F428671

General Info

Members Datasets Scaffolds Average Seq Length
380 232 377 291

Family's Representative Sequence

Representative Sequence 3300025233|Ga0209437_103578|Ga0209437_1035782
Length 331
Sequence MTWMTRRNFNVTAAIAAAAPLTVNRDDSSTGTTVRQEPRLKIVPRMEFRLVDVFSKEPLSGNGLVVFMSNERVSPDMMQALTREMRQFESIFLESTNNPSVVKARVFTMEEELDFAGHPLLGAAAALHEQRLPEKQVASWTIELRHKTIPVTTTREKSWYRANMNQGEAEFGKTLSMEESKPFLAALNLKTTQVAKSLPLQQVSTGLPYLIVPISDGLENARIVQSDFESLLATVGAKFVYVLDVNQREGRTWDNQGLVEDVATGSAAGPVGAYLVRQKIIEPGHELVLRQGRFVGRPSLLFVTVQATATGRFEVSVAGDVRLIARGRLGA

Samples

Sample ID Description Type Environment
1 2511231002 Polaromonas sp. CF318 Isolate Rhizosphere
2 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
3 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
4 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
5 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
6 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
7 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
8 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
9 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
10 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
11 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
12 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
13 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
14 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
15 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
16 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
17 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
18 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
19 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
20 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
21 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
22 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
23 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
24 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
25 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
26 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
27 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
28 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
29 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
30 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
31 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
32 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
33 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
34 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
35 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
38 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
44 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
48 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
49 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
50 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
51 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
52 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
61 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
62 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
63 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
64 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
65 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
66 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
67 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
68 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
69 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
70 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
71 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
72 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
73 3300012513 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.old.250510 Metagenome Rhizosphere
74 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
75 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
76 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
77 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
78 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
79 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
80 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
81 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
82 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
83 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
84 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
85 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
86 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
87 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
88 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
89 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
90 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
91 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
92 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
93 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
94 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
95 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
96 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
97 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
98 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
99 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
100 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
101 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
102 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
103 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
104 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
105 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
106 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
142 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
143 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
144 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
145 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
146 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
147 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
148 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
149 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
150 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
151 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
152 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
153 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
154 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
155 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
156 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
157 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
158 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
159 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
160 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
161 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
164 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
165 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
166 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
167 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
168 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
169 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
170 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
171 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
172 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
173 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
174 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
175 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
176 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
177 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
178 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
179 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
180 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
181 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
182 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
183 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
184 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
185 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
186 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
187 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
188 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
189 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
190 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
191 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
192 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
193 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
194 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
195 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
196 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
197 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
198 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
199 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
200 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
201 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
202 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
203 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
204 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
205 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
206 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
207 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
208 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
209 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
210 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
211 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
212 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
213 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
214 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
215 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
216 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
217 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
220 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
221 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
222 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
223 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
224 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
225 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
226 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
227 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
228 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
229 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
230 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
231 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
232 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.95
Metatranscriptomes 0.26
Isolates 0.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 16.32
Nodule 0
Rhizoplane 3.95
Rhizosphere 74.21
Stem 0
Stem Tuber 0
Unclassified 5.53

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24736J21556_1001290 3300001904 Bacteria 4594
2 JGI24740J21852_10000328 3300001979 Bacteria 20047
3 JGI25155J39150_1000098 3300002704 Bacteria 48725
4 JGI25156J39149_1000163 3300002705 Bacteria 48762
5 JGI25154J39366_1000183 3300002738 Bacteria 48762
6 JGI25157J39369_1000209 3300002741 Bacteria 48762
7 JGI25150J39212_1001877 3300002774 Bacteria 5537
8 JGI25159J45721_1001207 3300002987 Bacteria 10956
9 JGI25159J45721_1004564 3300002987 Bacteria 4562
10 JGI25151J46595_10002055 3300003187 Bacteria 12566
11 rootH1_10152290 3300003316 Unclassified 1917
12 rootH1_10034446 3300003323 Bacteria 2526
13 rootH1_10282976 3300003323 Unclassified 1230
14 JGI25160J50197_1000212 3300003354 Bacteria 47984
15 JGI25161J50226_1000151 3300003374 Bacteria 47984
16 Ga0055526_1000958 3300003771 Bacteria 21286
17 Ga0055526_1005848 3300003771 Bacteria 6907
18 Ga0055537_1000084 3300003773 Bacteria 68680
19 Ga0055537_1007230 3300003773 Bacteria 2703
20 Ga0055524_1000082 3300003775 Bacteria 119749
21 Ga0055534_1002638 3300003784 Bacteria 6088
22 Ga0055528_1001888 3300003790 Bacteria 11933
23 Ga0055530_10001442 3300003791 Bacteria 17391
24 Ga0055540_1000010 3300003792 Bacteria 290865
25 Ga0055531_10000461 3300003794 Bacteria 37626
26 Ga0055543_1000394 3300004625 Bacteria 27958
27 Ga0065165_1005448 3300005262 Bacteria 7147
28 Ga0065165_1010042 3300005262 Bacteria 4157
29 Ga0065165_1023417 3300005262 Bacteria 2095
30 Ga0065165_1042841 3300005262 Bacteria 1333
31 Ga0070658_10000059 3300005327 Bacteria 112781
32 Ga0070683_100008694 3300005329 Bacteria 8634
33 Ga0070690_100109738 3300005330 Bacteria 1839
34 Ga0070666_10016597 3300005335 Unclassified 4711
35 Ga0070680_100064016 3300005336 Unclassified 3013
36 Ga0070680_100354177 3300005336 Unclassified 1248
37 Ga0070682_100030079 3300005337 Bacteria 3274
38 Ga0068868_100384980 3300005338 Bacteria 1207
39 Ga0070660_100002661 3300005339 Bacteria 12268
40 Ga0070691_10000433 3300005341 Bacteria 15463
41 Ga0070671_100003166 3300005355 Bacteria 12836
42 Ga0070671_100013393 3300005355 Bacteria 6611
43 Ga0070659_100019554 3300005366 Bacteria 5134
44 Ga0070667_100013576 3300005367 Bacteria 6731
45 Ga0070713_100000603 3300005436 Bacteria 22834
46 Ga0070713_100152272 3300005436 Bacteria 2058
47 Ga0070713_100160124 3300005436 Bacteria 2008
48 Ga0070711_100040670 3300005439 Unclassified 3136
49 Ga0070708_100229404 3300005445 Bacteria 1742
50 Ga0070681_10057167 3300005458 Bacteria 3881
51 Ga0070681_10111687 3300005458 Unclassified 2672
52 Ga0070681_10261772 3300005458 Bacteria 1641
53 Ga0070681_10306941 3300005458 Bacteria 1496
54 Ga0070681_10610877 3300005458 Bacteria 1005
55 Ga0070679_100032218 3300005530 Bacteria 5182
56 Ga0070679_100082804 3300005530 Bacteria 3198
57 Ga0070679_100101386 3300005530 Unclassified 2865
58 Ga0070684_100000079 3300005535 Bacteria 63157
59 Ga0070684_100139105 3300005535 Bacteria 2195
60 Ga0068853_100031597 3300005539 Bacteria 4479
61 Ga0070672_100467127 3300005543 Bacteria 1088
62 Ga0070696_100210192 3300005546 Unclassified 1456
63 Ga0070665_100000002 3300005548 Bacteria 849037
64 Ga0068855_100011557 3300005563 Bacteria 10662
65 Ga0068855_100227601 3300005563 Unclassified 2089
66 Ga0070664_100032000 3300005564 Bacteria 4399
67 Ga0068857_100001971 3300005577 Bacteria 16594
68 Ga0068857_100025208 3300005577 Bacteria 5237
69 Ga0068856_100036841 3300005614 Bacteria 4797
70 Ga0068856_100052677 3300005614 Unclassified 4013
71 Ga0068856_100059111 3300005614 Bacteria 3786
72 Ga0068856_100074285 3300005614 Unclassified 3366
73 Ga0068852_100089523 3300005616 Bacteria 2751
74 Ga0068852_100148855 3300005616 Bacteria 2175
75 Ga0068852_100261053 3300005616 Bacteria 1663
76 Ga0068864_100026930 3300005618 Bacteria 4850
77 Ga0068864_100056346 3300005618 Bacteria 3395
78 Ga0068851_10009522 3300005834 Unclassified 4520
79 Ga0068863_100055538 3300005841 Unclassified 3750
80 Ga0068863_100280724 3300005841 Bacteria 1614
81 Ga0068858_100116675 3300005842 Bacteria 2495
82 Ga0068858_100211894 3300005842 Unclassified 1833
83 Ga0068860_100000019 3300005843 Bacteria 299860
84 Ga0068860_100209985 3300005843 Unclassified 1888
85 Ga0068862_100041126 3300005844 Bacteria 3932
86 Ga0075362_10023486 3300006177 Bacteria 2608
87 Ga0075370_10146151 3300006353 Bacteria 1384
88 Ga0068871_100158296 3300006358 Bacteria 1935
89 Ga0075428_100064568 3300006844 Bacteria 4009
90 Ga0075431_100028837 3300006847 Bacteria 5707
91 Ga0105240_10000607 3300009093 Bacteria 66455
92 Ga0105240_10046895 3300009093 Bacteria 5472
93 Ga0105240_10165405 3300009093 Bacteria 2624
94 Ga0105240_10290640 3300009093 Unclassified 1874
95 Ga0105247_10015185 3300009101 Bacteria 4617
96 Ga0105241_10011338 3300009174 Bacteria 6534
97 Ga0105241_10170958 3300009174 Bacteria 1795
98 Ga0105241_10172883 3300009174 Bacteria 1786
99 Ga0105242_10028876 3300009176 Unclassified 4419
100 Ga0105248_10001858 3300009177 Bacteria 23422
101 Ga0105248_10007623 3300009177 Bacteria 11890
102 Ga0105248_10055784 3300009177 Bacteria 4433
103 Ga0105248_10125720 3300009177 Unclassified 2893
104 Ga0105248_10126478 3300009177 Unclassified 2883
105 Ga0105237_10002039 3300009545 Bacteria 25680
106 Ga0105237_10019463 3300009545 Bacteria 7010
107 Ga0105237_10070699 3300009545 Bacteria 3486
108 Ga0105237_10192432 3300009545 Bacteria 2039
109 Ga0105237_10328889 3300009545 Bacteria 1532
110 Ga0105238_10023933 3300009551 Bacteria 6225
111 Ga0105238_10063887 3300009551 Unclassified 3682
112 Ga0105238_10132638 3300009551 Unclassified 2469
113 Ga0105238_10275769 3300009551 Bacteria 1662
114 Ga0105238_10431647 3300009551 Bacteria 1313
115 Ga0105239_10000195 3300010375 Bacteria 88195
116 Ga0105239_10008295 3300010375 Bacteria 11841
117 Ga0105239_10120633 3300010375 Bacteria 2912
118 Ga0105239_10362408 3300010375 Bacteria 1637
119 Ga0105239_10543359 3300010375 Unclassified 1323
120 Ga0105239_10776179 3300010375 Bacteria 1097
121 Ga0157326_1002087 3300012513 Bacteria 2165
122 Ga0157373_10056327 3300013100 Bacteria 2792
123 Ga0157373_10078214 3300013100 Bacteria 2333
124 Ga0157370_10001646 3300013104 Bacteria 27589
125 Ga0157370_10018539 3300013104 Bacteria 6997
126 Ga0157370_10068197 3300013104 Unclassified 3362
127 Ga0157370_10108255 3300013104 Unclassified 2599
128 Ga0157369_10006631 3300013105 Bacteria 13389
129 Ga0157369_10235321 3300013105 Bacteria 1914
130 Ga0157374_10128423 3300013296 Bacteria 2451
131 Ga0157374_10521587 3300013296 Bacteria 1194
132 Ga0157378_10172624 3300013297 Bacteria 2029
133 Ga0163162_10000625 3300013306 Bacteria 32864
134 Ga0163162_10013855 3300013306 Bacteria 7875
135 Ga0163162_10058120 3300013306 Bacteria 3896
136 Ga0163162_10072773 3300013306 Bacteria 3492
137 Ga0157372_10005642 3300013307 Bacteria 13304
138 Ga0157372_10038992 3300013307 Bacteria 5243
139 Ga0157372_10050687 3300013307 Bacteria 4617
140 Ga0157372_10094125 3300013307 Unclassified 3411
141 Ga0157372_10132357 3300013307 Bacteria 2870
142 Ga0157372_10173772 3300013307 Bacteria 2493
143 Ga0157372_10481864 3300013307 Unclassified 1446
144 Ga0157375_10007976 3300013308 Bacteria 9270
145 Ga0157375_10324551 3300013308 Unclassified 1704
146 Ga0157379_10032440 3300014968 Bacteria 4657
147 Ga0157379_10334459 3300014968 Bacteria 1384
148 Ga0157376_10017327 3300014969 Bacteria 5491
149 Ga0157376_10138410 3300014969 Unclassified 2181
150 Ga0157376_10176201 3300014969 Bacteria 1951
151 Ga0157376_10390250 3300014969 Bacteria 1343
152 Ga0163161_10016559 3300017792 Bacteria 5148
153 Ga0154015_1199638 3300020610 Bacteria 4150
154 Ga0213876_10047465 3300021384 Bacteria 2270
155 Ga0209435_100010 3300025206 Bacteria 475373
156 Ga0209437_103578 3300025233 Bacteria 2793
157 Ga0207425_1008307 3300025245 Bacteria 2667
158 Ga0209646_1000001 3300025246 Bacteria 3092932
159 Ga0209026_1000001 3300025250 Bacteria 1228671
160 Ga0209759_1000001 3300025256 Bacteria 2799452
161 Ga0209233_1000799 3300025261 Bacteria 14109
162 Ga0209565_1000036 3300025263 Bacteria 293334
163 Ga0209565_1000686 3300025263 Bacteria 21039
164 Ga0209130_1000042 3300025284 Bacteria 257581
165 Ga0209130_1000151 3300025284 Bacteria 107021
166 Ga0209675_1000751 3300025291 Bacteria 21867
167 Ga0209675_1001480 3300025291 Bacteria 13498
168 Ga0209675_1022494 3300025291 Bacteria 1655
169 Ga0209676_1000007 3300025292 Bacteria 1029371
170 Ga0209676_1002711 3300025292 Bacteria 11932
171 Ga0209025_1001245 3300025294 Bacteria 35389
172 Ga0209025_1001980 3300025294 Bacteria 23509
173 Ga0209025_1002721 3300025294 Bacteria 17941
174 Ga0209025_1028725 3300025294 Bacteria 2715
175 Ga0209564_1000729 3300025295 Bacteria 46947
176 Ga0209564_1000903 3300025295 Bacteria 38881
177 Ga0209564_1002398 3300025295 Bacteria 14955
178 Ga0209758_1009443 3300025297 Bacteria 6065
179 Ga0209050_1000003 3300025298 Bacteria 1609245
180 Ga0209050_1001985 3300025298 Bacteria 19184
181 Ga0209256_1000001 3300025299 Bacteria 2166974
182 Ga0207426_1000097 3300025302 Bacteria 265930
183 Ga0209051_1000003 3300025303 Bacteria 1609245
184 Ga0209257_1000020 3300025304 Bacteria 773356
185 Ga0207642_10022822 3300025899 Unclassified 2489
186 Ga0207647_10003540 3300025904 Bacteria 11711
187 Ga0207705_10000216 3300025909 Bacteria 57377
188 Ga0207705_10002735 3300025909 Bacteria 13520
189 Ga0207654_10012517 3300025911 Bacteria 4348
190 Ga0207654_10032061 3300025911 Unclassified 2899
191 Ga0207707_10001178 3300025912 Bacteria 24639
192 Ga0207707_10106019 3300025912 Unclassified 2457
193 Ga0207707_10125271 3300025912 Bacteria 2247
194 Ga0207707_10169719 3300025912 Bacteria 1907
195 Ga0207695_10001170 3300025913 Bacteria 45242
196 Ga0207695_10116195 3300025913 Bacteria 2649
197 Ga0207695_10314229 3300025913 Unclassified 1457
198 Ga0207671_10001902 3300025914 Bacteria 23210
199 Ga0207671_10010501 3300025914 Bacteria 7634
200 Ga0207671_10042211 3300025914 Bacteria 3376
201 Ga0207671_10148490 3300025914 Bacteria 1810
202 Ga0207671_10207310 3300025914 Bacteria 1532
203 Ga0207671_10269742 3300025914 Bacteria 1340
204 Ga0207693_10009625 3300025915 Bacteria 7868
205 Ga0207693_10013867 3300025915 Bacteria 6491
206 Ga0207663_10086780 3300025916 Bacteria 2064
207 Ga0207660_10002385 3300025917 Bacteria 12353
208 Ga0207660_10031380 3300025917 Bacteria 3658
209 Ga0207660_10395268 3300025917 Unclassified 1113
210 Ga0207660_10433811 3300025917 Unclassified 1061
211 Ga0207657_10019927 3300025919 Bacteria 6355
212 Ga0207652_10018241 3300025921 Bacteria 5754
213 Ga0207652_10148272 3300025921 Unclassified 2100
214 Ga0207646_10194766 3300025922 Bacteria 1830
215 Ga0207694_10155116 3300025924 Bacteria 1846
216 Ga0207700_10191772 3300025928 Unclassified 1718
217 Ga0207644_10005922 3300025931 Bacteria 7970
218 Ga0207644_10021204 3300025931 Bacteria 4423
219 Ga0207644_10078791 3300025931 Unclassified 2429
220 Ga0207644_10321483 3300025931 Bacteria 1251
221 Ga0207690_10063954 3300025932 Bacteria 2510
222 Ga0207686_10006347 3300025934 Bacteria 6362
223 Ga0207686_10086584 3300025934 Bacteria 2058
224 Ga0207704_10027490 3300025938 Unclassified 3140
225 Ga0207711_10032283 3300025941 Bacteria 4427
226 Ga0207711_10048891 3300025941 Bacteria 3619
227 Ga0207661_10003737 3300025944 Bacteria 10603
228 Ga0207661_10026349 3300025944 Bacteria 4428
229 Ga0207661_10066693 3300025944 Bacteria 2924
230 Ga0207661_10101337 3300025944 Unclassified 2419
231 Ga0207679_10020473 3300025945 Bacteria 4465
232 Ga0207679_10335228 3300025945 Bacteria 1314
233 Ga0207667_10007296 3300025949 Bacteria 13321
234 Ga0207667_10360264 3300025949 Bacteria 1483
235 Ga0207651_10054021 3300025960 Unclassified 2750
236 Ga0207658_10172915 3300025986 Bacteria 1781
237 Ga0207703_10295629 3300026035 Bacteria 1475
238 Ga0207639_10001785 3300026041 Bacteria 14494
239 Ga0207639_10024084 3300026041 Bacteria 4401
240 Ga0207639_10042031 3300026041 Bacteria 3425
241 Ga0207678_10084601 3300026067 Bacteria 2712
242 Ga0207702_10004913 3300026078 Bacteria 11756
243 Ga0207676_10044425 3300026095 Bacteria 3428
244 Ga0207676_10067570 3300026095 Bacteria 2856
245 Ga0207674_10001794 3300026116 Bacteria 27378
246 Ga0207674_10021487 3300026116 Bacteria 6950
247 Ga0207674_10034882 3300026116 Bacteria 5254
248 Ga0207683_10028606 3300026121 Bacteria 4820
249 Ga0207683_10054761 3300026121 Unclassified 3497
250 Ga0207683_10102049 3300026121 Bacteria 2562
251 Ga0268266_10000022 3300028379 Bacteria 508060
252 Ga0268265_10008890 3300028380 Bacteria 6790
253 Ga0268264_10000115 3300028381 Bacteria 202634
254 Ga0268264_10034104 3300028381 Unclassified 4185
255 Ga0268264_10258090 3300028381 Unclassified 1622
256 Ga0307517_10007263 3300028786 Bacteria 16208
257 Ga0307517_10008092 3300028786 Bacteria 15151
258 Ga0307513_10000011 3300031456 Bacteria 354929
259 Ga0307509_10310104 3300031507 Bacteria 1321
260 Ga0307408_100010648 3300031548 Bacteria 6066
261 Ga0307408_100087554 3300031548 Bacteria 2344
262 Ga0307408_100091424 3300031548 Unclassified 2298
263 Ga0307516_10000111 3300031730 Bacteria 94707
264 Ga0307516_10013516 3300031730 Bacteria 8686
265 Ga0307405_10059359 3300031731 Bacteria 2410
266 Ga0307413_10382718 3300031824 Bacteria 1097
267 Ga0307406_10072950 3300031901 Bacteria 2255
268 Ga0307406_10098605 3300031901 Unclassified 1984
269 Ga0307407_10066597 3300031903 Bacteria 2125
270 Ga0307412_10021574 3300031911 Bacteria 3937
271 Ga0307409_100070698 3300031995 Bacteria 2771
272 Ga0307409_100390327 3300031995 Unclassified 1326
273 Ga0307416_100026332 3300032002 Bacteria 4284
274 Ga0307416_100125361 3300032002 Bacteria 2299
275 Ga0307414_10403167 3300032004 Unclassified 1188
276 Ga0307411_10006512 3300032005 Bacteria 5851
277 Ga0307411_10043487 3300032005 Bacteria 2874
278 Ga0307415_100034520 3300032126 Unclassified 3294
279 Ga0307415_100053530 3300032126 Bacteria 2750
280 Ga0307510_10001091 3300033180 Bacteria 28923
281 Ga0373923_0027958 3300035111 Unclassified 2253
282 Ga0373955_0023597 3300035172 Bacteria 3136
283 Ga0316574_0194666 3300035398 Bacteria 1303
284 Ga0373927_0021485 3300035695 Bacteria 4231
285 Ga0373933_0054077 3300035724 Unclassified 2405
286 Ga0373937_0075975 3300036401 Unclassified 3102
287 Ga0373937_0113925 3300036401 Bacteria 2517
288 Ga0373937_0254484 3300036401 Unclassified 1655
289 Ga0373937_0265248 3300036401 Unclassified 1620
290 Ga0395899_0047992 3300037312 Bacteria 3178
291 Ga0395900_0081877 3300037418 Bacteria 3316
292 Ga0395905_0002075 3300037471 Bacteria 22818
293 Ga0436365_1407042 3300039437 Bacteria 4827
294 Ga0439436_0000541 3300041404 Bacteria 9930
295 Ga0439438_002969 3300041405 Bacteria 7024
296 Ga0439447_005313 3300041407 Bacteria 4293
297 Ga0439466_0002747 3300041411 Bacteria 6890
298 Ga0439466_0008185 3300041411 Bacteria 3941
299 Ga0439432_017779 3300042006 Bacteria 2383
300 Ga0439452_001586 3300042010 Bacteria 9005
301 Ga0450923_000846 3300042125 Bacteria 3719
302 Ga0439446_0000239 3300042156 Bacteria 10146
303 Ga0439434_0007500 3300042435 Bacteria 3195
304 Ga0466972_0004623 3300044658 Bacteria 6893
305 Ga0466967_0077090 3300045976 Bacteria 3000
306 Ga0466967_0292817 3300045976 Unclassified 1564
307 Ga0495580_0000306 3300046472 Bacteria 39953
308 Ga0495580_0000832 3300046472 Bacteria 26751
309 Ga0495580_0006977 3300046472 Bacteria 9110
310 Ga0495580_0091598 3300046472 Bacteria 2116
311 Ga0495582_0060333 3300046473 Unclassified 2093
312 Ga0495648_0004023 3300046524 Bacteria 12700
313 Ga0495663_0008285 3300046525 Bacteria 2878
314 Ga0495640_0018012 3300046533 Bacteria 5251
315 Ga0495586_0004855 3300046535 Bacteria 7191
316 Ga0495668_0008955 3300046616 Bacteria 6187
317 Ga0495611_0000224 3300046648 Bacteria 39649
318 Ga0495635_0163641 3300046663 Bacteria 1514
319 Ga0495635_0193118 3300046663 Unclassified 1382
320 Ga0495599_0188447 3300046678 Bacteria 1270
321 Ga0495623_0168512 3300046679 Unclassified 1281
322 Ga0495658_0116114 3300046683 Bacteria 1614
323 Ga0495669_0007065 3300046684 Bacteria 4701
324 Ga0495613_0125052 3300046689 Bacteria 1845
325 Ga0495624_0019363 3300046690 Bacteria 4546
326 Ga0495581_0027415 3300047315 Bacteria 3304
327 Ga0495674_0229157 3300047319 Bacteria 1534
328 Ga0495687_002453 3300047443 Bacteria 14872
329 Ga0495677_0011126 3300047445 Bacteria 3293
330 Ga0495684_0174727 3300047471 Bacteria 1595
331 Ga0496101_0183745 3300048904 Bacteria 1611
332 Ga0496104_0088066 3300048907 Unclassified 2965
333 Ga0496105_0016550 3300048908 Bacteria 5887
334 Ga0496105_0303618 3300048908 Bacteria 1283
335 Ga0496107_0019641 3300048910 Bacteria 4767
336 Ga0496107_0041539 3300048910 Unclassified 3302
337 Ga0496108_0093043 3300048911 Unclassified 2564
338 Ga0496111_0329123 3300048914 Bacteria 1131
339 Ga0496112_0001654 3300048915 Bacteria 17322
340 Ga0496114_0029386 3300048917 Bacteria 4517
341 Ga0496114_0060104 3300048917 Bacteria 3176
342 Ga0496114_0541831 3300048917 Bacteria 1028
343 Ga0496115_0044227 3300048918 Unclassified 3551
344 Ga0496115_0084932 3300048918 Bacteria 2581
345 Ga0496115_0270494 3300048918 Bacteria 1396
346 Ga0501032_0046980 3300049569 Bacteria 2916
347 Ga0501033_0438105 3300049570 Bacteria 909
348 Ga0501034_0228036 3300049571 Bacteria 1813
349 Ga0501034_0252414 3300049571 Bacteria 1708
350 Ga0501037_0067802 3300049573 Bacteria 2598
351 Ga0501043_0301065 3300049579 Unclassified 1225
352 Ga0501047_0040395 3300049581 Bacteria 4512
353 Ga0501048_0069419 3300049582 Bacteria 2489
354 Ga0501070_0066681 3300049586 Bacteria 2981
355 Ga0501070_0242755 3300049586 Bacteria 1474
356 Ga0501071_0010984 3300049587 Bacteria 6081
357 Ga0501075_0013160 3300049591 Bacteria 5898
358 Ga0501081_0084389 3300049743 Bacteria 2228
359 Ga0495601_0082881 3300053077 Bacteria 2059
360 Ga0495595_0005538 3300053084 Bacteria 5113
361 Ga0495619_0265648 3300053085 Bacteria 1189
362 Ga0500644_0005249 3300053088 Bacteria 3264
363 Ga0500583_0013491 3300053092 Unclassified 3163
364 Ga0500583_0031911 3300053092 Unclassified 2320
365 Ga0500593_000131 3300053117 Bacteria 29789
366 Ga0500658_0005616 3300053134 Plasmid 4669
367 Ga0500588_0028473 3300053146 Unclassified 1584
368 Ga0500604_0001825 3300053151 Bacteria 5927
369 Ga0500616_0075837 3300053153 Bacteria 1701
370 Ga0500622_0007176 3300053156 Bacteria 6353
371 Ga0500645_000397 3300053730 Bacteria 30509
372 Ga0500645_000644 3300053730 Bacteria 22175
373 Ga0500645_008173 3300053730 Bacteria 3593
374 Ga0500645_065172 3300053730 Unclassified 1050
375 Ga0501084_0191230 3300054114 Bacteria 1727
376 Ga0466962_0035938 3300061719 Bacteria 2371
377 Ga0530510_0053480 3300061734 Bacteria 2918

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005335 Ga0070666_10016597 Ga0070666_100165973 238
2 3300031903 Ga0307407_10066597 Ga0307407_100665972 247
3 3300048908 Ga0496105_0303618 Ga0496105_0303618_475_1227 249
4 3300049582 Ga0501048_0069419 Ga0501048_0069419_684_1436 249
5 3300048918 Ga0496115_0270494 Ga0496115_0270494_36_818 254
6 3300053153 Ga0500616_0075837 Ga0500616_0075837_907_1680 257
7 3300048917 Ga0496114_0541831 Ga0496114_0541831_228_1013 259
8 3300031731 Ga0307405_10059359 Ga0307405_100593592 262
9 3300032002 Ga0307416_100125361 Ga0307416_1001253612 262
10 3300032126 Ga0307415_100053530 Ga0307415_1000535302 262
11 3300005834 Ga0068851_10009522 Ga0068851_100095226 266
12 3300009551 Ga0105238_10275769 Ga0105238_102757691 266
13 3300025912 Ga0207707_10001178 Ga0207707_100011782 266
14 3300049570 Ga0501033_0438105 Ga0501033_0438105_60_875 270
15 3300049579 Ga0501043_0301065 Ga0501043_0301065_115_996 270
16 3300049581 Ga0501047_0040395 Ga0501047_0040395_3305_4186 270
17 3300039437 Ga0436365_1407042 Ga0436365_1407042_3922_4749 272
18 3300005563 Ga0068855_100011557 Ga0068855_10001155711 273
19 3300010375 Ga0105239_10362408 Ga0105239_103624082 273
20 3300046533 Ga0495640_0018012 Ga0495640_0018012_630_1541 273
21 3300046535 Ga0495586_0004855 Ga0495586_0004855_3060_3971 273
22 3300047315 Ga0495581_0027415 Ga0495581_0027415_482_1393 273
23 3300047471 Ga0495684_0174727 Ga0495684_0174727_254_1165 273
24 3300009545 Ga0105237_10328889 Ga0105237_103288892 276
25 3300025914 Ga0207671_10207310 Ga0207671_102073102 276
26 3300005330 Ga0070690_100109738 Ga0070690_1001097382 278
27 3300005436 Ga0070713_100152272 Ga0070713_1001522723 278
28 3300005439 Ga0070711_100040670 Ga0070711_1000406702 278
29 3300005546 Ga0070696_100210192 Ga0070696_1002101922 278
30 3300005614 Ga0068856_100052677 Ga0068856_1000526772 278
31 3300005841 Ga0068863_100055538 Ga0068863_1000555381 278
32 3300005842 Ga0068858_100211894 Ga0068858_1002118942 278
33 3300009101 Ga0105247_10015185 Ga0105247_100151852 278
34 3300009177 Ga0105248_10126478 Ga0105248_101264783 278
35 3300009545 Ga0105237_10192432 Ga0105237_101924323 278
36 3300010375 Ga0105239_10543359 Ga0105239_105433591 278
37 3300013308 Ga0157375_10324551 Ga0157375_103245512 278
38 3300025899 Ga0207642_10022822 Ga0207642_100228224 278
39 3300025914 Ga0207671_10148490 Ga0207671_101484902 278
40 3300025915 Ga0207693_10009625 Ga0207693_100096257 278
41 3300025916 Ga0207663_10086780 Ga0207663_100867801 278
42 3300025931 Ga0207644_10078791 Ga0207644_100787913 278
43 3300025934 Ga0207686_10086584 Ga0207686_100865841 278
44 3300025938 Ga0207704_10027490 Ga0207704_100274904 278
45 3300025960 Ga0207651_10054021 Ga0207651_100540212 278
46 3300026035 Ga0207703_10295629 Ga0207703_102956292 278
47 3300028381 Ga0268264_10258090 Ga0268264_102580902 278
48 3300035111 Ga0373923_0027958 Ga0373923_0027958_1345_2187 278
49 3300046472 Ga0495580_0000832 Ga0495580_0000832_20709_21551 278
50 3300046472 Ga0495580_0006977 Ga0495580_0006977_3800_4642 278
51 3300046678 Ga0495599_0188447 Ga0495599_0188447_125_967 278
52 3300047319 Ga0495674_0229157 Ga0495674_0229157_658_1500 278
53 3300048907 Ga0496104_0088066 Ga0496104_0088066_457_1299 278
54 3300048910 Ga0496107_0041539 Ga0496107_0041539_196_1038 278
55 3300048918 Ga0496115_0044227 Ga0496115_0044227_811_1653 278
56 iso_pu_bacteria 2811994881 2812368789 279
57 iso_pu_bacteria 2923519811 2923522856 279
58 3300005616 Ga0068852_100261053 Ga0068852_1002610532 280
59 3300013306 Ga0163162_10072773 Ga0163162_100727732 280
60 3300025945 Ga0207679_10335228 Ga0207679_103352282 280
61 3300053151 Ga0500604_0001825 Ga0500604_0001825_1970_2854 280
62 3300005327 Ga0070658_10000059 Ga0070658_1000005918 281
63 3300005355 Ga0070671_100013393 Ga0070671_1000133933 281
64 3300005367 Ga0070667_100013576 Ga0070667_1000135765 281
65 3300005543 Ga0070672_100467127 Ga0070672_1004671272 281
66 3300005841 Ga0068863_100280724 Ga0068863_1002807242 281
67 3300009177 Ga0105248_10055784 Ga0105248_100557842 281
68 3300013105 Ga0157369_10235321 Ga0157369_102353212 281
69 3300013296 Ga0157374_10128423 Ga0157374_101284232 281
70 3300013306 Ga0163162_10013855 Ga0163162_100138552 281
71 3300013308 Ga0157375_10007976 Ga0157375_100079763 281
72 3300014968 Ga0157379_10032440 Ga0157379_100324404 281
73 3300014969 Ga0157376_10017327 Ga0157376_100173271 281
74 3300014969 Ga0157376_10176201 Ga0157376_101762012 281
75 3300025909 Ga0207705_10000216 Ga0207705_1000021623 281
76 3300025931 Ga0207644_10005922 Ga0207644_100059222 281
77 3300025941 Ga0207711_10032283 Ga0207711_100322834 281
78 3300025986 Ga0207658_10172915 Ga0207658_101729152 281
79 3300026121 Ga0207683_10028606 Ga0207683_100286065 281
80 3300048904 Ga0496101_0183745 Ga0496101_0183745_282_1130 281
81 3300048917 Ga0496114_0060104 Ga0496114_0060104_1654_2502 281
82 iso_pu_bacteria 2511231002 2511247227 282
83 3300005445 Ga0070708_100229404 Ga0070708_1002294042 283
84 3300041404 Ga0439436_0000541 Ga0439436_0000541_7100_7954 283
85 3300041405 Ga0439438_002969 Ga0439438_002969_1839_2693 283
86 3300041407 Ga0439447_005313 Ga0439447_005313_1548_2402 283
87 3300041411 Ga0439466_0008185 Ga0439466_0008185_312_1166 283
88 3300042006 Ga0439432_017779 Ga0439432_017779_1363_2217 283
89 3300042010 Ga0439452_001586 Ga0439452_001586_7210_8064 283
90 3300042125 Ga0450923_000846 Ga0450923_000846_1915_2769 283
91 3300042435 Ga0439434_0007500 Ga0439434_0007500_670_1524 283
92 3300046690 Ga0495624_0019363 Ga0495624_0019363_98_955 283
93 3300049569 Ga0501032_0046980 Ga0501032_0046980_1152_2006 283
94 3300049571 Ga0501034_0228036 Ga0501034_0228036_35_889 283
95 3300049571 Ga0501034_0252414 Ga0501034_0252414_522_1376 283
96 3300049573 Ga0501037_0067802 Ga0501037_0067802_950_1804 283
97 3300006844 Ga0075428_100064568 Ga0075428_1000645683 284
98 3300006847 Ga0075431_100028837 Ga0075431_1000288375 284
99 3300036401 Ga0373937_0265248 Ga0373937_0265248_627_1484 284
100 3300046663 Ga0495635_0193118 Ga0495635_0193118_211_1068 284
101 3300013306 Ga0163162_10058120 Ga0163162_100581202 285
102 3300014968 Ga0157379_10334459 Ga0157379_103344591 285
103 3300014969 Ga0157376_10390250 Ga0157376_103902502 285
104 3300031548 Ga0307408_100087554 Ga0307408_1000875542 285
105 3300031901 Ga0307406_10072950 Ga0307406_100729502 285
106 3300031995 Ga0307409_100070698 Ga0307409_1000706982 285
107 3300032005 Ga0307411_10043487 Ga0307411_100434873 285
108 3300044658 Ga0466972_0004623 Ga0466972_0004623_5813_6670 285
109 3300002774 JGI25150J39212_1001877 JGI25150J39212_10018775 286
110 3300002987 JGI25159J45721_1001207 JGI25159J45721_10012076 286
111 3300002987 JGI25159J45721_1004564 JGI25159J45721_10045646 286
112 3300003187 JGI25151J46595_10002055 JGI25151J46595_100020553 286
113 3300003354 JGI25160J50197_1000212 JGI25160J50197_100021229 286
114 3300003374 JGI25161J50226_1000151 JGI25161J50226_100015129 286
115 3300003771 Ga0055526_1000958 Ga0055526_100095811 286
116 3300003771 Ga0055526_1005848 Ga0055526_10058481 286
117 3300003773 Ga0055537_1000084 Ga0055537_100008460 286
118 3300003773 Ga0055537_1007230 Ga0055537_10072301 286
119 3300003775 Ga0055524_1000082 Ga0055524_100008289 286
120 3300003784 Ga0055534_1002638 Ga0055534_10026386 286
121 3300003790 Ga0055528_1001888 Ga0055528_10018884 286
122 3300003791 Ga0055530_10001442 Ga0055530_100014428 286
123 3300003792 Ga0055540_1000010 Ga0055540_1000010266 286
124 3300003794 Ga0055531_10000461 Ga0055531_1000046142 286
125 3300004625 Ga0055543_1000394 Ga0055543_100039422 286
126 3300005262 Ga0065165_1005448 Ga0065165_10054482 286
127 3300005262 Ga0065165_1010042 Ga0065165_10100427 286
128 3300005262 Ga0065165_1023417 Ga0065165_10234172 286
129 3300005262 Ga0065165_1042841 Ga0065165_10428411 286
130 3300005844 Ga0068862_100041126 Ga0068862_1000411264 286
131 3300006177 Ga0075362_10023486 Ga0075362_100234863 286
132 3300012513 Ga0157326_1002087 Ga0157326_10020872 286
133 3300025245 Ga0207425_1008307 Ga0207425_10083072 286
134 3300025263 Ga0209565_1000036 Ga0209565_100003691 286
135 3300025263 Ga0209565_1000686 Ga0209565_100068616 286
136 3300025284 Ga0209130_1000042 Ga0209130_1000042149 286
137 3300025284 Ga0209130_1000151 Ga0209130_100015182 286
138 3300025291 Ga0209675_1000751 Ga0209675_10007511 286
139 3300025291 Ga0209675_1001480 Ga0209675_10014806 286
140 3300025291 Ga0209675_1022494 Ga0209675_10224942 286
141 3300025292 Ga0209676_1000007 Ga0209676_1000007293 286
142 3300025292 Ga0209676_1002711 Ga0209676_10027115 286
143 3300025294 Ga0209025_1001245 Ga0209025_100124520 286
144 3300025294 Ga0209025_1001980 Ga0209025_100198017 286
145 3300025294 Ga0209025_1002721 Ga0209025_10027219 286
146 3300025294 Ga0209025_1028725 Ga0209025_10287252 286
147 3300025295 Ga0209564_1000729 Ga0209564_100072921 286
148 3300025295 Ga0209564_1000903 Ga0209564_100090321 286
149 3300025295 Ga0209564_1002398 Ga0209564_10023985 286
150 3300025297 Ga0209758_1009443 Ga0209758_10094434 286
151 3300025298 Ga0209050_1000003 Ga0209050_10000031215 286
152 3300025298 Ga0209050_1001985 Ga0209050_10019857 286
153 3300025299 Ga0209256_1000001 Ga0209256_10000011218 286
154 3300025302 Ga0207426_1000097 Ga0207426_1000097155 286
155 3300025303 Ga0209051_1000003 Ga0209051_10000031215 286
156 3300025304 Ga0209257_1000020 Ga0209257_1000020293 286
157 3300028380 Ga0268265_10008890 Ga0268265_100088901 286
158 3300028381 Ga0268264_10034104 Ga0268264_100341045 286
159 3300031456 Ga0307513_10000011 Ga0307513_10000011135 286
160 3300031548 Ga0307408_100010648 Ga0307408_1000106486 286
161 3300031824 Ga0307413_10382718 Ga0307413_103827182 286
162 3300035724 Ga0373933_0054077 Ga0373933_0054077_1115_1984 286
163 3300036401 Ga0373937_0254484 Ga0373937_0254484_658_1527 286
164 3300045976 Ga0466967_0292817 Ga0466967_0292817_225_1121 286
165 3300046679 Ga0495623_0168512 Ga0495623_0168512_153_1022 286
166 3300053088 Ga0500644_0005249 Ga0500644_0005249_2289_3161 286
167 3300053117 Ga0500593_000131 Ga0500593_000131_20278_21150 286
168 3300053730 Ga0500645_000397 Ga0500645_000397_5760_6632 286
169 3300053730 Ga0500645_000644 Ga0500645_000644_2662_3534 286
170 3300005329 Ga0070683_100008694 Ga0070683_1000086943 287
171 3300005341 Ga0070691_10000433 Ga0070691_100004337 287
172 3300005436 Ga0070713_100000603 Ga0070713_1000006035 287
173 3300005535 Ga0070684_100000079 Ga0070684_1000000794 287
174 3300005564 Ga0070664_100032000 Ga0070664_1000320003 287
175 3300005577 Ga0068857_100001971 Ga0068857_1000019715 287
176 3300005614 Ga0068856_100036841 Ga0068856_1000368415 287
177 3300009177 Ga0105248_10125720 Ga0105248_101257201 287
178 3300009551 Ga0105238_10431647 Ga0105238_104316471 287
179 3300013104 Ga0157370_10068197 Ga0157370_100681974 287
180 3300013307 Ga0157372_10173772 Ga0157372_101737723 287
181 3300021384 Ga0213876_10047465 Ga0213876_100474651 287
182 3300025944 Ga0207661_10003737 Ga0207661_1000373713 287
183 3300025945 Ga0207679_10020473 Ga0207679_100204733 287
184 3300026116 Ga0207674_10001794 Ga0207674_1000179425 287
185 3300036401 Ga0373937_0075975 Ga0373937_0075975_121_1029 287
186 3300048914 Ga0496111_0329123 Ga0496111_0329123_152_1057 287
187 3300009545 Ga0105237_10002039 Ga0105237_1000203910 288
188 3300046648 Ga0495611_0000224 Ga0495611_0000224_25534_26400 288
189 3300002704 JGI25155J39150_1000098 JGI25155J39150_100009826 289
190 3300002705 JGI25156J39149_1000163 JGI25156J39149_100016326 289
191 3300002738 JGI25154J39366_1000183 JGI25154J39366_100018326 289
192 3300002741 JGI25157J39369_1000209 JGI25157J39369_100020924 289
193 3300005436 Ga0070713_100160124 Ga0070713_1001601241 289
194 3300005458 Ga0070681_10306941 Ga0070681_103069411 289
195 3300005614 Ga0068856_100074285 Ga0068856_1000742853 289
196 3300005616 Ga0068852_100089523 Ga0068852_1000895232 289
197 3300005616 Ga0068852_100148855 Ga0068852_1001488552 289
198 3300006353 Ga0075370_10146151 Ga0075370_101461511 289
199 3300009093 Ga0105240_10046895 Ga0105240_100468953 289
200 3300009551 Ga0105238_10063887 Ga0105238_100638873 289
201 3300010375 Ga0105239_10008295 Ga0105239_100082955 289
202 3300013296 Ga0157374_10521587 Ga0157374_105215871 289
203 3300013307 Ga0157372_10132357 Ga0157372_101323573 289
204 3300025206 Ga0209435_100010 Ga0209435_100010405 289
205 3300025246 Ga0209646_1000001 Ga0209646_10000011737 289
206 3300025250 Ga0209026_1000001 Ga0209026_1000001391 289
207 3300025256 Ga0209759_1000001 Ga0209759_10000011368 289
208 3300025912 Ga0207707_10125271 Ga0207707_101252712 289
209 3300025915 Ga0207693_10013867 Ga0207693_100138672 289
210 3300026041 Ga0207639_10001785 Ga0207639_100017857 289
211 3300028786 Ga0307517_10007263 Ga0307517_100072633 289
212 3300033180 Ga0307510_10001091 Ga0307510_100010914 289
213 3300035695 Ga0373927_0021485 Ga0373927_0021485_737_1633 289
214 3300036401 Ga0373937_0113925 Ga0373937_0113925_1281_2189 289
215 3300041411 Ga0439466_0002747 Ga0439466_0002747_3777_4649 289
216 3300046472 Ga0495580_0000306 Ga0495580_0000306_16777_17673 289
217 3300053730 Ga0500645_008173 Ga0500645_008173_613_1494 289
218 3300003316 rootH1_10152290 rootH1_101522902 290
219 3300005614 Ga0068856_100059111 Ga0068856_1000591115 290
220 3300006358 Ga0068871_100158296 Ga0068871_1001582962 290
221 3300009093 Ga0105240_10000607 Ga0105240_1000060730 290
222 3300009093 Ga0105240_10165405 Ga0105240_101654052 290
223 3300009174 Ga0105241_10170958 Ga0105241_101709582 290
224 3300009174 Ga0105241_10172883 Ga0105241_101728833 290
225 3300009176 Ga0105242_10028876 Ga0105242_100288762 290
226 3300009551 Ga0105238_10023933 Ga0105238_100239333 290
227 3300013307 Ga0157372_10050687 Ga0157372_100506873 290
228 3300014969 Ga0157376_10138410 Ga0157376_101384102 290
229 3300025911 Ga0207654_10012517 Ga0207654_100125171 290
230 3300025913 Ga0207695_10001170 Ga0207695_1000117016 290
231 3300025913 Ga0207695_10116195 Ga0207695_101161952 290
232 3300025914 Ga0207671_10042211 Ga0207671_100422115 290
233 3300025924 Ga0207694_10155116 Ga0207694_101551162 290
234 3300025934 Ga0207686_10006347 Ga0207686_100063473 290
235 3300026121 Ga0207683_10054761 Ga0207683_100547612 290
236 3300042156 Ga0439446_0000239 Ga0439446_0000239_5269_6144 290
237 3300045976 Ga0466967_0077090 Ga0466967_0077090_1933_2850 290
238 3300046473 Ga0495582_0060333 Ga0495582_0060333_902_1843 290
239 3300046524 Ga0495648_0004023 Ga0495648_0004023_5862_6746 290
240 3300046683 Ga0495658_0116114 Ga0495658_0116114_235_1176 290
241 3300046689 Ga0495613_0125052 Ga0495613_0125052_38_979 290
242 3300053085 Ga0495619_0265648 Ga0495619_0265648_39_977 290
243 3300053092 Ga0500583_0013491 Ga0500583_0013491_1963_2847 290
244 3300053156 Ga0500622_0007176 Ga0500622_0007176_5457_6341 290
245 3300061719 Ga0466962_0035938 Ga0466962_0035938_739_1656 290
246 3300005338 Ga0068868_100384980 Ga0068868_1003849802 291
247 3300005548 Ga0070665_100000002 Ga0070665_10000000294 291
248 3300025922 Ga0207646_10194766 Ga0207646_101947662 291
249 3300025931 Ga0207644_10321483 Ga0207644_103214832 291
250 3300028379 Ga0268266_10000022 Ga0268266_10000022343 291
251 3300031507 Ga0307509_10310104 Ga0307509_103101042 291
252 3300053092 Ga0500583_0031911 Ga0500583_0031911_1046_1927 291
253 3300053134 Ga0500658_0005616 Ga0500658_0005616_573_1454 291
254 3300053146 Ga0500588_0028473 Ga0500588_0028473_485_1366 291
255 3300005458 Ga0070681_10610877 Ga0070681_106108771 292
256 3300005535 Ga0070684_100139105 Ga0070684_1001391052 292
257 3300005563 Ga0068855_100227601 Ga0068855_1002276012 292
258 3300009093 Ga0105240_10290640 Ga0105240_102906402 292
259 3300009545 Ga0105237_10019463 Ga0105237_100194633 292
260 3300009551 Ga0105238_10132638 Ga0105238_101326382 292
261 3300010375 Ga0105239_10000195 Ga0105239_1000019560 292
262 3300010375 Ga0105239_10120633 Ga0105239_101206334 292
263 3300013307 Ga0157372_10481864 Ga0157372_104818642 292
264 3300025912 Ga0207707_10169719 Ga0207707_101697193 292
265 3300025913 Ga0207695_10314229 Ga0207695_103142292 292
266 3300025914 Ga0207671_10010501 Ga0207671_100105014 292
267 3300025928 Ga0207700_10191772 Ga0207700_101917722 292
268 3300025944 Ga0207661_10066693 Ga0207661_100666932 292
269 3300025944 Ga0207661_10101337 Ga0207661_101013372 292
270 3300025949 Ga0207667_10360264 Ga0207667_103602642 292
271 3300031548 Ga0307408_100091424 Ga0307408_1000914242 292
272 3300031901 Ga0307406_10098605 Ga0307406_100986051 292
273 3300031911 Ga0307412_10021574 Ga0307412_100215741 292
274 3300032005 Ga0307411_10006512 Ga0307411_100065123 292
275 3300032126 Ga0307415_100034520 Ga0307415_1000345205 292
276 3300037312 Ga0395899_0047992 Ga0395899_0047992_378_1256 292
277 3300037418 Ga0395900_0081877 Ga0395900_0081877_934_1812 292
278 3300037471 Ga0395905_0002075 Ga0395905_0002075_20091_20969 292
279 3300047443 Ga0495687_002453 Ga0495687_002453_9566_10444 292
280 3300003323 rootH1_10282976 rootH1_102829761 293
281 3300005339 Ga0070660_100002661 Ga0070660_1000026617 293
282 3300005539 Ga0068853_100031597 Ga0068853_1000315973 293
283 3300005618 Ga0068864_100026930 Ga0068864_1000269304 293
284 3300005842 Ga0068858_100116675 Ga0068858_1001166752 293
285 3300009545 Ga0105237_10070699 Ga0105237_100706994 293
286 3300010375 Ga0105239_10776179 Ga0105239_107761791 293
287 3300013104 Ga0157370_10018539 Ga0157370_100185396 293
288 3300013105 Ga0157369_10006631 Ga0157369_1000663110 293
289 3300013306 Ga0163162_10000625 Ga0163162_100006257 293
290 3300025914 Ga0207671_10269742 Ga0207671_102697422 293
291 3300025919 Ga0207657_10019927 Ga0207657_100199276 293
292 3300026041 Ga0207639_10042031 Ga0207639_100420313 293
293 3300026095 Ga0207676_10044425 Ga0207676_100444251 293
294 3300031730 Ga0307516_10000111 Ga0307516_1000011166 293
295 3300046472 Ga0495580_0091598 Ga0495580_0091598_925_1815 293
296 3300049587 Ga0501071_0010984 Ga0501071_0010984_2183_3067 293
297 3300049591 Ga0501075_0013160 Ga0501075_0013160_4265_5149 293
298 3300049743 Ga0501081_0084389 Ga0501081_0084389_135_1019 293
299 3300054114 Ga0501084_0191230 Ga0501084_0191230_709_1593 293
300 3300061734 Ga0530510_0053480 Ga0530510_0053480_1789_2673 293
301 3300005843 Ga0068860_100209985 Ga0068860_1002099851 294
302 3300026121 Ga0207683_10102049 Ga0207683_101020492 294
303 3300031730 Ga0307516_10013516 Ga0307516_100135164 294
304 3300048908 Ga0496105_0016550 Ga0496105_0016550_3312_4202 294
305 3300048911 Ga0496108_0093043 Ga0496108_0093043_583_1473 294
306 3300048915 Ga0496112_0001654 Ga0496112_0001654_11489_12376 294
307 3300005336 Ga0070680_100354177 Ga0070680_1003541772 295
308 3300005530 Ga0070679_100082804 Ga0070679_1000828042 295
309 3300005577 Ga0068857_100025208 Ga0068857_1000252085 295
310 3300013307 Ga0157372_10038992 Ga0157372_100389922 295
311 3300025914 Ga0207671_10001902 Ga0207671_1000190219 295
312 3300025917 Ga0207660_10395268 Ga0207660_103952681 295
313 3300025921 Ga0207652_10148272 Ga0207652_101482722 295
314 3300026116 Ga0207674_10034882 Ga0207674_100348825 295
315 3300046616 Ga0495668_0008955 Ga0495668_0008955_4541_5428 295
316 3300049586 Ga0501070_0066681 Ga0501070_0066681_191_1078 295
317 3300017792 Ga0163161_10016559 Ga0163161_100165596 296
318 3300046684 Ga0495669_0007065 Ga0495669_0007065_1953_2846 296
319 3300003323 rootH1_10034446 rootH1_100344462 297
320 3300005336 Ga0070680_100064016 Ga0070680_1000640161 297
321 3300005355 Ga0070671_100003166 Ga0070671_10000316612 297
322 3300005458 Ga0070681_10261772 Ga0070681_102617721 297
323 3300005530 Ga0070679_100101386 Ga0070679_1001013863 297
324 3300005618 Ga0068864_100056346 Ga0068864_1000563464 297
325 3300009177 Ga0105248_10001858 Ga0105248_100018587 297
326 3300013104 Ga0157370_10108255 Ga0157370_101082553 297
327 3300013307 Ga0157372_10094125 Ga0157372_100941254 297
328 3300025931 Ga0207644_10021204 Ga0207644_100212044 297
329 3300026095 Ga0207676_10067570 Ga0207676_100675703 297
330 3300031995 Ga0307409_100390327 Ga0307409_1003903271 297
331 3300032002 Ga0307416_100026332 Ga0307416_1000263321 297
332 3300032004 Ga0307414_10403167 Ga0307414_104031671 297
333 3300005458 Ga0070681_10111687 Ga0070681_101116873 298
334 3300009177 Ga0105248_10007623 Ga0105248_100076232 298
335 3300025912 Ga0207707_10106019 Ga0207707_101060192 298
336 3300025941 Ga0207711_10048891 Ga0207711_100488912 298
337 3300028786 Ga0307517_10008092 Ga0307517_100080924 298
338 3300035398 Ga0316574_0194666 Ga0316574_0194666_65_979 298
339 3300046525 Ga0495663_0008285 Ga0495663_0008285_1735_2643 298
340 3300047445 Ga0495677_0011126 Ga0495677_0011126_2144_3052 298
341 3300048910 Ga0496107_0019641 Ga0496107_0019641_1812_2723 298
342 3300048917 Ga0496114_0029386 Ga0496114_0029386_617_1528 298
343 3300048918 Ga0496115_0084932 Ga0496115_0084932_1046_1957 298
344 3300053730 Ga0500645_065172 Ga0500645_065172_92_988 298
345 3300005843 Ga0068860_100000019 Ga0068860_10000001940 299
346 3300028381 Ga0268264_10000115 Ga0268264_10000115121 299
347 3300025233 Ga0209437_103578 Ga0209437_1035782 300
348 3300025261 Ga0209233_1000799 Ga0209233_10007996 300
349 3300005366 Ga0070659_100019554 Ga0070659_1000195542 301
350 3300005458 Ga0070681_10057167 Ga0070681_100571673 301
351 3300005530 Ga0070679_100032218 Ga0070679_1000322184 301
352 3300013100 Ga0157373_10056327 Ga0157373_100563272 301
353 3300013100 Ga0157373_10078214 Ga0157373_100782142 301
354 3300013104 Ga0157370_10001646 Ga0157370_1000164610 301
355 3300013307 Ga0157372_10005642 Ga0157372_100056426 301
356 3300025909 Ga0207705_10002735 Ga0207705_1000273511 301
357 3300025917 Ga0207660_10433811 Ga0207660_104338112 301
358 3300025932 Ga0207690_10063954 Ga0207690_100639543 301
359 3300025949 Ga0207667_10007296 Ga0207667_1000729611 301
360 3300026041 Ga0207639_10024084 Ga0207639_100240841 301
361 3300049586 Ga0501070_0242755 Ga0501070_0242755_242_1147 301
362 3300035172 Ga0373955_0023597 Ga0373955_0023597_153_1115 302
363 3300046663 Ga0495635_0163641 Ga0495635_0163641_151_1113 302
364 3300053077 Ga0495601_0082881 Ga0495601_0082881_955_1917 302
365 3300053084 Ga0495595_0005538 Ga0495595_0005538_3959_4921 302
366 3300013297 Ga0157378_10172624 Ga0157378_101726242 303
367 3300001904 JGI24736J21556_1001290 JGI24736J21556_10012902 312
368 3300001979 JGI24740J21852_10000328 JGI24740J21852_1000032811 312
369 3300005337 Ga0070682_100030079 Ga0070682_1000300792 312
370 3300009174 Ga0105241_10011338 Ga0105241_100113386 312
371 3300020610 Ga0154015_1199638 Ga0154015_11996384 312
372 3300025904 Ga0207647_10003540 Ga0207647_100035404 312
373 3300025911 Ga0207654_10032061 Ga0207654_100320613 312
374 3300025917 Ga0207660_10002385 Ga0207660_100023858 312
375 3300025917 Ga0207660_10031380 Ga0207660_100313802 312
376 3300025921 Ga0207652_10018241 Ga0207652_100182412 312
377 3300025944 Ga0207661_10026349 Ga0207661_100263495 312
378 3300026067 Ga0207678_10084601 Ga0207678_100846013 312
379 3300026078 Ga0207702_10004913 Ga0207702_1000491312 312
380 3300026116 Ga0207674_10021487 Ga0207674_100214873 312

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02567

PhzC-PhzF

Phenazine biosynthesis-like protein

51

327

0.84

Structural Annotation

Top 5 Hits

ID Description Score Start End
1u0k-assembly1.cif.gz_B the structure of a predicted epimerase pa4716 from pseudomonas aeruginosa 0.9654 15 303
1u0k-assembly1.cif.gz_B the structure of a predicted epimerase pa4716 from pseudomonas aeruginosa 0.9587 15 303
5iwe-assembly1.cif.gz_A-2 e45q mutant of phenazine biosynthesis protein phzf in complex with (5r,6r)-6-azaniumyl-5-ethoxycyclohexa-1,3-diene-1-carboxylate 0.8785 16 300
1xub-assembly1.cif.gz_A-2 structure and function of the phenazine biosynthetic protein phzf from pseudomonas fluorescens 0.8765 16 300
1u1x-assembly1.cif.gz_B structure and function of phenazine-biosynthesis protein phzf from pseudomonas fluorescens 2-79 0.8756 16 300
ID Description Score Start End Superfamily
1u0kB02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9561 135 288 3.10.310.10
1u0kB01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9521 15 130 3.10.310.10
1u0kB02 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9375 135 288 3.10.310.10
1u1vA01 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.9016 16 126 3.10.310.10
af_Q8NIL3_2_111_3.10.310.10 Alpha Beta;Roll;Diaminopimelate Epimerase; Chain A, domain 1;Diaminopimelate Epimerase; Chain A, domain 1 0.8937 17 119 3.10.310.10
ID Description Score Start End GO Terms
AF-A0A2Z6AYQ1-F1-model_v4 Uncharacterized isomerase yddE 0.9833 14 300 GO:0005737
GO:0009058
GO:0016853
AF-A0A7W1GIH8-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9807 17 82 GO:0003824
GO:0009058
AF-A0A6N4T0V0-F1-model_v4 Phenazine biosynthesis protein PhzF 0.9728 14 300 GO:0005737
GO:0009058
GO:0016853
AF-A0A231ZHJ7-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9724 14 303 GO:0005737
GO:0009058
GO:0016853
AF-A0A5B8UQG9-F1-model_v4 PhzF family phenazine biosynthesis protein 0.9714 14 302 GO:0005737
GO:0009058
GO:0016853

Feature Viewer

pLDDT pTM Quality
92.61 0.89 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map