F428621

General Info

Members Datasets Scaffolds Average Seq Length
380 187 760 384

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100054472|Ga0075434_1000544723
Length 444
Sequence VNKQLAKRETETAVKAAVAVEASGIPTRAVLRFFAYLVSPLVEFLRKPRSVANRTVAIPKVIAITLAYLIIATAILVAIFVIVPGLGNQFPEFAAQAKVYWQTLGDKMQQFIEYSRLRRMPPPLVQGVNEAIPKVRDTVLAAVTEFFSALLGYVIYLPWLVLIPILGFFLLKDAESFRRSALRMLPRGRWRWRGDEFFDDINNTLAAYIRAQLTACLFIGVVCAIGFTLLGLPGGLVMGFIAGMFEFVPLVGPLTIAAMAAVLAIFHAGPFNAFLVLLFLGVLRIVQDYVIYPRLIGQGIHLHPLAVIFAILAGEKLAGVAGIFLAIPVVAILTVSYRHWMEHRGSEGIADLLEPAPAHVEPVKADELRADSTAEDMARARPDLTTGELQLPEELRQELADSPSAPQIAENDAQHRVDQEQPQDGTEPRSQEETGDAFLQHTDR

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000531 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - CNB_Illumina_Assembled Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
7 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
28 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
32 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
33 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
40 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
41 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
42 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
43 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
44 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
45 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
46 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
47 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
48 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
49 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
50 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
51 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
54 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
55 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
56 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
57 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
58 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
59 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
60 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
61 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
62 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
63 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
64 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
65 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
66 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
67 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
68 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
69 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
70 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
87 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
88 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
89 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
90 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
91 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
92 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
93 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
94 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
136 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
140 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
141 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
142 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
143 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
144 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
145 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
146 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
147 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
148 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
149 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
150 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
151 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
152 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
153 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
154 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
155 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
156 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
157 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
158 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
159 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
160 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
161 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
162 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
163 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
164 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
165 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
166 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
167 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
168 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
169 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
170 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
171 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
172 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
173 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
174 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
175 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
176 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
177 3300049683 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_B_3_control Metagenome Rhizosphere
178 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
179 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
180 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
181 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
182 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
183 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
184 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
185 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
186 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
187 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.05
Rhizosphere 98.68
Stem 0
Stem Tuber 0
Unclassified 13.16

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100054472 3300006871 Bacteria 3973
2 SwRhRL2b_contig_282746 2162886007 Bacteria 3687
3 MBSR1b_contig_1518963 2162886012 Bacteria 1512
4 CNBas_1001206 3300000531 Bacteria 1330
5 JGI24751J29686_10000003 3300002459 Bacteria 157815
6 rootL2_10255793 3300003322 Bacteria 2590
7 Ga0065714_10064425 3300005288 Bacteria 189652
8 Ga0065704_10001506 3300005289 Bacteria 12849
9 Ga0065704_10100641 3300005289 Bacteria 2260
10 Ga0065704_10132126 3300005289 Bacteria 1616
11 Ga0065712_10009422 3300005290 Bacteria 3855
12 Ga0065712_10067727 3300005290 Bacteria 189643
13 Ga0065712_10119461 3300005290 Unclassified 1691
14 Ga0065715_10004306 3300005293 Bacteria 3596
15 Ga0065715_10025398 3300005293 Unclassified 1662
16 Ga0065715_10108920 3300005293 Bacteria 2694
17 Ga0065707_10000669 3300005295 Bacteria 21770
18 Ga0065707_10003232 3300005295 Bacteria 10132
19 Ga0070690_100007791 3300005330 Bacteria 6138
20 Ga0070690_100018563 3300005330 Bacteria 4204
21 Ga0070670_100000167 3300005331 Bacteria 59452
22 Ga0070670_100024656 3300005331 Bacteria 5172
23 Ga0068869_100002521 3300005334 Bacteria 11052
24 Ga0068869_100064978 3300005334 Bacteria 2685
25 Ga0068869_100067666 3300005334 Bacteria 2636
26 Ga0070680_100015837 3300005336 Bacteria 5919
27 Ga0070680_100026722 3300005336 Bacteria 4616
28 Ga0070680_100132492 3300005336 Bacteria 2086
29 Ga0070682_100000134 3300005337 Bacteria 61223
30 Ga0070682_100034463 3300005337 Bacteria 3084
31 Ga0070682_100085534 3300005337 Bacteria 2052
32 Ga0068868_100046088 3300005338 Bacteria 3413
33 Ga0070689_100001942 3300005340 Bacteria 13387
34 Ga0070689_100013651 3300005340 Bacteria 5884
35 Ga0070689_100019586 3300005340 Bacteria 5006
36 Ga0070687_100004208 3300005343 Bacteria 5707
37 Ga0070692_10027497 3300005345 Bacteria 2820
38 Ga0070692_10035646 3300005345 Bacteria 2520
39 Ga0070668_100011390 3300005347 Bacteria 6626
40 Ga0070669_100015581 3300005353 Bacteria 5421
41 Ga0070669_100015807 3300005353 Bacteria 5382
42 Ga0070669_100130424 3300005353 Bacteria 1928
43 Ga0070669_100157741 3300005353 Bacteria 1761
44 Ga0070671_100003278 3300005355 Bacteria 12629
45 Ga0070671_100032042 3300005355 Bacteria 4346
46 Ga0070671_100048442 3300005355 Bacteria 3533
47 Ga0070673_100006372 3300005364 Bacteria 7668
48 Ga0070673_100006512 3300005364 Bacteria 7597
49 Ga0070673_100019519 3300005364 Bacteria 4866
50 Ga0070659_100006582 3300005366 Bacteria 8391
51 Ga0070701_10024513 3300005438 Bacteria 2919
52 Ga0070705_100008290 3300005440 Bacteria 5145
53 Ga0070705_100034665 3300005440 Bacteria 2823
54 Ga0070705_100038846 3300005440 Unclassified 2697
55 Ga0070705_100087123 3300005440 Bacteria 1935
56 Ga0070700_100000228 3300005441 Bacteria 30994
57 Ga0070700_100004624 3300005441 Bacteria 7208
58 Ga0070700_100005396 3300005441 Bacteria 6768
59 Ga0070700_100027073 3300005441 Bacteria 3396
60 Ga0070700_100184473 3300005441 Unclassified 1455
61 Ga0070694_100043799 3300005444 Bacteria 2994
62 Ga0070694_100066999 3300005444 Unclassified 2464
63 Ga0070694_100081616 3300005444 Bacteria 2250
64 Ga0070694_100145501 3300005444 Bacteria 1726
65 Ga0070708_100001141 3300005445 Bacteria 20377
66 Ga0070678_100214580 3300005456 Unclassified 1597
67 Ga0070681_10000402 3300005458 Bacteria 35169
68 Ga0070681_10005009 3300005458 Bacteria 12761
69 Ga0070681_10011833 3300005458 Bacteria 8650
70 Ga0068867_100012450 3300005459 Bacteria 6019
71 Ga0068867_100049014 3300005459 Bacteria 3109
72 Ga0068867_100063385 3300005459 Bacteria 2747
73 Ga0070706_100000053 3300005467 Bacteria 139565
74 Ga0070706_100015270 3300005467 Bacteria 7089
75 Ga0070706_100017796 3300005467 Bacteria 6556
76 Ga0070706_100265537 3300005467 Bacteria 1602
77 Ga0070707_100120657 3300005468 Unclassified 2545
78 Ga0070698_100000717 3300005471 Bacteria 35575
79 Ga0070698_100007119 3300005471 Bacteria 12114
80 Ga0070698_100007471 3300005471 Bacteria 11824
81 Ga0070698_100028272 3300005471 Bacteria 5826
82 Ga0070699_100006953 3300005518 Bacteria 9838
83 Ga0070699_100032313 3300005518 Bacteria 4518
84 Ga0070699_100052111 3300005518 Bacteria 3543
85 Ga0070699_100076082 3300005518 Bacteria 2922
86 Ga0070699_100109721 3300005518 Bacteria 2422
87 Ga0070679_100000811 3300005530 Bacteria 27104
88 Ga0070679_100003677 3300005530 Bacteria 14049
89 Ga0070697_100001620 3300005536 Bacteria 17145
90 Ga0070697_100003805 3300005536 Bacteria 11593
91 Ga0070697_100141189 3300005536 Bacteria 2026
92 Ga0070697_100146182 3300005536 Bacteria 1990
93 Ga0068853_100038029 3300005539 Bacteria 4098
94 Ga0070686_100006177 3300005544 Bacteria 6652
95 Ga0070686_100006673 3300005544 Bacteria 6426
96 Ga0070686_100023997 3300005544 Unclassified 3652
97 Ga0070695_100079939 3300005545 Bacteria 2159
98 Ga0070695_100112964 3300005545 Unclassified 1846
99 Ga0070695_100157263 3300005545 Unclassified 1592
100 Ga0070696_100013676 3300005546 Bacteria 5449
101 Ga0070696_100031460 3300005546 Bacteria 3637
102 Ga0070696_100034580 3300005546 Bacteria 3477
103 Ga0070696_100046462 3300005546 Bacteria 3011
104 Ga0070693_100026932 3300005547 Bacteria 3108
105 Ga0070693_100029890 3300005547 Bacteria 2975
106 Ga0070693_100062228 3300005547 Bacteria 2172
107 Ga0070693_100063848 3300005547 Bacteria 2148
108 Ga0070665_100333156 3300005548 Bacteria 1522
109 Ga0070704_100063530 3300005549 Unclassified 2650
110 Ga0068857_100003644 3300005577 Bacteria 12913
111 Ga0068857_100029260 3300005577 Bacteria 4861
112 Ga0068857_100159987 3300005577 Bacteria 2043
113 Ga0068857_100165554 3300005577 Bacteria 2008
114 Ga0068854_100103158 3300005578 Bacteria 2141
115 Ga0068854_100116814 3300005578 Bacteria 2020
116 Ga0068856_100023399 3300005614 Bacteria 6006
117 Ga0070702_100006490 3300005615 Bacteria 5541
118 Ga0068859_100000994 3300005617 Bacteria 29030
119 Ga0068859_100024698 3300005617 Bacteria 6031
120 Ga0068859_100056136 3300005617 Bacteria 3962
121 Ga0068859_100092293 3300005617 Bacteria 3079
122 Ga0068864_100002954 3300005618 Bacteria 14055
123 Ga0068864_100031674 3300005618 Bacteria 4488
124 Ga0068864_100064004 3300005618 Bacteria 3188
125 Ga0068864_100078016 3300005618 Unclassified 2898
126 Ga0068866_10022696 3300005718 Bacteria 2908
127 Ga0068861_100011384 3300005719 Bacteria 6181
128 Ga0068861_100019593 3300005719 Bacteria 4833
129 Ga0068861_100047223 3300005719 Bacteria 3249
130 Ga0068851_10011575 3300005834 Bacteria 4140
131 Ga0068870_10090399 3300005840 Unclassified 1710
132 Ga0068863_100011621 3300005841 Bacteria 8519
133 Ga0068863_100228369 3300005841 Bacteria 1795
134 Ga0068858_100037952 3300005842 Bacteria 4468
135 Ga0068860_100018750 3300005843 Bacteria 6723
136 Ga0068860_100070142 3300005843 Unclassified 3332
137 Ga0068862_100130338 3300005844 Unclassified 2224
138 Ga0068862_100179526 3300005844 Bacteria 1899
139 Ga0081539_10001126 3300005985 Bacteria 48444
140 Ga0081539_10002144 3300005985 Bacteria 29163
141 Ga0070715_10000020 3300006163 Bacteria 119605
142 Ga0070716_100000003 3300006173 Bacteria 312721
143 Ga0097621_100006699 3300006237 Bacteria 8188
144 Ga0097621_100184607 3300006237 Bacteria 1803
145 Ga0068871_100003178 3300006358 Bacteria 11281
146 Ga0075431_100013578 3300006847 Bacteria 8230
147 Ga0075433_10006400 3300006852 Bacteria 9310
148 Ga0075433_10014794 3300006852 Bacteria 6386
149 Ga0075433_10018162 3300006852 Bacteria 5841
150 Ga0075433_10051162 3300006852 Bacteria 3597
151 Ga0075433_10162695 3300006852 Bacteria 1986
152 Ga0075434_100094375 3300006871 Bacteria 2996
153 Ga0075429_100009773 3300006880 Bacteria 8316
154 Ga0068865_100059144 3300006881 Unclassified 2680
155 Ga0097620_100000994 3300006931 Bacteria 29030
156 Ga0097620_100024697 3300006931 Bacteria 6031
157 Ga0097620_100056138 3300006931 Bacteria 3962
158 Ga0097620_100092292 3300006931 Bacteria 3079
159 Ga0075435_100139153 3300007076 Bacteria 2036
160 Ga0105240_10262749 3300009093 Unclassified 1990
161 Ga0105240_10340380 3300009093 Unclassified 1704
162 Ga0111539_10001706 3300009094 Bacteria 29249
163 Ga0111539_10093497 3300009094 Bacteria 3532
164 Ga0111539_10176080 3300009094 Unclassified 2499
165 Ga0105245_10052983 3300009098 Bacteria 3641
166 Ga0105245_10109742 3300009098 Bacteria 2564
167 Ga0105247_10085059 3300009101 Unclassified 1999
168 Ga0114129_10034595 3300009147 Bacteria 7137
169 Ga0114129_10037208 3300009147 Bacteria 6872
170 Ga0114129_10039288 3300009147 Bacteria 6672
171 Ga0114129_10067321 3300009147 Unclassified 4995
172 Ga0114129_10170985 3300009147 Bacteria 2963
173 Ga0114129_10321513 3300009147 Bacteria 2057
174 Ga0105243_10003528 3300009148 Bacteria 12640
175 Ga0105243_10041643 3300009148 Bacteria 3592
176 Ga0105243_10137287 3300009148 Bacteria 2082
177 Ga0105243_10228516 3300009148 Bacteria 1649
178 Ga0105241_10070088 3300009174 Unclassified 2720
179 Ga0105241_10187550 3300009174 Bacteria 1719
180 Ga0105242_10007353 3300009176 Bacteria 8479
181 Ga0105248_10012443 3300009177 Bacteria 9387
182 Ga0105248_10038542 3300009177 Bacteria 5349
183 Ga0105248_10064145 3300009177 Bacteria 4124
184 Ga0105248_10103391 3300009177 Unclassified 3211
185 Ga0105248_10124525 3300009177 Bacteria 2907
186 Ga0105248_10148806 3300009177 Unclassified 2642
187 Ga0105237_10001338 3300009545 Bacteria 32668
188 Ga0105237_10119409 3300009545 Unclassified 2630
189 Ga0105238_10006965 3300009551 Bacteria 11296
190 Ga0105238_10008039 3300009551 Bacteria 10552
191 Ga0105249_10000044 3300009553 Bacteria 184637
192 Ga0105249_10035387 3300009553 Bacteria 4530
193 Ga0105249_10054949 3300009553 Bacteria 3641
194 Ga0105249_10149075 3300009553 Bacteria 2250
195 Ga0105249_10278428 3300009553 Bacteria 1669
196 Ga0105239_10048618 3300010375 Bacteria 4651
197 Ga0105239_10187236 3300010375 Bacteria 2317
198 Ga0105246_10021933 3300011119 Bacteria 4117
199 Ga0157373_10043123 3300013100 Bacteria 3223
200 Ga0157374_10023364 3300013296 Bacteria 5530
201 Ga0157378_10001621 3300013297 Bacteria 20349
202 Ga0157378_10006156 3300013297 Bacteria 10505
203 Ga0157378_10031083 3300013297 Bacteria 4715
204 Ga0157378_10039570 3300013297 Bacteria 4182
205 Ga0157378_10062312 3300013297 Bacteria 3330
206 Ga0157378_10126748 3300013297 Unclassified 2359
207 Ga0163162_10000025 3300013306 Bacteria 184648
208 Ga0163162_10001376 3300013306 Bacteria 22623
209 Ga0163162_10006906 3300013306 Bacteria 11008
210 Ga0163162_10026311 3300013306 Bacteria 5750
211 Ga0163162_10051720 3300013306 Bacteria 4123
212 Ga0163162_10084433 3300013306 Bacteria 3251
213 Ga0163162_10146577 3300013306 Unclassified 2477
214 Ga0163162_10164684 3300013306 Bacteria 2341
215 Ga0157372_10149888 3300013307 Bacteria 2691
216 Ga0157375_10012720 3300013308 Bacteria 7469
217 Ga0157375_10026135 3300013308 Bacteria 5436
218 Ga0157375_10064796 3300013308 Bacteria 3639
219 Ga0157375_10072942 3300013308 Bacteria 3450
220 Ga0157375_10086128 3300013308 Bacteria 3192
221 Ga0157375_10159293 3300013308 Bacteria 2398
222 Ga0163163_10000298 3300014325 Bacteria 49128
223 Ga0163163_10002579 3300014325 Bacteria 15355
224 Ga0163163_10003476 3300014325 Bacteria 13381
225 Ga0163163_10019946 3300014325 Bacteria 6306
226 Ga0163163_10041517 3300014325 Bacteria 4499
227 Ga0163163_10062793 3300014325 Bacteria 3682
228 Ga0163163_10249768 3300014325 Unclassified 1824
229 Ga0157380_10005248 3300014326 Bacteria 9052
230 Ga0157380_10011324 3300014326 Bacteria 6442
231 Ga0157380_10011590 3300014326 Bacteria 6373
232 Ga0157380_10016106 3300014326 Bacteria 5506
233 Ga0157380_10141628 3300014326 Bacteria 2067
234 Ga0157380_10156137 3300014326 Bacteria 1978
235 Ga0157377_10059226 3300014745 Bacteria 2182
236 Ga0157376_10023361 3300014969 Bacteria 4838
237 Ga0163161_10106174 3300017792 Unclassified 2095
238 Ga0163161_10227403 3300017792 Unclassified 1447
239 Ga0207653_10002430 3300025885 Bacteria 5921
240 Ga0207647_10002119 3300025904 Bacteria 15172
241 Ga0207685_10000008 3300025905 Bacteria 273136
242 Ga0207643_10032919 3300025908 Bacteria 2899
243 Ga0207643_10116517 3300025908 Bacteria 1578
244 Ga0207684_10062738 3300025910 Bacteria 3155
245 Ga0207684_10075559 3300025910 Unclassified 2863
246 Ga0207654_10107103 3300025911 Bacteria 1732
247 Ga0207654_10118911 3300025911 Bacteria 1656
248 Ga0207707_10000033 3300025912 Bacteria 158362
249 Ga0207707_10011173 3300025912 Bacteria 7811
250 Ga0207707_10092961 3300025912 Bacteria 2635
251 Ga0207695_10115010 3300025913 Unclassified 2665
252 Ga0207671_10007615 3300025914 Bacteria 9367
253 Ga0207671_10132800 3300025914 Unclassified 1912
254 Ga0207660_10003477 3300025917 Bacteria 10270
255 Ga0207660_10108363 3300025917 Bacteria 2086
256 Ga0207662_10002574 3300025918 Bacteria 9138
257 Ga0207662_10004431 3300025918 Bacteria 7385
258 Ga0207652_10000032 3300025921 Bacteria 143319
259 Ga0207652_10018347 3300025921 Bacteria 5737
260 Ga0207646_10228473 3300025922 Bacteria 1681
261 Ga0207681_10000486 3300025923 Bacteria 27828
262 Ga0207681_10057237 3300025923 Bacteria 2663
263 Ga0207694_10005155 3300025924 Bacteria 10087
264 Ga0207650_10000007 3300025925 Bacteria 530810
265 Ga0207650_10006915 3300025925 Bacteria 7733
266 Ga0207650_10028733 3300025925 Bacteria 3990
267 Ga0207644_10004590 3300025931 Bacteria 8984
268 Ga0207706_10028428 3300025933 Bacteria 4994
269 Ga0207709_10002610 3300025935 Bacteria 11221
270 Ga0207670_10000302 3300025936 Bacteria 29606
271 Ga0207665_10000003 3300025939 Bacteria 220666
272 Ga0207665_10028197 3300025939 Bacteria 3708
273 Ga0207691_10094712 3300025940 Unclassified 2671
274 Ga0207691_10166151 3300025940 Bacteria 1934
275 Ga0207711_10006732 3300025941 Bacteria 9670
276 Ga0207711_10022085 3300025941 Bacteria 5319
277 Ga0207711_10072704 3300025941 Bacteria 2987
278 Ga0207711_10221285 3300025941 Bacteria 1731
279 Ga0207689_10025351 3300025942 Bacteria 4969
280 Ga0207679_10003817 3300025945 Bacteria 9337
281 Ga0207651_10014721 3300025960 Bacteria 4526
282 Ga0207651_10172266 3300025960 Bacteria 1708
283 Ga0207712_10000039 3300025961 Bacteria 182548
284 Ga0207712_10023985 3300025961 Bacteria 4033
285 Ga0207640_10029823 3300025981 Bacteria 3353
286 Ga0207640_10091568 3300025981 Bacteria 2107
287 Ga0207640_10096688 3300025981 Bacteria 2059
288 Ga0207677_10045976 3300026023 Unclassified 2919
289 Ga0207677_10205841 3300026023 Bacteria 1567
290 Ga0207703_10115891 3300026035 Bacteria 2293
291 Ga0207639_10034057 3300026041 Bacteria 3762
292 Ga0207708_10000096 3300026075 Bacteria 67574
293 Ga0207708_10008497 3300026075 Bacteria 7602
294 Ga0207708_10015554 3300026075 Bacteria 5706
295 Ga0207708_10033251 3300026075 Bacteria 3917
296 Ga0207708_10118849 3300026075 Unclassified 2058
297 Ga0207708_10133007 3300026075 Bacteria 1946
298 Ga0207641_10012075 3300026088 Bacteria 7082
299 Ga0207641_10121769 3300026088 Bacteria 2329
300 Ga0207648_10002803 3300026089 Bacteria 18489
301 Ga0207648_10048741 3300026089 Bacteria 3708
302 Ga0207648_10064783 3300026089 Bacteria 3185
303 Ga0207648_10065032 3300026089 Bacteria 3179
304 Ga0207676_10000399 3300026095 Bacteria 36665
305 Ga0207676_10019664 3300026095 Bacteria 4930
306 Ga0207676_10257718 3300026095 Bacteria 1573
307 Ga0207674_10000058 3300026116 Bacteria 113012
308 Ga0207674_10011925 3300026116 Bacteria 9744
309 Ga0207674_10036448 3300026116 Bacteria 5125
310 Ga0207675_100013280 3300026118 Bacteria 7689
311 Ga0207675_100020571 3300026118 Bacteria 6151
312 Ga0207675_100023289 3300026118 Bacteria 5759
313 Ga0207675_100114543 3300026118 Unclassified 2547
314 Ga0207675_100128343 3300026118 Bacteria 2403
315 Ga0207675_100385611 3300026118 Unclassified 1379
316 Ga0207683_10022588 3300026121 Bacteria 5401
317 Ga0207428_10004223 3300027907 Bacteria 13752
318 Ga0207428_10111263 3300027907 Bacteria 2107
319 Ga0268266_10079113 3300028379 Bacteria 2862
320 Ga0268265_10137155 3300028380 Unclassified 2043
321 Ga0268264_10109451 3300028381 Bacteria 2417
322 Ga0307408_100008694 3300031548 Bacteria 6706
323 Ga0307408_100211091 3300031548 Unclassified 1578
324 Ga0307405_10029680 3300031731 Bacteria 3199
325 Ga0307405_10049647 3300031731 Bacteria 2594
326 Ga0307410_10006740 3300031852 Bacteria 6228
327 Ga0307406_10007449 3300031901 Bacteria 6067
328 Ga0307416_100001340 3300032002 Bacteria 13264
329 Ga0307414_10002430 3300032004 Bacteria 9741
330 Ga0307414_10045552 3300032004 Bacteria 3005
331 Ga0307411_10014760 3300032005 Bacteria 4360
332 Ga0307415_100001629 3300032126 Bacteria 10854
333 Ga0373953_0076406 3300035117 Bacteria 1388
334 Ga0373937_0107579 3300036401 Bacteria 2593
335 Ga0395900_0174365 3300037418 Bacteria 2188
336 Ga0395900_0262869 3300037418 Bacteria 1723
337 Ga0439455_0013182 3300042012 Unclassified 1868
338 Ga0439462_0022259 3300042015 Bacteria 1658
339 Ga0439458_0001799 3300042157 Bacteria 5333
340 Ga0439460_0010612 3300042461 Unclassified 2363
341 Ga0495663_0000184 3300046525 Bacteria 24910
342 Ga0495598_0000407 3300046537 Bacteria 7731
343 Ga0495621_0006340 3300046539 Unclassified 3446
344 Ga0495636_0073617 3300047318 Unclassified 1462
345 Ga0495672_0013614 3300047320 Bacteria 5603
346 Ga0496102_0091031 3300048905 Bacteria 2823
347 Ga0496110_0081551 3300048913 Bacteria 2884
348 Ga0496112_0371981 3300048915 Bacteria 1371
349 Ga0496113_0199507 3300048916 Unclassified 1590
350 Ga0501292_001221 3300049515 Unclassified 3159
351 Ga0501298_010482 3300049521 Bacteria 1596
352 Ga0501299_006278 3300049522 Bacteria 1860
353 Ga0501038_0050517 3300049574 Bacteria 3592
354 Ga0501198_000173 3300049649 Bacteria 8414
355 Ga0501202_009331 3300049652 Bacteria 1802
356 Ga0501206_002275 3300049653 Unclassified 2419
357 Ga0501209_004861 3300049656 Bacteria 2373
358 Ga0501216_003673 3300049660 Bacteria 2253
359 Ga0501217_001464 3300049661 Bacteria 4433
360 Ga0501235_004825 3300049669 Bacteria 2921
361 Ga0501240_001167 3300049673 Unclassified 2475
362 Ga0501243_002300 3300049675 Bacteria 2791
363 Ga0501249_012940 3300049679 Bacteria 1769
364 Ga0501253_008492 3300049683 Bacteria 1480
365 Ga0501257_007845 3300049686 Bacteria 2391
366 Ga0501225_0001798 3300049705 Bacteria 6711
367 Ga0501225_0003247 3300049705 Bacteria 4961
368 Ga0501234_000318 3300049707 Bacteria 7047
369 Ga0501079_0073673 3300049741 Bacteria 2640
370 Ga0501283_000525 3300049779 Bacteria 5028
371 Ga0501283_000849 3300049779 Bacteria 4026
372 Ga0501226_001634 3300049853 Unclassified 2840
373 nmdc:mga05p37_21098_c2 3300050507 Bacteria 4617
374 nmdc:mga05p37_225825_c1 3300050507 Unclassified 2258
375 nmdc:mga09592_90381_c1 3300050508 Bacteria 2616
376 nmdc:mga0n895_151280_c1 3300050512 Bacteria 2351
377 nmdc:mga0n895_55805_c1 3300050512 Bacteria 3889
378 nmdc:mga0a205_28138_c1 3300050515 Bacteria 5372
379 nmdc:mga0a205_31274_c1 3300050515 Bacteria 5099
380 nmdc:mga0a205_75361_c1 3300050515 Bacteria 3260
381 Ga0075434_100054472
382 SwRhRL2b_contig_282746
383 MBSR1b_contig_1518963
384 CNBas_1001206
385 JGI24751J29686_10000003
386 rootL2_10255793
387 Ga0065714_10064425
388 Ga0065704_10001506
389 Ga0065704_10100641
390 Ga0065704_10132126
391 Ga0065712_10009422
392 Ga0065712_10067727
393 Ga0065712_10119461
394 Ga0065715_10004306
395 Ga0065715_10025398
396 Ga0065715_10108920
397 Ga0065707_10000669
398 Ga0065707_10003232
399 Ga0070690_100007791
400 Ga0070690_100018563
401 Ga0070670_100000167
402 Ga0070670_100024656
403 Ga0068869_100002521
404 Ga0068869_100064978
405 Ga0068869_100067666
406 Ga0070680_100015837
407 Ga0070680_100026722
408 Ga0070680_100132492
409 Ga0070682_100000134
410 Ga0070682_100034463
411 Ga0070682_100085534
412 Ga0068868_100046088
413 Ga0070689_100001942
414 Ga0070689_100013651
415 Ga0070689_100019586
416 Ga0070687_100004208
417 Ga0070692_10027497
418 Ga0070692_10035646
419 Ga0070668_100011390
420 Ga0070669_100015581
421 Ga0070669_100015807
422 Ga0070669_100130424
423 Ga0070669_100157741
424 Ga0070671_100003278
425 Ga0070671_100032042
426 Ga0070671_100048442
427 Ga0070673_100006372
428 Ga0070673_100006512
429 Ga0070673_100019519
430 Ga0070659_100006582
431 Ga0070701_10024513
432 Ga0070705_100008290
433 Ga0070705_100034665
434 Ga0070705_100038846
435 Ga0070705_100087123
436 Ga0070700_100000228
437 Ga0070700_100004624
438 Ga0070700_100005396
439 Ga0070700_100027073
440 Ga0070700_100184473
441 Ga0070694_100043799
442 Ga0070694_100066999
443 Ga0070694_100081616
444 Ga0070694_100145501
445 Ga0070708_100001141
446 Ga0070678_100214580
447 Ga0070681_10000402
448 Ga0070681_10005009
449 Ga0070681_10011833
450 Ga0068867_100012450
451 Ga0068867_100049014
452 Ga0068867_100063385
453 Ga0070706_100000053
454 Ga0070706_100015270
455 Ga0070706_100017796
456 Ga0070706_100265537
457 Ga0070707_100120657
458 Ga0070698_100000717
459 Ga0070698_100007119
460 Ga0070698_100007471
461 Ga0070698_100028272
462 Ga0070699_100006953
463 Ga0070699_100032313
464 Ga0070699_100052111
465 Ga0070699_100076082
466 Ga0070699_100109721
467 Ga0070679_100000811
468 Ga0070679_100003677
469 Ga0070697_100001620
470 Ga0070697_100003805
471 Ga0070697_100141189
472 Ga0070697_100146182
473 Ga0068853_100038029
474 Ga0070686_100006177
475 Ga0070686_100006673
476 Ga0070686_100023997
477 Ga0070695_100079939
478 Ga0070695_100112964
479 Ga0070695_100157263
480 Ga0070696_100013676
481 Ga0070696_100031460
482 Ga0070696_100034580
483 Ga0070696_100046462
484 Ga0070693_100026932
485 Ga0070693_100029890
486 Ga0070693_100062228
487 Ga0070693_100063848
488 Ga0070665_100333156
489 Ga0070704_100063530
490 Ga0068857_100003644
491 Ga0068857_100029260
492 Ga0068857_100159987
493 Ga0068857_100165554
494 Ga0068854_100103158
495 Ga0068854_100116814
496 Ga0068856_100023399
497 Ga0070702_100006490
498 Ga0068859_100000994
499 Ga0068859_100024698
500 Ga0068859_100056136
501 Ga0068859_100092293
502 Ga0068864_100002954
503 Ga0068864_100031674
504 Ga0068864_100064004
505 Ga0068864_100078016
506 Ga0068866_10022696
507 Ga0068861_100011384
508 Ga0068861_100019593
509 Ga0068861_100047223
510 Ga0068851_10011575
511 Ga0068870_10090399
512 Ga0068863_100011621
513 Ga0068863_100228369
514 Ga0068858_100037952
515 Ga0068860_100018750
516 Ga0068860_100070142
517 Ga0068862_100130338
518 Ga0068862_100179526
519 Ga0081539_10001126
520 Ga0081539_10002144
521 Ga0070715_10000020
522 Ga0070716_100000003
523 Ga0097621_100006699
524 Ga0097621_100184607
525 Ga0068871_100003178
526 Ga0075431_100013578
527 Ga0075433_10006400
528 Ga0075433_10014794
529 Ga0075433_10018162
530 Ga0075433_10051162
531 Ga0075433_10162695
532 Ga0075434_100094375
533 Ga0075429_100009773
534 Ga0068865_100059144
535 Ga0097620_100000994
536 Ga0097620_100024697
537 Ga0097620_100056138
538 Ga0097620_100092292
539 Ga0075435_100139153
540 Ga0105240_10262749
541 Ga0105240_10340380
542 Ga0111539_10001706
543 Ga0111539_10093497
544 Ga0111539_10176080
545 Ga0105245_10052983
546 Ga0105245_10109742
547 Ga0105247_10085059
548 Ga0114129_10034595
549 Ga0114129_10037208
550 Ga0114129_10039288
551 Ga0114129_10067321
552 Ga0114129_10170985
553 Ga0114129_10321513
554 Ga0105243_10003528
555 Ga0105243_10041643
556 Ga0105243_10137287
557 Ga0105243_10228516
558 Ga0105241_10070088
559 Ga0105241_10187550
560 Ga0105242_10007353
561 Ga0105248_10012443
562 Ga0105248_10038542
563 Ga0105248_10064145
564 Ga0105248_10103391
565 Ga0105248_10124525
566 Ga0105248_10148806
567 Ga0105237_10001338
568 Ga0105237_10119409
569 Ga0105238_10006965
570 Ga0105238_10008039
571 Ga0105249_10000044
572 Ga0105249_10035387
573 Ga0105249_10054949
574 Ga0105249_10149075
575 Ga0105249_10278428
576 Ga0105239_10048618
577 Ga0105239_10187236
578 Ga0105246_10021933
579 Ga0157373_10043123
580 Ga0157374_10023364
581 Ga0157378_10001621
582 Ga0157378_10006156
583 Ga0157378_10031083
584 Ga0157378_10039570
585 Ga0157378_10062312
586 Ga0157378_10126748
587 Ga0163162_10000025
588 Ga0163162_10001376
589 Ga0163162_10006906
590 Ga0163162_10026311
591 Ga0163162_10051720
592 Ga0163162_10084433
593 Ga0163162_10146577
594 Ga0163162_10164684
595 Ga0157372_10149888
596 Ga0157375_10012720
597 Ga0157375_10026135
598 Ga0157375_10064796
599 Ga0157375_10072942
600 Ga0157375_10086128
601 Ga0157375_10159293
602 Ga0163163_10000298
603 Ga0163163_10002579
604 Ga0163163_10003476
605 Ga0163163_10019946
606 Ga0163163_10041517
607 Ga0163163_10062793
608 Ga0163163_10249768
609 Ga0157380_10005248
610 Ga0157380_10011324
611 Ga0157380_10011590
612 Ga0157380_10016106
613 Ga0157380_10141628
614 Ga0157380_10156137
615 Ga0157377_10059226
616 Ga0157376_10023361
617 Ga0163161_10106174
618 Ga0163161_10227403
619 Ga0207653_10002430
620 Ga0207647_10002119
621 Ga0207685_10000008
622 Ga0207643_10032919
623 Ga0207643_10116517
624 Ga0207684_10062738
625 Ga0207684_10075559
626 Ga0207654_10107103
627 Ga0207654_10118911
628 Ga0207707_10000033
629 Ga0207707_10011173
630 Ga0207707_10092961
631 Ga0207695_10115010
632 Ga0207671_10007615
633 Ga0207671_10132800
634 Ga0207660_10003477
635 Ga0207660_10108363
636 Ga0207662_10002574
637 Ga0207662_10004431
638 Ga0207652_10000032
639 Ga0207652_10018347
640 Ga0207646_10228473
641 Ga0207681_10000486
642 Ga0207681_10057237
643 Ga0207694_10005155
644 Ga0207650_10000007
645 Ga0207650_10006915
646 Ga0207650_10028733
647 Ga0207644_10004590
648 Ga0207706_10028428
649 Ga0207709_10002610
650 Ga0207670_10000302
651 Ga0207665_10000003
652 Ga0207665_10028197
653 Ga0207691_10094712
654 Ga0207691_10166151
655 Ga0207711_10006732
656 Ga0207711_10022085
657 Ga0207711_10072704
658 Ga0207711_10221285
659 Ga0207689_10025351
660 Ga0207679_10003817
661 Ga0207651_10014721
662 Ga0207651_10172266
663 Ga0207712_10000039
664 Ga0207712_10023985
665 Ga0207640_10029823
666 Ga0207640_10091568
667 Ga0207640_10096688
668 Ga0207677_10045976
669 Ga0207677_10205841
670 Ga0207703_10115891
671 Ga0207639_10034057
672 Ga0207708_10000096
673 Ga0207708_10008497
674 Ga0207708_10015554
675 Ga0207708_10033251
676 Ga0207708_10118849
677 Ga0207708_10133007
678 Ga0207641_10012075
679 Ga0207641_10121769
680 Ga0207648_10002803
681 Ga0207648_10048741
682 Ga0207648_10064783
683 Ga0207648_10065032
684 Ga0207676_10000399
685 Ga0207676_10019664
686 Ga0207676_10257718
687 Ga0207674_10000058
688 Ga0207674_10011925
689 Ga0207674_10036448
690 Ga0207675_100013280
691 Ga0207675_100020571
692 Ga0207675_100023289
693 Ga0207675_100114543
694 Ga0207675_100128343
695 Ga0207675_100385611
696 Ga0207683_10022588
697 Ga0207428_10004223
698 Ga0207428_10111263
699 Ga0268266_10079113
700 Ga0268265_10137155
701 Ga0268264_10109451
702 Ga0307408_100008694
703 Ga0307408_100211091
704 Ga0307405_10029680
705 Ga0307405_10049647
706 Ga0307410_10006740
707 Ga0307406_10007449
708 Ga0307416_100001340
709 Ga0307414_10002430
710 Ga0307414_10045552
711 Ga0307411_10014760
712 Ga0307415_100001629
713 Ga0373953_0076406
714 Ga0373937_0107579
715 Ga0395900_0174365
716 Ga0395900_0262869
717 Ga0439455_0013182
718 Ga0439462_0022259
719 Ga0439458_0001799
720 Ga0439460_0010612
721 Ga0495663_0000184
722 Ga0495598_0000407
723 Ga0495621_0006340
724 Ga0495636_0073617
725 Ga0495672_0013614
726 Ga0496102_0091031
727 Ga0496110_0081551
728 Ga0496112_0371981
729 Ga0496113_0199507
730 Ga0501292_001221
731 Ga0501298_010482
732 Ga0501299_006278
733 Ga0501038_0050517
734 Ga0501198_000173
735 Ga0501202_009331
736 Ga0501206_002275
737 Ga0501209_004861
738 Ga0501216_003673
739 Ga0501217_001464
740 Ga0501235_004825
741 Ga0501240_001167
742 Ga0501243_002300
743 Ga0501249_012940
744 Ga0501253_008492
745 Ga0501257_007845
746 Ga0501225_0001798
747 Ga0501225_0003247
748 Ga0501234_000318
749 Ga0501079_0073673
750 Ga0501283_000525
751 Ga0501283_000849
752 Ga0501226_001634
753 nmdc:mga05p37_21098_c2
754 nmdc:mga05p37_225825_c1
755 nmdc:mga09592_90381_c1
756 nmdc:mga0n895_151280_c1
757 nmdc:mga0n895_55805_c1
758 nmdc:mga0a205_28138_c1
759 nmdc:mga0a205_31274_c1
760 nmdc:mga0a205_75361_c1

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01594

AI-2E_transport

AI-2E family transporter

28

341

0.91

Map