F428648

General Info

Members Datasets Scaffolds Average Seq Length
380 202 346 312

Family's Representative Sequence

Representative Sequence 3300013102|Ga0157371_10002537|Ga0157371_1000253712
Length 378
Sequence LDGATDGGSFLVRFAIKNGAFVALRVGLYRLTSFLTLVIGVSLRVEYNRNIKADVPQKAALGGRGVVAMQNVGLILYPGCQVLGLSMSAIFEIANMIAKEEVYAITLLSEQGGLIQTSAGFSVSTEPFDQRMFDTLLVLGDNVIRLPSKGLVEFLQRSSPFTRRLCSICTGSAALAEAGLLDGRRATTHWAHAKDLQKDYPNIKVDEDRIFINDGPIWTAAGMSACLDLALALVENDLGSEVTRLVSKMLVVYHRRAGGQSQFSVMQELDPKSDRVQAALTFARQHLKADLSVEKLAYVVNMSPRQFSRVFHNETGKSPAKAIENLRVESARIMMETGIHSIDVIATEIGFGDRERMRRAFIRAYGQPPQVFQRANRA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2511231018 Pseudomonas sp. GM60 Isolate Nodule
3 2511231019 Pseudomonas sp. GM67 Isolate Nodule
4 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
5 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
6 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
7 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
8 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
9 2773857670 Pseudomonas sp. 478 Isolate Unclassified
10 2784132072 Pseudomonas sp. 460 Isolate Unclassified
11 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
12 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
13 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
14 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
15 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
16 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
17 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
18 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
19 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
20 2902405164 Methylobacterium sp. P1-11 Isolate Unclassified
21 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
22 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
23 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
24 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
25 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
26 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
27 2941479691
28 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
29 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
30 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
31 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
32 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
33 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
34 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
35 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
38 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
43 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
44 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
45 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
46 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
47 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
48 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
49 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
50 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
51 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
52 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
53 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
54 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
55 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
58 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
59 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
60 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
61 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
64 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
65 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
66 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
67 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
68 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
69 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
70 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
71 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
72 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
73 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
74 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
89 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
90 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
91 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
92 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
93 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
94 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
95 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
96 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
97 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
98 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
99 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
100 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
101 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
102 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
103 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
104 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
105 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
106 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
107 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
108 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
109 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
110 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
111 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
112 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
113 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
114 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
115 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
116 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
117 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
118 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
119 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
120 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
121 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
122 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
123 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
124 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
125 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
126 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
127 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
128 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
129 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
130 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
131 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
132 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
133 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
134 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
135 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
136 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
137 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
138 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
139 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
140 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
141 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
142 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
143 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
144 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
145 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
146 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
147 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
148 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
149 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
150 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
151 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
152 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
153 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
154 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
155 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
156 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
157 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
158 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
159 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
160 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
161 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
162 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
163 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
164 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
165 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
166 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
167 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
168 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
169 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
170 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
171 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
172 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
173 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
174 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
175 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
176 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
177 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
178 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
179 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
180 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
181 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
182 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
183 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
184 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
185 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
186 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
187 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
188 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
189 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
190 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
191 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
192 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
193 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
194 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
195 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
196 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
197 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
198 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
199 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
200 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
201 643348564 Methylobacterium nodulans ORS 2060 Isolate Nodule
202 644736347 Cupriavidus taiwanensis LMG 19424 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 91.84
Metatranscriptomes 0.26
Isolates 7.89

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 5.53
Nodule 2.63
Rhizoplane 1.84
Rhizosphere 77.63
Stem 0
Stem Tuber 0
Unclassified 12.37

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_5159 2124908027 Bacteria 5101
2 rootH1_10071460 3300003323 Bacteria 5002
3 Ga0055524_1000085 3300003775 Bacteria 117478
4 Ga0055536_1010597 3300003781 Bacteria 3635
5 Ga0055530_10000421 3300003791 Bacteria 37698
6 Ga0065165_1000498 3300005262 Bacteria 60773
7 Ga0065714_10000224 3300005288 Bacteria 7203
8 Ga0065714_10076134 3300005288 Bacteria 2825
9 Ga0070709_10166486 3300005434 Bacteria 1537
10 Ga0070708_100124880 3300005445 Unclassified 2378
11 Ga0070663_100004380 3300005455 Bacteria 8289
12 Ga0070706_100060374 3300005467 Bacteria 3500
13 Ga0070706_100077132 3300005467 Bacteria 3084
14 Ga0070706_100319860 3300005467 Bacteria 1447
15 Ga0070707_100040899 3300005468 Bacteria 4435
16 Ga0070707_100054440 3300005468 Bacteria 3836
17 Ga0070707_100129835 3300005468 Bacteria 2450
18 Ga0070698_100089523 3300005471 Bacteria 3061
19 Ga0070698_100139350 3300005471 Unclassified 2378
20 Ga0070699_100021232 3300005518 Bacteria 5599
21 Ga0070699_100024954 3300005518 Bacteria 5153
22 Ga0070697_100067322 3300005536 Bacteria 2929
23 Ga0070697_100143022 3300005536 Bacteria 2012
24 Ga0068851_10062448 3300005834 Bacteria 1911
25 Ga0068863_100111383 3300005841 Bacteria 2607
26 Ga0070717_10001870 3300006028 Bacteria 14720
27 Ga0070717_10170089 3300006028 Unclassified 1895
28 Ga0070716_100007766 3300006173 Bacteria 5296
29 Ga0070712_100092474 3300006175 Bacteria 2218
30 Ga0075433_10329151 3300006852 Bacteria 1351
31 Ga0075434_100317917 3300006871 Bacteria 1577
32 Ga0079104_1000073 3300006946 Bacteria 152269
33 Ga0099794_10002642 3300007265 Bacteria 6662
34 Ga0105240_10000012 3300009093 Bacteria 496639
35 Ga0105247_10233632 3300009101 Bacteria 1250
36 Ga0114129_10820922 3300009147 Bacteria 1184
37 Ga0105243_10137046 3300009148 Bacteria 2083
38 Ga0105248_10203136 3300009177 Bacteria 2233
39 Ga0105237_10000054 3300009545 Bacteria 155063
40 Ga0105249_10228039 3300009553 Bacteria 1836
41 Ga0157371_10002537 3300013102 Bacteria 17351
42 Ga0157371_10233256 3300013102 Bacteria 1323
43 Ga0157370_10001998 3300013104 Bacteria 25057
44 Ga0157370_10005014 3300013104 Bacteria 14964
45 Ga0157370_10064494 3300013104 Bacteria 3468
46 Ga0157370_10200040 3300013104 Bacteria 1853
47 Ga0163162_10000656 3300013306 Bacteria 31990
48 Ga0163162_10015341 3300013306 Bacteria 7485
49 Ga0182008_10004936 3300014497 Bacteria 7688
50 Ga0182007_10000306 3300015262 Bacteria 31526
51 Ga0182005_1002224 3300015265 Bacteria 7129
52 Ga0182005_1004064 3300015265 Bacteria 4798
53 Ga0182005_1011095 3300015265 Bacteria 2576
54 Ga0163161_10002355 3300017792 Bacteria 13542
55 Ga0163161_10049660 3300017792 Bacteria 3033
56 Ga0209565_1006742 3300025263 Bacteria 3184
57 Ga0209675_1005399 3300025291 Bacteria 5362
58 Ga0209676_1000097 3300025292 Bacteria 237203
59 Ga0209025_1000594 3300025294 Bacteria 65297
60 Ga0209025_1004181 3300025294 Bacteria 12754
61 Ga0209758_1025360 3300025297 Bacteria 2605
62 Ga0209050_1005012 3300025298 Bacteria 8602
63 Ga0209050_1009579 3300025298 Bacteria 4931
64 Ga0209256_1000036 3300025299 Bacteria 386664
65 Ga0207696_1031148 3300025711 Bacteria 1615
66 Ga0207655_1018366 3300025728 Bacteria 3713
67 Ga0207713_1019882 3300025735 Bacteria 3271
68 Ga0207699_10145833 3300025906 Bacteria 1560
69 Ga0207695_10000097 3300025913 Bacteria 262517
70 Ga0207671_10000023 3300025914 Bacteria 274756
71 Ga0207693_10263696 3300025915 Bacteria 1350
72 Ga0207693_10399080 3300025915 Bacteria 1075
73 Ga0207663_10042205 3300025916 Bacteria 2786
74 Ga0207646_10082859 3300025922 Bacteria 2869
75 Ga0207646_10264819 3300025922 Bacteria 1553
76 Ga0207711_10108366 3300025941 Bacteria 2467
77 Ga0207711_10116697 3300025941 Bacteria 2380
78 Ga0207711_10311312 3300025941 Bacteria 1454
79 Ga0207658_10222105 3300025986 Bacteria 1590
80 Ga0207703_10307467 3300026035 Bacteria 1448
81 Ga0207678_10026524 3300026067 Bacteria 5054
82 Ga0207641_10029962 3300026088 Bacteria 4503
83 Ga0207641_10288323 3300026088 Bacteria 1547
84 Ga0307511_10056545 3300030521 Bacteria 3066
85 Ga0265760_10067161 3300031090 Bacteria 1096
86 Ga0265327_10003283 3300031251 Bacteria 15666
87 Ga0307513_10000549 3300031456 Bacteria 53746
88 Ga0307508_10007098 3300031616 Bacteria 10444
89 Ga0395900_0026088 3300037418 Bacteria 5983
90 Ga0436361_0049906 3300039447 Bacteria 14312
91 Ga0439447_000346 3300041407 Bacteria 16736
92 Ga0439447_000499 3300041407 Bacteria 14616
93 Ga0439466_0000604 3300041411 Bacteria 13476
94 Ga0439432_020317 3300042006 Bacteria 2208
95 Ga0439452_000230 3300042010 Bacteria 38856
96 Ga0450902_001483 3300042137 Bacteria 3206
97 Ga0450903_001483 3300042138 Bacteria 4370
98 Ga0450907_000058 3300042146 Bacteria 43951
99 Ga0439446_0017357 3300042156 Bacteria 2011
100 Ga0450909_004147 3300042185 Bacteria 2065
101 Ga0439434_0001657 3300042435 Bacteria 6447
102 Ga0439460_0001297 3300042461 Bacteria 5866
103 Ga0439440_0008683 3300042993 Bacteria 2090
104 Ga0495617_001657 3300046452 Bacteria 9580
105 Ga0495617_040049 3300046452 Bacteria 1567
106 Ga0495617_066414 3300046452 Bacteria 1188
107 Ga0495627_020845 3300046453 Bacteria 2179
108 Ga0495592_0287068 3300046454 Bacteria 1074
109 Ga0495603_0002364 3300046455 Bacteria 11076
110 Ga0495603_0005483 3300046455 Bacteria 7572
111 Ga0495590_0015575 3300046457 Bacteria 2756
112 Ga0495591_000568 3300046458 Bacteria 28319
113 Ga0495591_005101 3300046458 Bacteria 6164
114 Ga0495638_0002136 3300046460 Bacteria 16599
115 Ga0495638_0003736 3300046460 Bacteria 11844
116 Ga0495638_0005498 3300046460 Bacteria 9419
117 Ga0495650_0000405 3300046471 Bacteria 71148
118 Ga0495650_0003886 3300046471 Bacteria 10568
119 Ga0495650_0008598 3300046471 Bacteria 5928
120 Ga0495650_0015667 3300046471 Bacteria 3878
121 Ga0495650_0024321 3300046471 Bacteria 2862
122 Ga0495605_0000001 3300046474 Bacteria 614538
123 Ga0495605_0000002 3300046474 Bacteria 522417
124 Ga0495605_0000596 3300046474 Bacteria 28664
125 Ga0495605_0002542 3300046474 Bacteria 11241
126 Ga0495605_0010814 3300046474 Bacteria 5097
127 Ga0495605_0017727 3300046474 Bacteria 3829
128 Ga0495605_0019142 3300046474 Unclassified 3663
129 Ga0495605_0020392 3300046474 Bacteria 3523
130 Ga0495605_0025618 3300046474 Bacteria 3072
131 Ga0495605_0030187 3300046474 Bacteria 2782
132 Ga0495584_0000140 3300046491 Bacteria 50112
133 Ga0495584_0029936 3300046491 Bacteria 2758
134 Ga0495584_0139148 3300046491 Bacteria 1232
135 Ga0495585_0004195 3300046492 Bacteria 9410
136 Ga0495585_0006562 3300046492 Bacteria 7197
137 Ga0495585_0035561 3300046492 Bacteria 2813
138 Ga0495594_0021800 3300046499 Bacteria 3421
139 Ga0495594_0049214 3300046499 Bacteria 2316
140 Ga0495607_0007373 3300046501 Bacteria 7615
141 Ga0495607_0012901 3300046501 Bacteria 5495
142 Ga0495607_0071430 3300046501 Bacteria 1935
143 Ga0495607_0075874 3300046501 Bacteria 1861
144 Ga0495583_0000012 3300046506 Bacteria 324839
145 Ga0495583_0000384 3300046506 Bacteria 68323
146 Ga0495583_0000958 3300046506 Bacteria 33509
147 Ga0495583_0003084 3300046506 Bacteria 13195
148 Ga0495606_0000502 3300046507 Bacteria 63679
149 Ga0495606_0001784 3300046507 Bacteria 27444
150 Ga0495606_0003335 3300046507 Bacteria 17138
151 Ga0495616_0004436 3300046513 Bacteria 8837
152 Ga0495616_0024999 3300046513 Bacteria 3196
153 Ga0495616_0071354 3300046513 Bacteria 1679
154 Ga0495620_0000238 3300046515 Bacteria 41133
155 Ga0495628_0256952 3300046516 Bacteria 1303
156 Ga0495630_0052143 3300046517 Bacteria 3062
157 Ga0495631_0000002 3300046518 Bacteria 178694
158 Ga0495631_0018585 3300046518 Bacteria 3270
159 Ga0495631_0026138 3300046518 Bacteria 2683
160 Ga0495631_0042980 3300046518 Bacteria 1995
161 Ga0495632_0000337 3300046519 Bacteria 44677
162 Ga0495632_0000809 3300046519 Bacteria 27722
163 Ga0495632_0005882 3300046519 Bacteria 8008
164 Ga0495632_0051789 3300046519 Bacteria 2020
165 Ga0495632_0054455 3300046519 Bacteria 1961
166 Ga0495637_0006366 3300046520 Bacteria 5934
167 Ga0495637_0009572 3300046520 Bacteria 4723
168 Ga0495637_0010919 3300046520 Bacteria 4378
169 Ga0495637_0012537 3300046520 Bacteria 4050
170 Ga0495637_0042422 3300046520 Bacteria 1946
171 Ga0495643_0004454 3300046522 Bacteria 9782
172 Ga0495643_0149563 3300046522 Bacteria 1157
173 Ga0495648_0000489 3300046524 Bacteria 42541
174 Ga0495648_0002490 3300046524 Bacteria 16910
175 Ga0495648_0028042 3300046524 Bacteria 3756
176 Ga0495648_0040461 3300046524 Bacteria 2955
177 Ga0495648_0081148 3300046524 Bacteria 1846
178 Ga0495648_0092770 3300046524 Bacteria 1685
179 Ga0495648_0164621 3300046524 Bacteria 1142
180 Ga0495666_0112332 3300046526 Bacteria 1279
181 Ga0495642_0000082 3300046528 Bacteria 55424
182 Ga0495642_0000614 3300046528 Bacteria 17935
183 Ga0495642_0008247 3300046528 Bacteria 3985
184 Ga0495654_0002809 3300046530 Bacteria 10967
185 Ga0495654_0008201 3300046530 Bacteria 5783
186 Ga0495654_0014398 3300046530 Bacteria 4208
187 Ga0495654_0035022 3300046530 Bacteria 2530
188 Ga0495654_0039244 3300046530 Bacteria 2364
189 Ga0495654_0049997 3300046530 Bacteria 2044
190 Ga0495587_0003814 3300046536 Bacteria 9998
191 Ga0495587_0030035 3300046536 Bacteria 3297
192 Ga0495609_0000008 3300046538 Bacteria 383025
193 Ga0495609_0000043 3300046538 Bacteria 166590
194 Ga0495609_0000316 3300046538 Bacteria 43165
195 Ga0495609_0001746 3300046538 Bacteria 13981
196 Ga0495609_0003357 3300046538 Bacteria 9226
197 Ga0495597_0001812 3300046542 Bacteria 14632
198 Ga0495597_0004173 3300046542 Bacteria 8017
199 Ga0495622_0002129 3300046557 Bacteria 9649
200 Ga0495622_0003956 3300046557 Bacteria 6917
201 Ga0495622_0039369 3300046557 Bacteria 2201
202 Ga0495633_0000009 3300046558 Bacteria 293183
203 Ga0495633_0001615 3300046558 Bacteria 17035
204 Ga0495656_0004525 3300046615 Bacteria 4763
205 Ga0495656_0027305 3300046615 Bacteria 2278
206 Ga0495656_0038529 3300046615 Bacteria 1980
207 Ga0495668_0013772 3300046616 Bacteria 4758
208 Ga0495668_0023769 3300046616 Bacteria 3491
209 Ga0495668_0043534 3300046616 Bacteria 2496
210 Ga0495634_0229519 3300046642 Bacteria 1143
211 Ga0495611_0000881 3300046648 Bacteria 16332
212 Ga0495611_0001920 3300046648 Bacteria 9879
213 Ga0495611_0001963 3300046648 Bacteria 9762
214 Ga0495625_0000101 3300046660 Bacteria 139139
215 Ga0495625_0002877 3300046660 Bacteria 18012
216 Ga0495625_0003812 3300046660 Bacteria 14591
217 Ga0495625_0054522 3300046660 Bacteria 2854
218 Ga0495635_0000974 3300046663 Bacteria 18843
219 Ga0495659_0001444 3300046664 Bacteria 8058
220 Ga0495661_0000029 3300046665 Bacteria 173899
221 Ga0495661_0000683 3300046665 Bacteria 33827
222 Ga0495588_0005503 3300046674 Bacteria 5641
223 Ga0495588_0061872 3300046674 Bacteria 1939
224 Ga0495599_0010036 3300046678 Bacteria 5796
225 Ga0495623_0005517 3300046679 Bacteria 8262
226 Ga0495623_0006658 3300046679 Bacteria 7517
227 Ga0495669_0006789 3300046684 Bacteria 4789
228 Ga0495669_0021051 3300046684 Bacteria 2827
229 Ga0495613_0096296 3300046689 Bacteria 2140
230 Ga0495670_0000754 3300046691 Bacteria 15523
231 Ga0495670_0005261 3300046691 Bacteria 6368
232 Ga0495670_0015669 3300046691 Bacteria 3725
233 Ga0495670_0121336 3300046691 Bacteria 1358
234 Ga0495671_0001167 3300046692 Bacteria 18001
235 Ga0495671_0001456 3300046692 Bacteria 15898
236 Ga0495671_0006886 3300046692 Bacteria 6521
237 Ga0495671_0045519 3300046692 Bacteria 2196
238 Ga0495671_0084166 3300046692 Bacteria 1558
239 Ga0495671_0130060 3300046692 Bacteria 1227
240 Ga0495649_0000520 3300046694 Bacteria 32804
241 Ga0495589_0000562 3300046794 Bacteria 25678
242 Ga0495589_0002795 3300046794 Bacteria 9654
243 Ga0495589_0006121 3300046794 Bacteria 6356
244 Ga0495589_0006667 3300046794 Bacteria 6082
245 Ga0495660_0002662 3300046810 Bacteria 11311
246 Ga0495660_0005147 3300046810 Bacteria 7858
247 Ga0495660_0012098 3300046810 Bacteria 5005
248 Ga0495660_0025524 3300046810 Bacteria 3355
249 Ga0495660_0090455 3300046810 Bacteria 1591
250 Ga0495604_0001350 3300047317 Bacteria 20066
251 Ga0495604_0007361 3300047317 Bacteria 8720
252 Ga0495604_0050064 3300047317 Bacteria 3244
253 Ga0495636_0003234 3300047318 Bacteria 6322
254 Ga0495674_0004091 3300047319 Bacteria 14102
255 Ga0495674_0061922 3300047319 Bacteria 3259
256 Ga0495672_0006877 3300047320 Bacteria 8676
257 Ga0495672_0050685 3300047320 Bacteria 2448
258 Ga0495676_0000071 3300047321 Bacteria 76592
259 Ga0495680_0034478 3300047322 Bacteria 4086
260 Ga0495680_0131754 3300047322 Bacteria 1836
261 Ga0495683_0000037 3300047323 Bacteria 140632
262 Ga0495683_0000039 3300047323 Bacteria 137702
263 Ga0495683_0018642 3300047323 Bacteria 3585
264 Ga0495683_0020994 3300047323 Bacteria 3366
265 Ga0495683_0051006 3300047323 Bacteria 2070
266 Ga0495675_0001140 3300047444 Bacteria 16148
267 Ga0495677_0000486 3300047445 Bacteria 16837
268 Ga0495677_0002366 3300047445 Bacteria 7411
269 Ga0495679_000160 3300047446 Bacteria 61002
270 Ga0495679_000236 3300047446 Bacteria 45851
271 Ga0495679_012800 3300047446 Bacteria 3176
272 Ga0495673_0000093 3300047469 Bacteria 185841
273 Ga0495673_0000118 3300047469 Bacteria 147670
274 Ga0495673_0000319 3300047469 Bacteria 61961
275 Ga0495673_0002274 3300047469 Bacteria 13772
276 Ga0495673_0040276 3300047469 Bacteria 2112
277 Ga0495681_0000023 3300047470 Bacteria 154266
278 Ga0495681_0007115 3300047470 Bacteria 7216
279 Ga0495681_0007940 3300047470 Bacteria 6705
280 Ga0495681_0018538 3300047470 Bacteria 3833
281 Ga0495681_0046686 3300047470 Bacteria 2064
282 Ga0495681_0110215 3300047470 Bacteria 1193
283 Ga0495686_0000101 3300047472 Bacteria 178238
284 Ga0495686_0000326 3300047472 Bacteria 78600
285 Ga0495686_0004072 3300047472 Bacteria 12209
286 Ga0495686_0012995 3300047472 Bacteria 5800
287 Ga0495686_0035953 3300047472 Bacteria 3180
288 Ga0495593_0017638 3300047673 Bacteria 4018
289 Ga0495602_0004273 3300048088 Bacteria 14870
290 Ga0495614_0014589 3300048089 Bacteria 3436
291 Ga0495626_0000045 3300048091 Bacteria 164931
292 Ga0495626_0008878 3300048091 Bacteria 5461
293 Ga0496102_0002794 3300048905 Bacteria 14880
294 Ga0496102_0080628 3300048905 Bacteria 2998
295 Ga0496103_0002417 3300048906 Bacteria 11750
296 Ga0496111_0076087 3300048914 Bacteria 2446
297 Ga0496114_0013372 3300048917 Bacteria 6580
298 Ga0496114_0328116 3300048917 Bacteria 1353
299 Ga0496115_0002159 3300048918 Bacteria 14064
300 Ga0496116_0056833 3300048919 Bacteria 2562
301 Ga0496116_0090000 3300048919 Unclassified 1870
302 Ga0496117_0000571 3300048920 Bacteria 60417
303 Ga0496117_0006453 3300048920 Bacteria 11865
304 Ga0496117_0015523 3300048920 Bacteria 6487
305 Ga0496117_0229119 3300048920 Bacteria 1028
306 Ga0496118_0000832 3300048921 Bacteria 49071
307 Ga0496118_0016993 3300048921 Bacteria 6644
308 Ga0496118_0064123 3300048921 Bacteria 2698
309 Ga0496118_0127825 3300048921 Bacteria 1639
310 Ga0496118_0150004 3300048921 Bacteria 1461
311 Ga0496119_0033975 3300048922 Bacteria 3369
312 Ga0496119_0091410 3300048922 Bacteria 1728
313 Ga0496120_0018436 3300048923 Bacteria 4499
314 Ga0496120_0023502 3300048923 Bacteria 3859
315 Ga0496120_0083871 3300048923 Bacteria 1719
316 Ga0496121_0000249 3300048924 Bacteria 114260
317 Ga0496121_0171755 3300048924 Bacteria 1574
318 Ga0496121_0283825 3300048924 Bacteria 1131
319 Ga0496122_0015911 3300048925 Bacteria 7160
320 Ga0496123_0033851 3300048926 Bacteria 3670
321 Ga0496123_0055855 3300048926 Bacteria 2586
322 Ga0496124_0023182 3300048927 Bacteria 5672
323 Ga0496124_0067672 3300048927 Bacteria 2971
324 Ga0496125_0003865 3300048928 Bacteria 17724
325 Ga0496125_0017859 3300048928 Bacteria 6750
326 Ga0496125_0021777 3300048928 Bacteria 5964
327 Ga0496125_0078586 3300048928 Bacteria 2535
328 Ga0496126_0000138 3300048929 Bacteria 167324
329 Ga0496126_0000426 3300048929 Bacteria 84838
330 Ga0496126_0047165 3300048929 Bacteria 3945
331 Ga0496126_0360446 3300048929 Bacteria 1187
332 Ga0495678_000011 3300049459 Bacteria 335512
333 Ga0495678_029257 3300049459 Bacteria 2315
334 Ga0495682_0006897 3300049460 Bacteria 4563
335 Ga0495682_0018761 3300049460 Bacteria 2604
336 Ga0495682_0029078 3300049460 Bacteria 2046
337 nmdc:mga0n895_226577_c1 3300050512 Bacteria 1897
338 nmdc:mga0a205_270527_c1 3300050515 Bacteria 1576
339 Ga0500643_047182 3300053087 Bacteria 1242
340 Ga0500618_000669 3300053125 Bacteria 20161
341 Ga0500568_0000185 3300053139 Bacteria 54765
342 Ga0500590_024856 3300053148 Bacteria 3109
343 Ga0500622_0005636 3300053156 Bacteria 7459
344 Ga0500622_0017340 3300053156 Bacteria 3831
345 Ga0500633_0069105 3300053160 Bacteria 1258
346 Ga0500645_032678 3300053730 Bacteria 1559

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300050512 nmdc:mga0n895_226577_c1 nmdc:mga0n895_226577_c1_18_806 252
2 3300048929 Ga0496126_0360446 Ga0496126_0360446_326_1105 254
3 3300046528 Ga0495642_0000614 Ga0495642_0000614_11705_12679 290
4 3300046616 Ga0495668_0013772 Ga0495668_0013772_1440_2414 290
5 3300046648 Ga0495611_0000881 Ga0495611_0000881_11928_12902 290
6 3300047445 Ga0495677_0002366 Ga0495677_0002366_2328_3302 290
7 3300053087 Ga0500643_047182 Ga0500643_047182_239_1177 293
8 3300003775 Ga0055524_1000085 Ga0055524_100008598 300
9 3300025263 Ga0209565_1006742 Ga0209565_10067422 300
10 3300025291 Ga0209675_1005399 Ga0209675_10053992 300
11 3300025299 Ga0209256_1000036 Ga0209256_100003634 300
12 3300048917 Ga0496114_0013372 Ga0496114_0013372_682_1620 300
13 3300006852 Ga0075433_10329151 Ga0075433_103291512 304
14 3300006871 Ga0075434_100317917 Ga0075434_1003179171 304
15 3300009147 Ga0114129_10820922 Ga0114129_108209221 304
16 3300050515 nmdc:mga0a205_270527_c1 nmdc:mga0a205_270527_c1_356_1300 304
17 3300046453 Ga0495627_020845 Ga0495627_020845_108_1025 305
18 3300046458 Ga0495591_005101 Ga0495591_005101_345_1262 305
19 3300046474 Ga0495605_0000002 Ga0495605_0000002_276458_277375 305
20 3300046499 Ga0495594_0049214 Ga0495594_0049214_1155_2072 305
21 3300046506 Ga0495583_0000012 Ga0495583_0000012_144188_145105 305
22 3300046515 Ga0495620_0000238 Ga0495620_0000238_18557_19474 305
23 3300046519 Ga0495632_0000337 Ga0495632_0000337_20586_21503 305
24 3300046520 Ga0495637_0010919 Ga0495637_0010919_649_1566 305
25 3300046520 Ga0495637_0042422 Ga0495637_0042422_567_1484 305
26 3300046524 Ga0495648_0000489 Ga0495648_0000489_40297_41214 305
27 3300046538 Ga0495609_0000008 Ga0495609_0000008_237852_238769 305
28 3300046542 Ga0495597_0001812 Ga0495597_0001812_9846_10763 305
29 3300046558 Ga0495633_0000009 Ga0495633_0000009_258654_259571 305
30 3300046648 Ga0495611_0001963 Ga0495611_0001963_128_1045 305
31 3300046665 Ga0495661_0000029 Ga0495661_0000029_21470_22387 305
32 3300046794 Ga0495589_0000562 Ga0495589_0000562_7978_8895 305
33 3300046810 Ga0495660_0002662 Ga0495660_0002662_10082_10999 305
34 3300047319 Ga0495674_0004091 Ga0495674_0004091_6077_7087 305
35 3300047323 Ga0495683_0000039 Ga0495683_0000039_81569_82486 305
36 3300047446 Ga0495679_000160 Ga0495679_000160_1651_2568 305
37 3300047469 Ga0495673_0000118 Ga0495673_0000118_72011_72928 305
38 3300047469 Ga0495673_0002274 Ga0495673_0002274_6497_7414 305
39 3300047470 Ga0495681_0018538 Ga0495681_0018538_2846_3763 305
40 3300049459 Ga0495678_000011 Ga0495678_000011_251733_252650 305
41 3300005834 Ga0068851_10062448 Ga0068851_100624482 306
42 3300009093 Ga0105240_10000012 Ga0105240_10000012271 306
43 3300009148 Ga0105243_10137046 Ga0105243_101370462 306
44 3300009177 Ga0105248_10203136 Ga0105248_102031363 306
45 3300009545 Ga0105237_10000054 Ga0105237_1000005437 306
46 3300013104 Ga0157370_10001998 Ga0157370_1000199812 306
47 3300025913 Ga0207695_10000097 Ga0207695_1000009760 306
48 3300025914 Ga0207671_10000023 Ga0207671_10000023143 306
49 3300025941 Ga0207711_10311312 Ga0207711_103113122 306
50 3300025986 Ga0207658_10222105 Ga0207658_102221052 306
51 3300030521 Ga0307511_10056545 Ga0307511_100565453 306
52 3300046519 Ga0495632_0051789 Ga0495632_0051789_441_1379 306
53 3300048922 Ga0496119_0091410 Ga0496119_0091410_247_1197 306
54 3300048923 Ga0496120_0083871 Ga0496120_0083871_532_1482 306
55 3300048925 Ga0496122_0015911 Ga0496122_0015911_3261_4211 306
56 3300048926 Ga0496123_0055855 Ga0496123_0055855_860_1810 306
57 3300048928 Ga0496125_0017859 Ga0496125_0017859_2561_3511 306
58 iso_pu_bacteria 2511231018 2511335805 306
59 iso_pu_bacteria 2511231019 2511347100 306
60 iso_pu_bacteria 2513237165 2514043359 306
61 iso_pu_bacteria 2582581298 2585221146 306
62 iso_pu_bacteria 2582581316 2585332709 306
63 iso_pu_bacteria 2585427529 2585549348 306
64 iso_pu_bacteria 2643221633 2644186693 306
65 iso_pu_bacteria 2773857670 2774123600 306
66 iso_pu_bacteria 2784132072 2784317233 306
67 iso_pu_bacteria 2808606382 2808958249 306
68 iso_pu_bacteria 2821443989 2821450000 306
69 iso_pu_bacteria 2840764183 2840766097 306
70 iso_pu_bacteria 2842324504 2842326997 306
71 iso_pu_bacteria 2842348783 2842350602 306
72 iso_pu_bacteria 2842454564 2842456657 306
73 iso_pu_bacteria 2842871566 2842874336 306
74 iso_pu_bacteria 2860339153 2860342203 306
75 iso_pu_bacteria 2874168670 2874173025 306
76 iso_pu_bacteria 2902405164 2902409319 306
77 iso_pu_bacteria 2904578770 2904580299 306
78 iso_pu_bacteria 2919119836 2919120025 306
79 iso_pu_bacteria 2919456309 2919456345 306
80 iso_pu_bacteria 2931396565 2931401137 306
81 iso_pu_bacteria 2941479691 2941481311 306
82 iso_pu_bacteria 3007511990 3007514687 306
83 iso_pu_bacteria 3007619802 3007621891 306
84 iso_pu_bacteria 643348564 643598783 306
85 iso_pu_bacteria 644736347 644747722 306
86 iso_pu_bacteria 2904541872 2904543800 307
87 iso_pu_bacteria 2929160207 2929162642 307
88 3300031090 Ga0265760_10067161 Ga0265760_100671611 308
89 3300048922 Ga0496119_0033975 Ga0496119_0033975_2245_3201 308
90 3300005445 Ga0070708_100124880 Ga0070708_1001248803 309
91 3300005467 Ga0070706_100319860 Ga0070706_1003198602 309
92 3300005468 Ga0070707_100129835 Ga0070707_1001298353 309
93 3300005471 Ga0070698_100139350 Ga0070698_1001393501 309
94 3300005536 Ga0070697_100067322 Ga0070697_1000673223 309
95 3300006028 Ga0070717_10170089 Ga0070717_101700892 309
96 3300006946 Ga0079104_1000073 Ga0079104_10000731 309
97 3300025294 Ga0209025_1004181 Ga0209025_100418111 309
98 3300025297 Ga0209758_1025360 Ga0209758_10253603 309
99 3300025298 Ga0209050_1009579 Ga0209050_10095794 309
100 3300046460 Ga0495638_0005498 Ga0495638_0005498_5596_6567 309
101 3300046660 Ga0495625_0002877 Ga0495625_0002877_13906_14877 309
102 2124908027 MRS2a_Contig_5159 MRS2a_00058320 310
103 3300003323 rootH1_10071460 rootH1_100714602 310
104 3300003781 Ga0055536_1010597 Ga0055536_10105971 310
105 3300003791 Ga0055530_10000421 Ga0055530_1000042132 310
106 3300005262 Ga0065165_1000498 Ga0065165_100049842 310
107 3300005288 Ga0065714_10000224 Ga0065714_100002247 310
108 3300005288 Ga0065714_10076134 Ga0065714_100761343 310
109 3300005434 Ga0070709_10166486 Ga0070709_101664861 310
110 3300005455 Ga0070663_100004380 Ga0070663_1000043804 310
111 3300005467 Ga0070706_100060374 Ga0070706_1000603743 310
112 3300005467 Ga0070706_100077132 Ga0070706_1000771323 310
113 3300005468 Ga0070707_100040899 Ga0070707_1000408993 310
114 3300005468 Ga0070707_100054440 Ga0070707_1000544402 310
115 3300005471 Ga0070698_100089523 Ga0070698_1000895232 310
116 3300005518 Ga0070699_100021232 Ga0070699_1000212326 310
117 3300005518 Ga0070699_100024954 Ga0070699_1000249542 310
118 3300005536 Ga0070697_100143022 Ga0070697_1001430222 310
119 3300005841 Ga0068863_100111383 Ga0068863_1001113833 310
120 3300006028 Ga0070717_10001870 Ga0070717_1000187021 310
121 3300006173 Ga0070716_100007766 Ga0070716_1000077667 310
122 3300006175 Ga0070712_100092474 Ga0070712_1000924742 310
123 3300007265 Ga0099794_10002642 Ga0099794_100026422 310
124 3300009101 Ga0105247_10233632 Ga0105247_102336321 310
125 3300009553 Ga0105249_10228039 Ga0105249_102280392 310
126 3300013102 Ga0157371_10002537 Ga0157371_1000253712 310
127 3300013102 Ga0157371_10233256 Ga0157371_102332561 310
128 3300013104 Ga0157370_10005014 Ga0157370_1000501414 310
129 3300013104 Ga0157370_10064494 Ga0157370_100644944 310
130 3300013104 Ga0157370_10200040 Ga0157370_102000402 310
131 3300013306 Ga0163162_10000656 Ga0163162_100006564 310
132 3300013306 Ga0163162_10015341 Ga0163162_100153414 310
133 3300014497 Ga0182008_10004936 Ga0182008_100049368 310
134 3300015262 Ga0182007_10000306 Ga0182007_100003069 310
135 3300015265 Ga0182005_1002224 Ga0182005_10022243 310
136 3300015265 Ga0182005_1004064 Ga0182005_10040643 310
137 3300015265 Ga0182005_1011095 Ga0182005_10110953 310
138 3300017792 Ga0163161_10002355 Ga0163161_100023554 310
139 3300017792 Ga0163161_10049660 Ga0163161_100496602 310
140 3300025292 Ga0209676_1000097 Ga0209676_1000097229 310
141 3300025294 Ga0209025_1000594 Ga0209025_10005947 310
142 3300025298 Ga0209050_1005012 Ga0209050_10050124 310
143 3300025711 Ga0207696_1031148 Ga0207696_10311482 310
144 3300025728 Ga0207655_1018366 Ga0207655_10183665 310
145 3300025735 Ga0207713_1019882 Ga0207713_10198823 310
146 3300025906 Ga0207699_10145833 Ga0207699_101458331 310
147 3300025915 Ga0207693_10263696 Ga0207693_102636961 310
148 3300025915 Ga0207693_10399080 Ga0207693_103990801 310
149 3300025916 Ga0207663_10042205 Ga0207663_100422052 310
150 3300025922 Ga0207646_10082859 Ga0207646_100828592 310
151 3300025922 Ga0207646_10264819 Ga0207646_102648191 310
152 3300025941 Ga0207711_10108366 Ga0207711_101083662 310
153 3300025941 Ga0207711_10116697 Ga0207711_101166973 310
154 3300026035 Ga0207703_10307467 Ga0207703_103074672 310
155 3300026067 Ga0207678_10026524 Ga0207678_100265244 310
156 3300026088 Ga0207641_10029962 Ga0207641_100299624 310
157 3300026088 Ga0207641_10288323 Ga0207641_102883232 310
158 3300031251 Ga0265327_10003283 Ga0265327_1000328314 310
159 3300031456 Ga0307513_10000549 Ga0307513_1000054943 310
160 3300031616 Ga0307508_10007098 Ga0307508_100070989 310
161 3300037418 Ga0395900_0026088 Ga0395900_0026088_4311_5264 310
162 3300039447 Ga0436361_0049906 Ga0436361_0049906_3259_4311 310
163 3300041407 Ga0439447_000346 Ga0439447_000346_11823_12755 310
164 3300041407 Ga0439447_000499 Ga0439447_000499_8912_9844 310
165 3300041411 Ga0439466_0000604 Ga0439466_0000604_7801_8733 310
166 3300042006 Ga0439432_020317 Ga0439432_020317_287_1219 310
167 3300042010 Ga0439452_000230 Ga0439452_000230_30327_31259 310
168 3300042137 Ga0450902_001483 Ga0450902_001483_480_1412 310
169 3300042138 Ga0450903_001483 Ga0450903_001483_1939_2871 310
170 3300042146 Ga0450907_000058 Ga0450907_000058_9933_10865 310
171 3300042156 Ga0439446_0017357 Ga0439446_0017357_645_1577 310
172 3300042185 Ga0450909_004147 Ga0450909_004147_63_995 310
173 3300042435 Ga0439434_0001657 Ga0439434_0001657_2479_3411 310
174 3300042461 Ga0439460_0001297 Ga0439460_0001297_4544_5476 310
175 3300042993 Ga0439440_0008683 Ga0439440_0008683_408_1340 310
176 3300046452 Ga0495617_001657 Ga0495617_001657_1122_2087 310
177 3300046452 Ga0495617_040049 Ga0495617_040049_287_1219 310
178 3300046452 Ga0495617_066414 Ga0495617_066414_105_1043 310
179 3300046454 Ga0495592_0287068 Ga0495592_0287068_63_1007 310
180 3300046455 Ga0495603_0002364 Ga0495603_0002364_7241_8179 310
181 3300046455 Ga0495603_0005483 Ga0495603_0005483_588_1520 310
182 3300046457 Ga0495590_0015575 Ga0495590_0015575_576_1508 310
183 3300046458 Ga0495591_000568 Ga0495591_000568_24231_25250 310
184 3300046460 Ga0495638_0002136 Ga0495638_0002136_14315_15256 310
185 3300046460 Ga0495638_0003736 Ga0495638_0003736_967_1899 310
186 3300046471 Ga0495650_0000405 Ga0495650_0000405_56937_57869 310
187 3300046471 Ga0495650_0003886 Ga0495650_0003886_1239_2171 310
188 3300046471 Ga0495650_0008598 Ga0495650_0008598_4473_5411 310
189 3300046471 Ga0495650_0015667 Ga0495650_0015667_643_1575 310
190 3300046471 Ga0495650_0024321 Ga0495650_0024321_326_1267 310
191 3300046474 Ga0495605_0000001 Ga0495605_0000001_323055_324026 310
192 3300046474 Ga0495605_0000596 Ga0495605_0000596_19373_20314 310
193 3300046474 Ga0495605_0002542 Ga0495605_0002542_4033_4989 310
194 3300046474 Ga0495605_0010814 Ga0495605_0010814_349_1281 310
195 3300046474 Ga0495605_0017727 Ga0495605_0017727_1772_2704 310
196 3300046474 Ga0495605_0019142 Ga0495605_0019142_1776_2750 310
197 3300046474 Ga0495605_0020392 Ga0495605_0020392_1183_2121 310
198 3300046474 Ga0495605_0025618 Ga0495605_0025618_123_1088 310
199 3300046474 Ga0495605_0030187 Ga0495605_0030187_1647_2579 310
200 3300046491 Ga0495584_0000140 Ga0495584_0000140_9468_10400 310
201 3300046491 Ga0495584_0029936 Ga0495584_0029936_319_1251 310
202 3300046491 Ga0495584_0139148 Ga0495584_0139148_175_1107 310
203 3300046492 Ga0495585_0004195 Ga0495585_0004195_2492_3457 310
204 3300046492 Ga0495585_0006562 Ga0495585_0006562_188_1120 310
205 3300046492 Ga0495585_0035561 Ga0495585_0035561_280_1212 310
206 3300046499 Ga0495594_0021800 Ga0495594_0021800_1062_1994 310
207 3300046501 Ga0495607_0007373 Ga0495607_0007373_3053_3991 310
208 3300046501 Ga0495607_0012901 Ga0495607_0012901_4184_5116 310
209 3300046501 Ga0495607_0071430 Ga0495607_0071430_832_1851 310
210 3300046501 Ga0495607_0075874 Ga0495607_0075874_627_1559 310
211 3300046506 Ga0495583_0000012 Ga0495583_0000012_146744_147676 310
212 3300046506 Ga0495583_0000384 Ga0495583_0000384_24768_25700 310
213 3300046506 Ga0495583_0000958 Ga0495583_0000958_24966_25898 310
214 3300046506 Ga0495583_0003084 Ga0495583_0003084_1620_2552 310
215 3300046507 Ga0495606_0000502 Ga0495606_0000502_24767_25744 310
216 3300046507 Ga0495606_0001784 Ga0495606_0001784_17145_18077 310
217 3300046507 Ga0495606_0003335 Ga0495606_0003335_12923_13861 310
218 3300046513 Ga0495616_0004436 Ga0495616_0004436_3155_4093 310
219 3300046513 Ga0495616_0024999 Ga0495616_0024999_2221_3153 310
220 3300046513 Ga0495616_0071354 Ga0495616_0071354_328_1260 310
221 3300046516 Ga0495628_0256952 Ga0495628_0256952_204_1136 310
222 3300046517 Ga0495630_0052143 Ga0495630_0052143_1896_2852 310
223 3300046518 Ga0495631_0000002 Ga0495631_0000002_31795_32733 310
224 3300046518 Ga0495631_0018585 Ga0495631_0018585_158_1090 310
225 3300046518 Ga0495631_0026138 Ga0495631_0026138_1387_2319 310
226 3300046518 Ga0495631_0042980 Ga0495631_0042980_156_1097 310
227 3300046519 Ga0495632_0000809 Ga0495632_0000809_17279_18211 310
228 3300046519 Ga0495632_0005882 Ga0495632_0005882_6702_7634 310
229 3300046519 Ga0495632_0054455 Ga0495632_0054455_69_1001 310
230 3300046520 Ga0495637_0006366 Ga0495637_0006366_1247_2179 310
231 3300046520 Ga0495637_0009572 Ga0495637_0009572_1222_2160 310
232 3300046520 Ga0495637_0012537 Ga0495637_0012537_1902_2849 310
233 3300046522 Ga0495643_0004454 Ga0495643_0004454_1602_2534 310
234 3300046522 Ga0495643_0149563 Ga0495643_0149563_158_1090 310
235 3300046524 Ga0495648_0002490 Ga0495648_0002490_6126_7064 310
236 3300046524 Ga0495648_0028042 Ga0495648_0028042_608_1573 310
237 3300046524 Ga0495648_0040461 Ga0495648_0040461_594_1532 310
238 3300046524 Ga0495648_0081148 Ga0495648_0081148_465_1397 310
239 3300046524 Ga0495648_0092770 Ga0495648_0092770_53_985 310
240 3300046524 Ga0495648_0164621 Ga0495648_0164621_148_1080 310
241 3300046526 Ga0495666_0112332 Ga0495666_0112332_54_986 310
242 3300046528 Ga0495642_0000082 Ga0495642_0000082_10906_11838 310
243 3300046528 Ga0495642_0008247 Ga0495642_0008247_1556_2497 310
244 3300046530 Ga0495654_0002809 Ga0495654_0002809_7807_8739 310
245 3300046530 Ga0495654_0008201 Ga0495654_0008201_1510_2442 310
246 3300046530 Ga0495654_0014398 Ga0495654_0014398_186_1124 310
247 3300046530 Ga0495654_0035022 Ga0495654_0035022_1441_2373 310
248 3300046530 Ga0495654_0039244 Ga0495654_0039244_211_1143 310
249 3300046530 Ga0495654_0049997 Ga0495654_0049997_449_1381 310
250 3300046536 Ga0495587_0003814 Ga0495587_0003814_7950_8882 310
251 3300046536 Ga0495587_0030035 Ga0495587_0030035_1022_1966 310
252 3300046538 Ga0495609_0000008 Ga0495609_0000008_235281_236213 310
253 3300046538 Ga0495609_0000043 Ga0495609_0000043_102922_103854 310
254 3300046538 Ga0495609_0000316 Ga0495609_0000316_40718_41650 310
255 3300046538 Ga0495609_0001746 Ga0495609_0001746_11567_12499 310
256 3300046538 Ga0495609_0003357 Ga0495609_0003357_5432_6364 310
257 3300046542 Ga0495597_0004173 Ga0495597_0004173_5395_6327 310
258 3300046557 Ga0495622_0002129 Ga0495622_0002129_5256_6188 310
259 3300046557 Ga0495622_0003956 Ga0495622_0003956_2605_3537 310
260 3300046557 Ga0495622_0039369 Ga0495622_0039369_1217_2149 310
261 3300046558 Ga0495633_0001615 Ga0495633_0001615_7300_8238 310
262 3300046615 Ga0495656_0004525 Ga0495656_0004525_1013_1945 310
263 3300046615 Ga0495656_0027305 Ga0495656_0027305_1009_1941 310
264 3300046615 Ga0495656_0038529 Ga0495656_0038529_101_1120 310
265 3300046616 Ga0495668_0023769 Ga0495668_0023769_1570_2502 310
266 3300046616 Ga0495668_0043534 Ga0495668_0043534_1420_2352 310
267 3300046642 Ga0495634_0229519 Ga0495634_0229519_88_1032 310
268 3300046648 Ga0495611_0001920 Ga0495611_0001920_6488_7420 310
269 3300046660 Ga0495625_0000101 Ga0495625_0000101_43531_44463 310
270 3300046660 Ga0495625_0003812 Ga0495625_0003812_8717_9655 310
271 3300046660 Ga0495625_0054522 Ga0495625_0054522_294_1259 310
272 3300046663 Ga0495635_0000974 Ga0495635_0000974_4176_5108 310
273 3300046664 Ga0495659_0001444 Ga0495659_0001444_3358_4290 310
274 3300046665 Ga0495661_0000029 Ga0495661_0000029_24026_24958 310
275 3300046665 Ga0495661_0000683 Ga0495661_0000683_5554_6486 310
276 3300046674 Ga0495588_0005503 Ga0495588_0005503_3041_3973 310
277 3300046674 Ga0495588_0061872 Ga0495588_0061872_640_1572 310
278 3300046678 Ga0495599_0010036 Ga0495599_0010036_197_1132 310
279 3300046679 Ga0495623_0005517 Ga0495623_0005517_1131_2063 310
280 3300046679 Ga0495623_0006658 Ga0495623_0006658_450_1385 310
281 3300046684 Ga0495669_0006789 Ga0495669_0006789_2470_3402 310
282 3300046684 Ga0495669_0021051 Ga0495669_0021051_1658_2599 310
283 3300046689 Ga0495613_0096296 Ga0495613_0096296_932_1864 310
284 3300046691 Ga0495670_0000754 Ga0495670_0000754_5181_6113 310
285 3300046691 Ga0495670_0005261 Ga0495670_0005261_1925_2866 310
286 3300046691 Ga0495670_0015669 Ga0495670_0015669_1243_2208 310
287 3300046691 Ga0495670_0121336 Ga0495670_0121336_165_1103 310
288 3300046692 Ga0495671_0001167 Ga0495671_0001167_12387_13406 310
289 3300046692 Ga0495671_0001456 Ga0495671_0001456_3811_4743 310
290 3300046692 Ga0495671_0006886 Ga0495671_0006886_3584_4516 310
291 3300046692 Ga0495671_0045519 Ga0495671_0045519_1238_2170 310
292 3300046692 Ga0495671_0084166 Ga0495671_0084166_608_1540 310
293 3300046692 Ga0495671_0130060 Ga0495671_0130060_37_969 310
294 3300046694 Ga0495649_0000520 Ga0495649_0000520_25948_26925 310
295 3300046794 Ga0495589_0002795 Ga0495589_0002795_7188_8129 310
296 3300046794 Ga0495589_0006121 Ga0495589_0006121_4560_5498 310
297 3300046794 Ga0495589_0006667 Ga0495589_0006667_1395_2327 310
298 3300046810 Ga0495660_0005147 Ga0495660_0005147_1454_2386 310
299 3300046810 Ga0495660_0012098 Ga0495660_0012098_3761_4726 310
300 3300046810 Ga0495660_0025524 Ga0495660_0025524_1024_1956 310
301 3300046810 Ga0495660_0090455 Ga0495660_0090455_280_1212 310
302 3300047317 Ga0495604_0001350 Ga0495604_0001350_9130_10065 310
303 3300047317 Ga0495604_0007361 Ga0495604_0007361_5841_6785 310
304 3300047317 Ga0495604_0050064 Ga0495604_0050064_984_1916 310
305 3300047318 Ga0495636_0003234 Ga0495636_0003234_14_955 310
306 3300047319 Ga0495674_0061922 Ga0495674_0061922_1832_2764 310
307 3300047320 Ga0495672_0006877 Ga0495672_0006877_3188_4153 310
308 3300047320 Ga0495672_0050685 Ga0495672_0050685_323_1255 310
309 3300047321 Ga0495676_0000071 Ga0495676_0000071_62776_63708 310
310 3300047322 Ga0495680_0034478 Ga0495680_0034478_1101_2036 310
311 3300047322 Ga0495680_0131754 Ga0495680_0131754_458_1390 310
312 3300047323 Ga0495683_0000037 Ga0495683_0000037_32130_33068 310
313 3300047323 Ga0495683_0018642 Ga0495683_0018642_1231_2163 310
314 3300047323 Ga0495683_0020994 Ga0495683_0020994_1551_2483 310
315 3300047323 Ga0495683_0051006 Ga0495683_0051006_861_1793 310
316 3300047444 Ga0495675_0001140 Ga0495675_0001140_15106_16041 310
317 3300047445 Ga0495677_0000486 Ga0495677_0000486_1208_2140 310
318 3300047446 Ga0495679_000236 Ga0495679_000236_42469_43401 310
319 3300047446 Ga0495679_012800 Ga0495679_012800_615_1547 310
320 3300047469 Ga0495673_0000093 Ga0495673_0000093_157441_158379 310
321 3300047469 Ga0495673_0000319 Ga0495673_0000319_6510_7442 310
322 3300047469 Ga0495673_0002274 Ga0495673_0002274_9053_9985 310
323 3300047469 Ga0495673_0040276 Ga0495673_0040276_1047_2012 310
324 3300047470 Ga0495681_0000023 Ga0495681_0000023_142150_143082 310
325 3300047470 Ga0495681_0007115 Ga0495681_0007115_5449_6381 310
326 3300047470 Ga0495681_0007940 Ga0495681_0007940_1142_2080 310
327 3300047470 Ga0495681_0046686 Ga0495681_0046686_249_1181 310
328 3300047470 Ga0495681_0110215 Ga0495681_0110215_208_1149 310
329 3300047472 Ga0495686_0000101 Ga0495686_0000101_21552_22598 310
330 3300047472 Ga0495686_0000326 Ga0495686_0000326_70294_71280 310
331 3300047472 Ga0495686_0004072 Ga0495686_0004072_9743_10699 310
332 3300047472 Ga0495686_0012995 Ga0495686_0012995_3501_4433 310
333 3300047472 Ga0495686_0035953 Ga0495686_0035953_33_998 310
334 3300047673 Ga0495593_0017638 Ga0495593_0017638_3058_3990 310
335 3300048088 Ga0495602_0004273 Ga0495602_0004273_9231_10166 310
336 3300048089 Ga0495614_0014589 Ga0495614_0014589_2480_3412 310
337 3300048091 Ga0495626_0000045 Ga0495626_0000045_62424_63356 310
338 3300048091 Ga0495626_0008878 Ga0495626_0008878_399_1331 310
339 3300048905 Ga0496102_0002794 Ga0496102_0002794_9592_10524 310
340 3300048905 Ga0496102_0080628 Ga0496102_0080628_856_1797 310
341 3300048906 Ga0496103_0002417 Ga0496103_0002417_9592_10524 310
342 3300048914 Ga0496111_0076087 Ga0496111_0076087_628_1560 310
343 3300048917 Ga0496114_0328116 Ga0496114_0328116_109_1041 310
344 3300048918 Ga0496115_0002159 Ga0496115_0002159_1594_2553 310
345 3300048919 Ga0496116_0056833 Ga0496116_0056833_1407_2339 310
346 3300048919 Ga0496116_0090000 Ga0496116_0090000_505_1509 310
347 3300048920 Ga0496117_0000571 Ga0496117_0000571_13927_14901 310
348 3300048920 Ga0496117_0006453 Ga0496117_0006453_9583_10515 310
349 3300048920 Ga0496117_0015523 Ga0496117_0015523_5431_6375 310
350 3300048920 Ga0496117_0229119 Ga0496117_0229119_73_1011 310
351 3300048921 Ga0496118_0000832 Ga0496118_0000832_6686_7660 310
352 3300048921 Ga0496118_0016993 Ga0496118_0016993_4408_5340 310
353 3300048921 Ga0496118_0064123 Ga0496118_0064123_895_1833 310
354 3300048921 Ga0496118_0127825 Ga0496118_0127825_63_1004 310
355 3300048921 Ga0496118_0150004 Ga0496118_0150004_258_1199 310
356 3300048923 Ga0496120_0018436 Ga0496120_0018436_1314_2252 310
357 3300048923 Ga0496120_0023502 Ga0496120_0023502_2314_3273 310
358 3300048924 Ga0496121_0000249 Ga0496121_0000249_42481_43419 310
359 3300048924 Ga0496121_0171755 Ga0496121_0171755_228_1292 310
360 3300048924 Ga0496121_0283825 Ga0496121_0283825_40_978 310
361 3300048926 Ga0496123_0033851 Ga0496123_0033851_1383_2321 310
362 3300048927 Ga0496124_0023182 Ga0496124_0023182_53_985 310
363 3300048927 Ga0496124_0067672 Ga0496124_0067672_450_1388 310
364 3300048928 Ga0496125_0003865 Ga0496125_0003865_8192_9130 310
365 3300048928 Ga0496125_0021777 Ga0496125_0021777_76_1008 310
366 3300048928 Ga0496125_0078586 Ga0496125_0078586_895_1827 310
367 3300048929 Ga0496126_0000138 Ga0496126_0000138_70000_70947 310
368 3300048929 Ga0496126_0000426 Ga0496126_0000426_83803_84747 310
369 3300048929 Ga0496126_0047165 Ga0496126_0047165_2553_3491 310
370 3300049459 Ga0495678_029257 Ga0495678_029257_193_1125 310
371 3300049460 Ga0495682_0006897 Ga0495682_0006897_1551_2483 310
372 3300049460 Ga0495682_0018761 Ga0495682_0018761_1551_2483 310
373 3300049460 Ga0495682_0029078 Ga0495682_0029078_201_1133 310
374 3300053125 Ga0500618_000669 Ga0500618_000669_13412_14419 310
375 3300053139 Ga0500568_0000185 Ga0500568_0000185_40801_41745 310
376 3300053148 Ga0500590_024856 Ga0500590_024856_1829_2773 310
377 3300053156 Ga0500622_0005636 Ga0500622_0005636_1706_2710 310
378 3300053156 Ga0500622_0017340 Ga0500622_0017340_1019_1978 310
379 3300053160 Ga0500633_0069105 Ga0500633_0069105_227_1165 310
380 3300053730 Ga0500645_032678 Ga0500645_032678_56_1003 310

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00165

HTH_AraC

Bacterial regulatory helix-turn-helix proteins, AraC family

284

323

0.95

PF12833

HTH_18

Helix-turn-helix domain

296

375

0.95

PF01965

DJ-1_PfpI

DJ-1/PfpI family

88

236

0.87

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oio-assembly1.cif.gz_A crystal structure of transcriptional regulator (arac-type dna-binding domain-containing proteins) from chromobacterium violaceum 0.9269 207 308
6swi-assembly1.cif.gz_A the c-terminal domain of arat, a response regulator from geobacillus stearothermophilus 0.9218 205 307
3gra-assembly1.cif.gz_A crystal structure of arac family transcriptional regulator from pseudomonas putida 0.9214 1 182
3w6v-assembly1.cif.gz_A crystal structure of the dna-binding domain of adpa, the global transcriptional factor, in complex with a target dna 0.9208 205 309
3lsg-assembly1.cif.gz_A the crystal structure of the c-terminal domain of the two-component response regulator yesn from fusobacterium nucleatum subsp. nucleatum atcc 25586 0.9048 205 305
ID Description Score Start End Superfamily
af_P0A9E0_176_235_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9614 205 260 1.10.10.60
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.96 208 309 1.10.10.60
af_P31449_179_288_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9344 207 310 1.10.10.60
3oioA00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.9255 207 308 1.10.10.60
af_P77379_178_282_1.10.10.60 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Homeodomain-like 0.925 208 309 1.10.10.60
ID Description Score Start End GO Terms
AF-A4X6Y1-F1-model_v4 Transcriptional regulator, AraC family 0.9743 206 306 GO:0003700
GO:0043565
AF-A0A4R5YYA1-F1-model_v4 deleted 0.9589 212 309
AF-A0A4Q1US27-F1-model_v4 HTH araC/xylS-type domain-containing protein 0.9586 207 308 GO:0003700
GO:0043565
AF-A0A0N1GD68-F1-model_v4 Transcriptional regulator, AraC family 0.9579 208 309 GO:0003700
GO:0043565
AF-A7HFP9-F1-model_v4 Helix-turn-helix-domain containing protein AraC type 0.9569 207 305 GO:0003700
GO:0043565

Feature Viewer

pLDDT pTM Quality
88.62 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map