339
250 3300025913 Ga0207695_10072415 Ga0207695_100724152 339
251 3300025915 Ga0207693_10240440 Ga0207693_102404402 339
252 3300025944 Ga0207661_10024098 Ga0207661_100240983 339
253 3300025949 Ga0207667_10219203 Ga0207667_102192032 339
254 3300031344 Ga0265316_10199062 Ga0265316_101990622 339
255 3300035172 Ga0373955_0007765 Ga0373955_0007765_795_1859 339
256 3300035172 Ga0373955_0069357 Ga0373955_0069357_300_1364 339
257 3300035410 Ga0373924_0112556 Ga0373924_0112556_93_1157 339
258 3300035695 Ga0373927_0090353 Ga0373927_0090353_119_1183 339
259 3300035725 Ga0373947_0002500 Ga0373947_0002500_1818_2882 339
260 3300036401 Ga0373937_0005568 Ga0373937_0005568_3569_4633 339
261 3300036401 Ga0373937_0045966 Ga0373937_0045966_49_1113 339
262 3300037068 Ga0373925_0010869 Ga0373925_0010869_875_1939 339
263 3300037418 Ga0395900_0155592 Ga0395900_0155592_127_1155 339
264 3300037466 Ga0395898_0100335 Ga0395898_0100335_1472_2500 339
265 3300046462 Ga0495651_0040058 Ga0495651_0040058_1816_2886 339
266 3300046475 Ga0495639_0068792 Ga0495639_0068792_369_1433 339
267 3300048907 Ga0496104_0155423 Ga0496104_0155423_658_1722 339
268 3300048908 Ga0496105_0011971 Ga0496105_0011971_5216_6280 339
269 3300048915 Ga0496112_0006152 Ga0496112_0006152_6332_7396 339
270 3300048915 Ga0496112_0077168 Ga0496112_0077168_959_2023 339
271 3300048916 Ga0496113_0001005 Ga0496113_0001005_5544_6608 339
272 3300050514 nmdc:mga08x19_91282_c1 nmdc:mga08x19_91282_c1_168_1232 339
273 3300053077 Ga0495601_0005560 Ga0495601_0005560_5289_6359 339
274 3300005436 Ga0070713_100016676 Ga0070713_1000166762 340
275 3300005983 Ga0081540_1007286 Ga0081540_10072867 340
276 3300014969 Ga0157376_10017216 Ga0157376_100172163 340
277 3300025921 Ga0207652_10305242 Ga0207652_103052422 340
278 3300031712 Ga0265342_10149178 Ga0265342_101491781 340
279 3300044842 Ga0466957_0000190 Ga0466957_0000190_6144_7208 340
280 3300006914 Ga0075436_100032651 Ga0075436_1000326512 341
281 3300025927 Ga0207687_10034262 Ga0207687_100342622 341
282 3300025928 Ga0207700_10057132 Ga0207700_100571322 341
283 3300026041 Ga0207639_10022782 Ga0207639_100227822 341
284 3300028653 Ga0265323_10032855 Ga0265323_100328552 341
285 3300031344 Ga0265316_10025821 Ga0265316_100258215 341
286 3300031712 Ga0265342_10014307 Ga0265342_100143075 341
287 3300037068 Ga0373925_0028029 Ga0373925_0028029_263_1318 341
288 3300039437 Ga0436365_0702050 Ga0436365_0702050_2209_3270 341
289 3300039450 Ga0436363_0317733 Ga0436363_0317733_3235_4296 341
290 3300039453 Ga0436362_1024607 Ga0436362_1024607_1241_2302 341
291 3300050514 nmdc:mga08x19_230034_c1 nmdc:mga08x19_230034_c1_153_1208 341
292 iso_pu_bacteria 2884215851 2884218523 341
293 3300005616 Ga0068852_100024010 Ga0068852_1000240101 342
294 3300025929 Ga0207664_10131293 Ga0207664_101312932 342
295 3300026142 Ga0207698_10045026 Ga0207698_100450262 342
296 3300049519 Ga0501296_001888 Ga0501296_001888_626_1672 342
297 3300005548 Ga0070665_100063399 Ga0070665_1000633991 343
298 3300006163 Ga0070715_10024527 Ga0070715_100245272 343
299 3300025906 Ga0207699_10045527 Ga0207699_100455272 343
300 3300025925 Ga0207650_10169832 Ga0207650_101698321 343
301 3300025939 Ga0207665_10002689 Ga0207665_100026892 343
302 3300028800 Ga0265338_10118311 Ga0265338_101183112 343
303 3300009551 Ga0105238_10383272 Ga0105238_103832721 345
304 3300031344 Ga0265316_10182656 Ga0265316_101826562 345
305 3300049569 Ga0501032_0002119 Ga0501032_0002119_3967_5019 345
306 3300049570 Ga0501033_0018089 Ga0501033_0018089_204_1256 345
307 3300049571 Ga0501034_0030535 Ga0501034_0030535_359_1411 345
308 3300049572 Ga0501036_0001980 Ga0501036_0001980_12447_13499 345
309 3300049573 Ga0501037_0043247 Ga0501037_0043247_2056_3108 345
310 3300049574 Ga0501038_0017174 Ga0501038_0017174_2655_3707 345
311 3300049575 Ga0501039_0044004 Ga0501039_0044004_1823_2875 345
312 3300049579 Ga0501043_0000430 Ga0501043_0000430_30743_31795 345
313 3300049580 Ga0501046_0000371 Ga0501046_0000371_33903_34955 345
314 3300049581 Ga0501047_0013169 Ga0501047_0013169_5285_6337 345
315 3300049589 Ga0501073_0008963 Ga0501073_0008963_4784_5836 345
316 3300049742 Ga0501080_0096673 Ga0501080_0096673_978_2030 345
317 3300049822 Ga0501035_0002370 Ga0501035_0002370_4883_5935 345
318 3300049823 Ga0501044_0012096 Ga0501044_0012096_4355_5407 345
319 3300005435 Ga0070714_100000338 Ga0070714_10000033821 346
320 3300021361 Ga0213872_10096404 Ga0213872_100964042 346
321 3300025924 Ga0207694_10044474 Ga0207694_100444742 346
322 3300025941 Ga0207711_10017586 Ga0207711_100175862 346
323 3300039438 Ga0436360_1093448 Ga0436360_1093448_2908_3966 346
324 3300039447 Ga0436361_0927715 Ga0436361_0927715_298_1344 346
325 3300046543 Ga0495645_0022866 Ga0495645_0022866_114_1163 346
326 3300049573 Ga0501037_0189575 Ga0501037_0189575_56_1111 346
327 3300049574 Ga0501038_0065445 Ga0501038_0065445_1893_2948 346
328 3300049586 Ga0501070_0102455 Ga0501070_0102455_111_1166 346
329 3300049742 Ga0501080_0207214 Ga0501080_0207214_18_1073 346
330 3300049822 Ga0501035_0158172 Ga0501035_0158172_832_1887 346
331 3300049823 Ga0501044_0139960 Ga0501044_0139960_1068_2123 346
332 3300053077 Ga0495601_0039003 Ga0495601_0039003_1504_2553 346
333 3300005530 Ga0070679_100001106 Ga0070679_10000110615 347
334 3300025261 Ga0209233_1002583 Ga0209233_10025836 347
335 3300025921 Ga0207652_10001024 Ga0207652_1000102415 347
336 3300033180 Ga0307510_10027300 Ga0307510_100273006 347
337 3300047472 Ga0495686_0000009 Ga0495686_0000009_345582_346652 347
338 3300047472 Ga0495686_0042323 Ga0495686_0042323_409_1479 347
339 3300048907 Ga0496104_0000031 Ga0496104_0000031_11639_12709 347
340 3300005347 Ga0070668_100400164 Ga0070668_1004001641 348
341 3300005366 Ga0070659_100209575 Ga0070659_1002095752 348
342 3300005548 Ga0070665_100094330 Ga0070665_1000943302 348
343 3300005563 Ga0068855_100028854 Ga0068855_1000288542 348
344 3300009093 Ga0105240_10012026 Ga0105240_100120262 348
345 3300013104 Ga0157370_10030637 Ga0157370_100306372 348
346 3300013104 Ga0157370_10092680 Ga0157370_100926803 348
347 3300013104 Ga0157370_10316553 Ga0157370_103165532 348
348 3300013105 Ga0157369_10014314 Ga0157369_100143142 348
349 3300013296 Ga0157374_10219923 Ga0157374_102199232 348
350 3300013307 Ga0157372_10013516 Ga0157372_100135165 348
351 3300013307 Ga0157372_10111373 Ga0157372_101113734 348
352 3300025261 Ga0209233_1007762 Ga0209233_10077622 348
353 3300025913 Ga0207695_10014790 Ga0207695_1001479010 348
354 3300025949 Ga0207667_10005429 Ga0207667_1000542919 348
355 3300026088 Ga0207641_10006824 Ga0207641_100068247 348
356 3300028379 Ga0268266_10002541 Ga0268266_1000254119 348
357 3300028379 Ga0268266_10024683 Ga0268266_100246833 348
358 3300044684 Ga0466966_0102499 Ga0466966_0102499_406_1461 348
359 3300045049 Ga0466959_0045149 Ga0466959_0045149_2026_3081 348
360 3300048929 Ga0496126_0000111 Ga0496126_0000111_82755_83828 348
361 3300003316 rootH1_10049638 rootH1_100496384 349
362 3300005327 Ga0070658_10026098 Ga0070658_100260983 349
363 3300005455 Ga0070663_100022896 Ga0070663_1000228963 349
364 3300005548 Ga0070665_100042719 Ga0070665_1000427193 349
365 3300005614 Ga0068856_100196015 Ga0068856_1001960151 349
366 3300013105 Ga0157369_10036136 Ga0157369_100361363 349
367 3300014325 Ga0163163_10318946 Ga0163163_103189462 349
368 3300014969 Ga0157376_10049914 Ga0157376_100499141 349
369 3300025904 Ga0207647_10013174 Ga0207647_100131742 349
370 3300025913 Ga0207695_10051710 Ga0207695_100517102 349
371 3300025919 Ga0207657_10077410 Ga0207657_100774102 349
372 3300025949 Ga0207667_10043023 Ga0207667_100430233 349
373 3300045049 Ga0466959_0044258 Ga0466959_0044258_61_1149 349
374 3300045836 Ga0466958_0043520 Ga0466958_0043520_1300_2358 349
375 3300048905 Ga0496102_0059469 Ga0496102_0059469_23_1081 349
376 3300048908 Ga0496105_0033714 Ga0496105_0033714_379_1437 349
377 3300048911 Ga0496108_0096180 Ga0496108_0096180_955_2013 349
378 3300048912 Ga0496109_0049253 Ga0496109_0049253_531_1589 349
379 3300048915 Ga0496112_0041195 Ga0496112_0041195_1846_2904 349
380 3300048916 Ga0496113_0029410 Ga0496113_0029410_2524_3582 349

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF04055

Radical_SAM

Radical SAM superfamily

96

240

0.9

PF13353

Fer4_12

4Fe-4S single cluster domain

93

219

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
6efn-assembly1.cif.gz_A-2 structure of a ripp maturase, skfb 0.7626 41 298
4u0p-assembly1.cif.gz_B the crystal structure of lipoyl synthase in complex with s-adenosyl homocysteine 0.7371 44 237
2a5h-assembly1.cif.gz_D 2.1 angstrom x-ray crystal structure of lysine-2,3-aminomutase from clostridium subterminale sb4, with michaelis analog (l-alpha-lysine external aldimine form of pyridoxal-5'-phosphate). 0.7294 41 207
5ff4-assembly1.cif.gz_A hyde from t. maritima in complex with (2r,4r)-tmetda 0.7264 42 211
4u0o-assembly1.cif.gz_B crystal structure of thermosynechococcus elongatus lipoyl synthase 2 complexed with mta and dtt 0.7255 44 237
ID Description Score Start End Superfamily
af_Q59026_29_239_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7639 46 237 3.20.20.70
af_Q57888_1_320_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.763 41 211 3.20.20.70
af_Q2FX16_20_293_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7278 41 237 3.20.20.70
2a5hB02 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7265 41 207 3.20.20.70
af_P0CH67_115_331_3.20.20.70 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Aldolase class I 0.7239 42 214 3.20.20.70
ID Description Score Start End GO Terms
AF-A0A3N5XMT7-F1-model_v4 Radical SAM protein 0.9635 17 321 GO:0003824
GO:0046872
GO:0051536
AF-A0A3N5XMT7-F1-model_v4 Radical SAM protein 0.9543 17 321 GO:0003824
GO:0046872
GO:0051536
AF-A0A7C2X8A6-F1-model_v4 Radical SAM protein 0.9506 32 341 GO:0003824
GO:0046872
GO:0051536
AF-A0A2V8FWE1-F1-model_v4 Radical SAM protein 0.9456 44 332 GO:0003824
GO:0046872
GO:0051536
AF-A0A2V9TXE9-F1-model_v4 Radical SAM protein 0.9409 16 236 GO:0003824
GO:0046872
GO:0051536

Feature Viewer

pLDDT pTM Quality
81.16 0.84 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map