F428620

General Info

Members Datasets Scaffolds Average Seq Length
380 207 760 225

Family's Representative Sequence

Representative Sequence 3300006852|Ga0075433_10186127|Ga0075433_101861272
Length 268
Sequence MWGQRGCPFNVSQALVVPKGNLARCQATAAFCHRALAPEQISGRYLLVQPSQLIARDIYKSFRMGARRIEVLRGISMDIAHNETIFLSGASGAGKTTLLYTLAGLEHPESGTVKFEGRELYSGSSSAEARLRNEKMGFVFQGYFLLPELTALENVLLPAMIGRRTTKGEAEESLAAVGLADRMDHLPAELSGGEQQRVAIARALTNNPEIIFADEPTGNLDSKTGDAIMDLLLNLARDRSKTLLVVTHDARLATRGDRQLHIVDGVLQ

Samples

Sample ID Description Type Environment
1 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
2 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
3 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
7 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
12 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
28 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
29 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
30 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
31 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
35 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
36 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
37 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
38 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
39 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
40 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
41 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
42 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
43 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
44 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
45 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
46 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
47 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
48 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
52 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
53 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
54 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
55 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
56 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
57 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
58 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
59 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
60 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
61 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
62 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
63 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
64 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
65 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
66 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
67 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
68 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
69 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
70 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
71 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
75 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
76 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
77 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
78 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
79 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
80 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
81 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
82 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
83 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
84 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
85 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
86 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
87 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
88 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
89 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
90 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
91 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
92 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
99 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
139 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
140 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
141 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
142 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
143 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
144 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
145 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
146 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
147 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
148 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
149 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
150 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
151 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
152 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
153 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
154 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
155 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
156 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
157 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
158 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
159 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
160 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
161 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
162 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
163 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
164 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
165 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
166 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
167 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
168 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
169 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
170 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
171 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
172 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
173 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
174 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
175 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
176 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
177 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
178 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
179 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
180 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
181 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
182 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
183 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
184 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
187 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
188 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
192 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
193 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
194 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
195 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
196 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
197 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
198 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
199 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
200 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
201 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
202 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
205 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
206 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
207 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.79
Nodule 0
Rhizoplane 7.37
Rhizosphere 89.74
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075433_10186127 3300006852 Bacteria 1847
2 JGI25406J46586_10000074 3300003203 Bacteria 45331
3 rootH1_10057451 3300003316 Bacteria 2431
4 rootL2_10144186 3300003322 Bacteria 11656
5 JGI25404J52841_10011109 3300003659 Unclassified 1939
6 Ga0055530_10029716 3300003791 Bacteria 1457
7 JGI25405J52794_10038920 3300003911 Bacteria 1002
8 Ga0065712_10004947 3300005290 Bacteria 4839
9 Ga0065712_10125649 3300005290 Bacteria 1611
10 Ga0065712_10232674 3300005290 Bacteria 1007
11 Ga0065715_10002403 3300005293 Bacteria 7364
12 Ga0065715_10003053 3300005293 Bacteria 5284
13 Ga0065715_10156450 3300005293 Bacteria 1672
14 Ga0065707_10103714 3300005295 Bacteria 2731
15 Ga0070676_10007858 3300005328 Bacteria 5734
16 Ga0070683_100024365 3300005329 Bacteria 5420
17 Ga0070683_100026618 3300005329 Bacteria 5210
18 Ga0070670_100005264 3300005331 Bacteria 10897
19 Ga0070670_100217834 3300005331 Bacteria 1660
20 Ga0070670_100231939 3300005331 Bacteria 1607
21 Ga0070670_100337331 3300005331 Bacteria 1323
22 Ga0070670_100660656 3300005331 Bacteria 938
23 Ga0070677_10048817 3300005333 Bacteria 1702
24 Ga0070666_10004462 3300005335 Bacteria 8523
25 Ga0070666_10078135 3300005335 Bacteria 2259
26 Ga0068868_100098869 3300005338 Bacteria 2360
27 Ga0070689_100014025 3300005340 Bacteria 5815
28 Ga0070687_100149405 3300005343 Bacteria 1370
29 Ga0070687_100236010 3300005343 Bacteria 1128
30 Ga0070661_100013106 3300005344 Bacteria 5817
31 Ga0070668_100006596 3300005347 Bacteria 8598
32 Ga0070668_101025359 3300005347 Bacteria 742
33 Ga0070669_100011735 3300005353 Bacteria 6214
34 Ga0070669_100139878 3300005353 Bacteria 1865
35 Ga0070669_100827375 3300005353 Bacteria 788
36 Ga0070675_100009331 3300005354 Bacteria 7631
37 Ga0070675_100052416 3300005354 Bacteria 3354
38 Ga0070671_100008597 3300005355 Bacteria 8183
39 Ga0070671_100084848 3300005355 Bacteria 2649
40 Ga0070671_100205268 3300005355 Bacteria 1671
41 Ga0070671_100705945 3300005355 Bacteria 875
42 Ga0070674_100000696 3300005356 Bacteria 17078
43 Ga0070673_100001067 3300005364 Bacteria 15654
44 Ga0070673_100021030 3300005364 Bacteria 4720
45 Ga0070673_100028962 3300005364 Bacteria 4125
46 Ga0070688_100009019 3300005365 Bacteria 5437
47 Ga0070688_100028270 3300005365 Bacteria 3346
48 Ga0070688_100115283 3300005365 Bacteria 1793
49 Ga0070667_100010616 3300005367 Bacteria 7604
50 Ga0070667_100167147 3300005367 Bacteria 1940
51 Ga0070709_10097857 3300005434 Bacteria 1949
52 Ga0070709_10380803 3300005434 Bacteria 1049
53 Ga0070714_100038827 3300005435 Bacteria 4005
54 Ga0070714_100305904 3300005435 Bacteria 1483
55 Ga0070714_100454885 3300005435 Bacteria 1216
56 Ga0070713_100029896 3300005436 Bacteria 4320
57 Ga0070710_10023713 3300005437 Bacteria 3229
58 Ga0070710_10069591 3300005437 Bacteria 2025
59 Ga0070711_100133538 3300005439 Bacteria 1852
60 Ga0070708_100159677 3300005445 Bacteria 2100
61 Ga0070678_100014991 3300005456 Bacteria 4909
62 Ga0070678_100035436 3300005456 Bacteria 3484
63 Ga0070678_100201599 3300005456 Bacteria 1642
64 Ga0070678_100513848 3300005456 Bacteria 1059
65 Ga0070662_100526104 3300005457 Bacteria 989
66 Ga0070681_10038940 3300005458 Bacteria 4766
67 Ga0068867_100035768 3300005459 Bacteria 3603
68 Ga0068867_100229864 3300005459 Bacteria 1499
69 Ga0070685_10043620 3300005466 Bacteria 2565
70 Ga0070706_100015362 3300005467 Bacteria 7070
71 Ga0070706_100070159 3300005467 Bacteria 3241
72 Ga0070706_100071125 3300005467 Bacteria 3217
73 Ga0070706_100071669 3300005467 Bacteria 3205
74 Ga0070707_100090799 3300005468 Bacteria 2957
75 Ga0070707_100465365 3300005468 Bacteria 1225
76 Ga0070698_100117606 3300005471 Bacteria 2620
77 Ga0070698_100590578 3300005471 Bacteria 1051
78 Ga0070679_100140340 3300005530 Bacteria 2396
79 Ga0070684_100115968 3300005535 Bacteria 2405
80 Ga0070697_100037242 3300005536 Bacteria 3929
81 Ga0070697_100067959 3300005536 Bacteria 2916
82 Ga0070697_100077824 3300005536 Bacteria 2728
83 Ga0070697_100090663 3300005536 Bacteria 2526
84 Ga0070697_100150541 3300005536 Bacteria 1961
85 Ga0070697_100284007 3300005536 Bacteria 1420
86 Ga0070697_100329839 3300005536 Bacteria 1315
87 Ga0070697_100740676 3300005536 Bacteria 868
88 Ga0068853_100267953 3300005539 Bacteria 1572
89 Ga0070672_100029625 3300005543 Bacteria 4106
90 Ga0070672_100097408 3300005543 Bacteria 2381
91 Ga0070672_100693886 3300005543 Bacteria 891
92 Ga0070686_100587794 3300005544 Bacteria 876
93 Ga0070695_100684833 3300005545 Bacteria 812
94 Ga0070693_100256231 3300005547 Bacteria 1162
95 Ga0070665_100003623 3300005548 Bacteria 16359
96 Ga0070665_100019987 3300005548 Bacteria 6725
97 Ga0070665_100125710 3300005548 Bacteria 2567
98 Ga0068855_100002881 3300005563 Bacteria 21086
99 Ga0070664_100239125 3300005564 Bacteria 1630
100 Ga0068856_100037144 3300005614 Bacteria 4778
101 Ga0068866_10142042 3300005718 Bacteria 1379
102 Ga0068861_100200681 3300005719 Bacteria 1674
103 Ga0068863_100149962 3300005841 Bacteria 2231
104 Ga0068863_100267541 3300005841 Bacteria 1654
105 Ga0068858_100004794 3300005842 Bacteria 13253
106 Ga0068858_100453697 3300005842 Bacteria 1236
107 Ga0068858_101192815 3300005842 Bacteria 748
108 Ga0068860_100268983 3300005843 Bacteria 1663
109 Ga0068860_100330749 3300005843 Bacteria 1497
110 Ga0068862_100074182 3300005844 Bacteria 2941
111 Ga0081455_10004503 3300005937 Bacteria 15580
112 Ga0081455_10008179 3300005937 Bacteria 10910
113 Ga0081455_10015032 3300005937 Bacteria 7539
114 Ga0081455_10075719 3300005937 Bacteria 2775
115 Ga0081540_1000223 3300005983 Bacteria 59812
116 Ga0081540_1075971 3300005983 Bacteria 1533
117 Ga0081539_10000077 3300005985 Bacteria 228125
118 Ga0081539_10000671 3300005985 Bacteria 68678
119 Ga0081539_10040389 3300005985 Bacteria 2739
120 Ga0070717_10032608 3300006028 Bacteria 4199
121 Ga0070717_10148293 3300006028 Bacteria 2028
122 Ga0070717_10270966 3300006028 Bacteria 1504
123 Ga0070716_100197586 3300006173 Bacteria 1334
124 Ga0070712_100032559 3300006175 Bacteria 3521
125 Ga0070712_100047381 3300006175 Bacteria 2974
126 Ga0070712_100102627 3300006175 Bacteria 2118
127 Ga0070712_100176066 3300006175 Bacteria 1663
128 Ga0097621_100095686 3300006237 Bacteria 2491
129 Ga0097621_100141758 3300006237 Bacteria 2054
130 Ga0068871_100105129 3300006358 Bacteria 2369
131 Ga0068871_100145852 3300006358 Bacteria 2015
132 Ga0075428_100402041 3300006844 Unclassified 1468
133 Ga0075434_100488053 3300006871 Unclassified 1253
134 Ga0068865_100062527 3300006881 Bacteria 2613
135 Ga0068865_100338647 3300006881 Bacteria 1215
136 Ga0075435_100277001 3300007076 Bacteria 1432
137 Ga0105240_10000021 3300009093 Bacteria 394304
138 Ga0105240_10183676 3300009093 Bacteria 2466
139 Ga0111539_10206623 3300009094 Bacteria 2289
140 Ga0105242_10980660 3300009176 Bacteria 851
141 Ga0105248_10469318 3300009177 Bacteria 1419
142 Ga0105237_10483842 3300009545 Bacteria 1244
143 Ga0105249_11111798 3300009553 Bacteria 860
144 Ga0105239_10008958 3300010375 Bacteria 11325
145 Ga0105239_10367983 3300010375 Bacteria 1624
146 Ga0157371_10289650 3300013102 Bacteria 1184
147 Ga0157374_10000057 3300013296 Bacteria 117036
148 Ga0157374_10016608 3300013296 Bacteria 6474
149 Ga0157374_10019980 3300013296 Bacteria 5938
150 Ga0157374_10052659 3300013296 Bacteria 3792
151 Ga0157378_10032669 3300013297 Bacteria 4598
152 Ga0157378_10041399 3300013297 Bacteria 4086
153 Ga0157378_10050077 3300013297 Bacteria 3717
154 Ga0157378_10054471 3300013297 Bacteria 3561
155 Ga0157378_10062249 3300013297 Bacteria 3332
156 Ga0157378_10098015 3300013297 Bacteria 2672
157 Ga0157378_10119543 3300013297 Bacteria 2427
158 Ga0163162_10014789 3300013306 Bacteria 7623
159 Ga0163162_10019896 3300013306 Bacteria 6593
160 Ga0163162_10117400 3300013306 Bacteria 2762
161 Ga0163162_10143892 3300013306 Bacteria 2499
162 Ga0157372_10123023 3300013307 Bacteria 2982
163 Ga0157372_10291966 3300013307 Bacteria 1896
164 Ga0157375_10000246 3300013308 Bacteria 49312
165 Ga0157375_10004602 3300013308 Bacteria 11989
166 Ga0157375_10047173 3300013308 Bacteria 4205
167 Ga0157375_11099309 3300013308 Bacteria 931
168 Ga0163163_10051834 3300014325 Bacteria 4046
169 Ga0163163_10095758 3300014325 Bacteria 2988
170 Ga0163163_11132534 3300014325 Bacteria 845
171 Ga0157377_10201388 3300014745 Bacteria 1264
172 Ga0157379_10003716 3300014968 Bacteria 12985
173 Ga0157376_10000167 3300014969 Bacteria 45629
174 Ga0157376_10009041 3300014969 Bacteria 7216
175 Ga0157376_10096889 3300014969 Bacteria 2568
176 Ga0157376_10481329 3300014969 Bacteria 1216
177 Ga0213872_10013633 3300021361 Bacteria 3806
178 Ga0213876_10054655 3300021384 Bacteria 2108
179 Ga0209050_1000999 3300025298 Bacteria 35524
180 Ga0207697_10001362 3300025315 Bacteria 13386
181 Ga0207697_10003523 3300025315 Bacteria 7717
182 Ga0207697_10003690 3300025315 Bacteria 7495
183 Ga0207697_10005467 3300025315 Bacteria 5902
184 Ga0207697_10006274 3300025315 Bacteria 5402
185 Ga0207697_10029642 3300025315 Bacteria 2240
186 Ga0207697_10037418 3300025315 Bacteria 1988
187 Ga0207697_10045126 3300025315 Bacteria 1814
188 Ga0207697_10061189 3300025315 Bacteria 1566
189 Ga0207653_10111580 3300025885 Bacteria 976
190 Ga0207682_10050151 3300025893 Bacteria 1725
191 Ga0207692_10047661 3300025898 Bacteria 2153
192 Ga0207692_10057352 3300025898 Bacteria 2002
193 Ga0207692_10133493 3300025898 Bacteria 1405
194 Ga0207642_10102476 3300025899 Bacteria 1440
195 Ga0207688_10003860 3300025901 Bacteria 8176
196 Ga0207680_10028223 3300025903 Bacteria 3136
197 Ga0207680_10367472 3300025903 Bacteria 1012
198 Ga0207680_10374929 3300025903 Bacteria 1002
199 Ga0207680_10463438 3300025903 Bacteria 900
200 Ga0207685_10045821 3300025905 Bacteria 1661
201 Ga0207699_10174704 3300025906 Bacteria 1440
202 Ga0207645_10006437 3300025907 Bacteria 8426
203 Ga0207645_10039040 3300025907 Bacteria 3042
204 Ga0207645_10066352 3300025907 Bacteria 2307
205 Ga0207705_10028282 3300025909 Bacteria 3997
206 Ga0207684_10007885 3300025910 Bacteria 9524
207 Ga0207684_10016876 3300025910 Bacteria 6270
208 Ga0207684_10018007 3300025910 Bacteria 6054
209 Ga0207684_10037279 3300025910 Bacteria 4125
210 Ga0207684_10061562 3300025910 Bacteria 3187
211 Ga0207684_10124530 3300025910 Bacteria 2211
212 Ga0207684_10349413 3300025910 Bacteria 1273
213 Ga0207695_10000083 3300025913 Bacteria 284102
214 Ga0207671_10087880 3300025914 Bacteria 2337
215 Ga0207693_10148077 3300025915 Bacteria 1846
216 Ga0207663_10081205 3300025916 Bacteria 2122
217 Ga0207657_10070256 3300025919 Bacteria 2969
218 Ga0207657_10513458 3300025919 Bacteria 938
219 Ga0207649_10250996 3300025920 Bacteria 1274
220 Ga0207652_10159897 3300025921 Bacteria 2019
221 Ga0207646_10000815 3300025922 Bacteria 40524
222 Ga0207646_10038297 3300025922 Bacteria 4320
223 Ga0207646_10045740 3300025922 Bacteria 3928
224 Ga0207646_10155192 3300025922 Bacteria 2064
225 Ga0207646_10185708 3300025922 Bacteria 1878
226 Ga0207646_10260164 3300025922 Bacteria 1568
227 Ga0207681_10023499 3300025923 Bacteria 3944
228 Ga0207681_10036470 3300025923 Bacteria 3244
229 Ga0207681_10547628 3300025923 Bacteria 952
230 Ga0207650_10086364 3300025925 Bacteria 2388
231 Ga0207650_10146420 3300025925 Bacteria 1861
232 Ga0207650_10208041 3300025925 Bacteria 1570
233 Ga0207650_10469406 3300025925 Bacteria 1049
234 Ga0207659_10028144 3300025926 Bacteria 3816
235 Ga0207659_10043445 3300025926 Bacteria 3157
236 Ga0207700_10170784 3300025928 Bacteria 1814
237 Ga0207664_10297381 3300025929 Bacteria 1419
238 Ga0207664_10403201 3300025929 Bacteria 1216
239 Ga0207644_10008274 3300025931 Bacteria 6815
240 Ga0207644_10043561 3300025931 Bacteria 3186
241 Ga0207644_10216283 3300025931 Bacteria 1517
242 Ga0207644_10318343 3300025931 Bacteria 1257
243 Ga0207706_10024263 3300025933 Bacteria 5436
244 Ga0207669_10012018 3300025937 Bacteria 4239
245 Ga0207669_10401816 3300025937 Bacteria 1073
246 Ga0207704_10028080 3300025938 Bacteria 3116
247 Ga0207665_10007105 3300025939 Bacteria 7413
248 Ga0207691_10001507 3300025940 Bacteria 23148
249 Ga0207691_10015716 3300025940 Bacteria 7194
250 Ga0207691_10644102 3300025940 Bacteria 896
251 Ga0207679_10198270 3300025945 Bacteria 1675
252 Ga0207667_10005665 3300025949 Bacteria 15230
253 Ga0207651_10002789 3300025960 Bacteria 8395
254 Ga0207651_10022055 3300025960 Bacteria 3884
255 Ga0207668_10050467 3300025972 Bacteria 2867
256 Ga0207668_10133149 3300025972 Bacteria 1901
257 Ga0207668_10159796 3300025972 Bacteria 1754
258 Ga0207658_10061399 3300025986 Bacteria 2808
259 Ga0207658_10138417 3300025986 Bacteria 1966
260 Ga0207677_10010682 3300026023 Bacteria 5202
261 Ga0207677_10224631 3300026023 Bacteria 1508
262 Ga0207703_10019808 3300026035 Bacteria 5258
263 Ga0207703_10382531 3300026035 Bacteria 1302
264 Ga0207639_10407292 3300026041 Bacteria 1226
265 Ga0207678_10004972 3300026067 Bacteria 11922
266 Ga0207641_10093766 3300026088 Bacteria 2632
267 Ga0207641_10186471 3300026088 Bacteria 1903
268 Ga0207641_10617279 3300026088 Bacteria 1063
269 Ga0207648_10016392 3300026089 Bacteria 6771
270 Ga0207683_10018000 3300026121 Bacteria 6025
271 Ga0207683_10024285 3300026121 Bacteria 5218
272 Ga0207683_10027291 3300026121 Bacteria 4934
273 Ga0207683_10152182 3300026121 Bacteria 2088
274 Ga0268266_10012428 3300028379 Bacteria 7360
275 Ga0268266_10039518 3300028379 Bacteria 4019
276 Ga0268266_10275047 3300028379 Bacteria 1564
277 Ga0268266_10309145 3300028379 Bacteria 1476
278 Ga0268265_10100804 3300028380 Bacteria 2332
279 Ga0268265_10909459 3300028380 Bacteria 865
280 Ga0268264_10552189 3300028381 Bacteria 1130
281 Ga0268264_10915500 3300028381 Bacteria 881
282 Ga0265327_10002005 3300031251 Bacteria 23006
283 Ga0265314_10199006 3300031711 Bacteria 1186
284 Ga0373934_0071648 3300035086 Bacteria 1387
285 Ga0373945_0084003 3300035116 Bacteria 1224
286 Ga0373953_0201357 3300035117 Bacteria 861
287 Ga0373957_0017738 3300035120 Bacteria 2485
288 Ga0373946_0050837 3300035171 Bacteria 1733
289 Ga0373955_0100851 3300035172 Bacteria 1657
290 Ga0373931_0343388 3300035691 Bacteria 933
291 Ga0373935_0199063 3300035692 Unclassified 1383
292 Ga0373927_0384474 3300035695 Bacteria 926
293 Ga0373933_0416083 3300035724 Bacteria 878
294 Ga0373947_0040085 3300035725 Bacteria 2789
295 Ga0373947_0052388 3300035725 Bacteria 2458
296 Ga0373947_0263280 3300035725 Bacteria 1143
297 Ga0373947_0306391 3300035725 Bacteria 1060
298 Ga0373947_0409517 3300035725 Bacteria 915
299 Ga0373937_0040640 3300036401 Bacteria 4240
300 Ga0373937_0165711 3300036401 Bacteria 2072
301 Ga0373937_0442183 3300036401 Bacteria 1234
302 Ga0373937_1059012 3300036401 Bacteria 760
303 Ga0373925_0213916 3300037068 Unclassified 1536
304 Ga0373925_0551998 3300037068 Bacteria 947
305 Ga0395899_0264270 3300037312 Bacteria 1176
306 Ga0395898_0310681 3300037466 Bacteria 1504
307 Ga0436364_1392031 3300037853 Bacteria 3058
308 Ga0395901_0185821 3300038443 Bacteria 2180
309 Ga0395901_0331906 3300038443 Bacteria 1572
310 Ga0395901_0377411 3300038443 Bacteria 1460
311 Ga0436365_1596478 3300039437 Bacteria 92213
312 Ga0436360_0468345 3300039438 Bacteria 764
313 Ga0436360_0642466 3300039438 Bacteria 3058
314 Ga0436361_0630809 3300039447 Bacteria 8116
315 Ga0436363_1130723 3300039450 Bacteria 24549
316 Ga0436363_1665071 3300039450 Bacteria 3116
317 Ga0436362_0101906 3300039453 Bacteria 1425
318 Ga0439448_0089170 3300042005 Bacteria 1041
319 Ga0495592_0057386 3300046454 Bacteria 2874
320 Ga0495603_0145005 3300046455 Bacteria 1380
321 Ga0495641_0039309 3300046461 Bacteria 2207
322 Ga0495651_0006596 3300046462 Bacteria 8861
323 Ga0495630_0136722 3300046517 Bacteria 1862
324 Ga0495652_0041030 3300046529 Bacteria 3997
325 Ga0495640_0350331 3300046533 Bacteria 911
326 Ga0495587_0072843 3300046536 Bacteria 1996
327 Ga0495598_0191499 3300046537 Bacteria 734
328 Ga0495609_0203500 3300046538 Bacteria 827
329 Ga0495634_0217549 3300046642 Bacteria 1180
330 Ga0495635_0113925 3300046663 Bacteria 1846
331 Ga0495599_0033505 3300046678 Bacteria 3228
332 Ga0495623_0022779 3300046679 Bacteria 4044
333 Ga0495646_0055775 3300046680 Bacteria 2371
334 Ga0495658_0106776 3300046683 Bacteria 1679
335 Ga0495613_0287288 3300046689 Bacteria 1141
336 Ga0495600_0077638 3300046809 Bacteria 2169
337 Ga0495600_0425935 3300046809 Bacteria 823
338 Ga0495581_0149408 3300047315 Bacteria 1364
339 Ga0495674_0036755 3300047319 Bacteria 4406
340 Ga0495674_0724971 3300047319 Bacteria 778
341 Ga0495676_0078236 3300047321 Bacteria 2519
342 Ga0495680_0121525 3300047322 Bacteria 1928
343 Ga0495675_0077460 3300047444 Bacteria 2095
344 Ga0495684_0191163 3300047471 Bacteria 1513
345 Ga0496101_0107851 3300048904 Bacteria 2093
346 Ga0496102_0066821 3300048905 Bacteria 3296
347 Ga0496102_0402895 3300048905 Bacteria 1286
348 Ga0496104_0241224 3300048907 Bacteria 1720
349 Ga0496104_0335443 3300048907 Bacteria 1425
350 Ga0496104_0498330 3300048907 Bacteria 1129
351 Ga0496105_0448138 3300048908 Bacteria 1019
352 Ga0496106_0099178 3300048909 Bacteria 2258
353 Ga0496107_0202948 3300048910 Bacteria 1474
354 Ga0496108_0092460 3300048911 Bacteria 2572
355 Ga0496108_0240135 3300048911 Bacteria 1576
356 Ga0496109_0035666 3300048912 Bacteria 4488
357 Ga0496109_0067823 3300048912 Bacteria 3269
358 Ga0496109_0078169 3300048912 Bacteria 3046
359 Ga0496109_0428242 3300048912 Bacteria 1250
360 Ga0496110_0060409 3300048913 Bacteria 3343
361 Ga0496111_0175840 3300048914 Bacteria 1591
362 Ga0496111_0282981 3300048914 Bacteria 1230
363 Ga0496112_0072132 3300048915 Bacteria 3413
364 Ga0496112_0172790 3300048915 Bacteria 2126
365 Ga0496112_0301149 3300048915 Bacteria 1549
366 Ga0496113_0142834 3300048916 Bacteria 1884
367 Ga0496113_0275663 3300048916 Bacteria 1345
368 Ga0496114_0014493 3300048917 Bacteria 6332
369 Ga0496114_0147814 3300048917 Bacteria 2038
370 Ga0496115_0006050 3300048918 Bacteria 8837
371 Ga0496115_0086532 3300048918 Bacteria 2557
372 Ga0496115_0209171 3300048918 Bacteria 1611
373 Ga0496121_0347721 3300048924 Bacteria 989
374 Ga0501080_0234803 3300049742 Bacteria 1676
375 nmdc:mga0n895_65165_c1 3300050512 Bacteria 3605
376 nmdc:mga08x19_54664_c1 3300050514 Bacteria 2571
377 nmdc:mga08x19_80387_c1 3300050514 Bacteria 2139
378 nmdc:mga0a205_446239_c1 3300050515 Bacteria 1154
379 Ga0495601_0014864 3300053077 Bacteria 4699
380 Ga0500616_0083597 3300053153 Bacteria 1598
381 Ga0075433_10186127
382 JGI25406J46586_10000074
383 rootH1_10057451
384 rootL2_10144186
385 JGI25404J52841_10011109
386 Ga0055530_10029716
387 JGI25405J52794_10038920
388 Ga0065712_10004947
389 Ga0065712_10125649
390 Ga0065712_10232674
391 Ga0065715_10002403
392 Ga0065715_10003053
393 Ga0065715_10156450
394 Ga0065707_10103714
395 Ga0070676_10007858
396 Ga0070683_100024365
397 Ga0070683_100026618
398 Ga0070670_100005264
399 Ga0070670_100217834
400 Ga0070670_100231939
401 Ga0070670_100337331
402 Ga0070670_100660656
403 Ga0070677_10048817
404 Ga0070666_10004462
405 Ga0070666_10078135
406 Ga0068868_100098869
407 Ga0070689_100014025
408 Ga0070687_100149405
409 Ga0070687_100236010
410 Ga0070661_100013106
411 Ga0070668_100006596
412 Ga0070668_101025359
413 Ga0070669_100011735
414 Ga0070669_100139878
415 Ga0070669_100827375
416 Ga0070675_100009331
417 Ga0070675_100052416
418 Ga0070671_100008597
419 Ga0070671_100084848
420 Ga0070671_100205268
421 Ga0070671_100705945
422 Ga0070674_100000696
423 Ga0070673_100001067
424 Ga0070673_100021030
425 Ga0070673_100028962
426 Ga0070688_100009019
427 Ga0070688_100028270
428 Ga0070688_100115283
429 Ga0070667_100010616
430 Ga0070667_100167147
431 Ga0070709_10097857
432 Ga0070709_10380803
433 Ga0070714_100038827
434 Ga0070714_100305904
435 Ga0070714_100454885
436 Ga0070713_100029896
437 Ga0070710_10023713
438 Ga0070710_10069591
439 Ga0070711_100133538
440 Ga0070708_100159677
441 Ga0070678_100014991
442 Ga0070678_100035436
443 Ga0070678_100201599
444 Ga0070678_100513848
445 Ga0070662_100526104
446 Ga0070681_10038940
447 Ga0068867_100035768
448 Ga0068867_100229864
449 Ga0070685_10043620
450 Ga0070706_100015362
451 Ga0070706_100070159
452 Ga0070706_100071125
453 Ga0070706_100071669
454 Ga0070707_100090799
455 Ga0070707_100465365
456 Ga0070698_100117606
457 Ga0070698_100590578
458 Ga0070679_100140340
459 Ga0070684_100115968
460 Ga0070697_100037242
461 Ga0070697_100067959
462 Ga0070697_100077824
463 Ga0070697_100090663
464 Ga0070697_100150541
465 Ga0070697_100284007
466 Ga0070697_100329839
467 Ga0070697_100740676
468 Ga0068853_100267953
469 Ga0070672_100029625
470 Ga0070672_100097408
471 Ga0070672_100693886
472 Ga0070686_100587794
473 Ga0070695_100684833
474 Ga0070693_100256231
475 Ga0070665_100003623
476 Ga0070665_100019987
477 Ga0070665_100125710
478 Ga0068855_100002881
479 Ga0070664_100239125
480 Ga0068856_100037144
481 Ga0068866_10142042
482 Ga0068861_100200681
483 Ga0068863_100149962
484 Ga0068863_100267541
485 Ga0068858_100004794
486 Ga0068858_100453697
487 Ga0068858_101192815
488 Ga0068860_100268983
489 Ga0068860_100330749
490 Ga0068862_100074182
491 Ga0081455_10004503
492 Ga0081455_10008179
493 Ga0081455_10015032
494 Ga0081455_10075719
495 Ga0081540_1000223
496 Ga0081540_1075971
497 Ga0081539_10000077
498 Ga0081539_10000671
499 Ga0081539_10040389
500 Ga0070717_10032608
501 Ga0070717_10148293
502 Ga0070717_10270966
503 Ga0070716_100197586
504 Ga0070712_100032559
505 Ga0070712_100047381
506 Ga0070712_100102627
507 Ga0070712_100176066
508 Ga0097621_100095686
509 Ga0097621_100141758
510 Ga0068871_100105129
511 Ga0068871_100145852
512 Ga0075428_100402041
513 Ga0075434_100488053
514 Ga0068865_100062527
515 Ga0068865_100338647
516 Ga0075435_100277001
517 Ga0105240_10000021
518 Ga0105240_10183676
519 Ga0111539_10206623
520 Ga0105242_10980660
521 Ga0105248_10469318
522 Ga0105237_10483842
523 Ga0105249_11111798
524 Ga0105239_10008958
525 Ga0105239_10367983
526 Ga0157371_10289650
527 Ga0157374_10000057
528 Ga0157374_10016608
529 Ga0157374_10019980
530 Ga0157374_10052659
531 Ga0157378_10032669
532 Ga0157378_10041399
533 Ga0157378_10050077
534 Ga0157378_10054471
535 Ga0157378_10062249
536 Ga0157378_10098015
537 Ga0157378_10119543
538 Ga0163162_10014789
539 Ga0163162_10019896
540 Ga0163162_10117400
541 Ga0163162_10143892
542 Ga0157372_10123023
543 Ga0157372_10291966
544 Ga0157375_10000246
545 Ga0157375_10004602
546 Ga0157375_10047173
547 Ga0157375_11099309
548 Ga0163163_10051834
549 Ga0163163_10095758
550 Ga0163163_11132534
551 Ga0157377_10201388
552 Ga0157379_10003716
553 Ga0157376_10000167
554 Ga0157376_10009041
555 Ga0157376_10096889
556 Ga0157376_10481329
557 Ga0213872_10013633
558 Ga0213876_10054655
559 Ga0209050_1000999
560 Ga0207697_10001362
561 Ga0207697_10003523
562 Ga0207697_10003690
563 Ga0207697_10005467
564 Ga0207697_10006274
565 Ga0207697_10029642
566 Ga0207697_10037418
567 Ga0207697_10045126
568 Ga0207697_10061189
569 Ga0207653_10111580
570 Ga0207682_10050151
571 Ga0207692_10047661
572 Ga0207692_10057352
573 Ga0207692_10133493
574 Ga0207642_10102476
575 Ga0207688_10003860
576 Ga0207680_10028223
577 Ga0207680_10367472
578 Ga0207680_10374929
579 Ga0207680_10463438
580 Ga0207685_10045821
581 Ga0207699_10174704
582 Ga0207645_10006437
583 Ga0207645_10039040
584 Ga0207645_10066352
585 Ga0207705_10028282
586 Ga0207684_10007885
587 Ga0207684_10016876
588 Ga0207684_10018007
589 Ga0207684_10037279
590 Ga0207684_10061562
591 Ga0207684_10124530
592 Ga0207684_10349413
593 Ga0207695_10000083
594 Ga0207671_10087880
595 Ga0207693_10148077
596 Ga0207663_10081205
597 Ga0207657_10070256
598 Ga0207657_10513458
599 Ga0207649_10250996
600 Ga0207652_10159897
601 Ga0207646_10000815
602 Ga0207646_10038297
603 Ga0207646_10045740
604 Ga0207646_10155192
605 Ga0207646_10185708
606 Ga0207646_10260164
607 Ga0207681_10023499
608 Ga0207681_10036470
609 Ga0207681_10547628
610 Ga0207650_10086364
611 Ga0207650_10146420
612 Ga0207650_10208041
613 Ga0207650_10469406
614 Ga0207659_10028144
615 Ga0207659_10043445
616 Ga0207700_10170784
617 Ga0207664_10297381
618 Ga0207664_10403201
619 Ga0207644_10008274
620 Ga0207644_10043561
621 Ga0207644_10216283
622 Ga0207644_10318343
623 Ga0207706_10024263
624 Ga0207669_10012018
625 Ga0207669_10401816
626 Ga0207704_10028080
627 Ga0207665_10007105
628 Ga0207691_10001507
629 Ga0207691_10015716
630 Ga0207691_10644102
631 Ga0207679_10198270
632 Ga0207667_10005665
633 Ga0207651_10002789
634 Ga0207651_10022055
635 Ga0207668_10050467
636 Ga0207668_10133149
637 Ga0207668_10159796
638 Ga0207658_10061399
639 Ga0207658_10138417
640 Ga0207677_10010682
641 Ga0207677_10224631
642 Ga0207703_10019808
643 Ga0207703_10382531
644 Ga0207639_10407292
645 Ga0207678_10004972
646 Ga0207641_10093766
647 Ga0207641_10186471
648 Ga0207641_10617279
649 Ga0207648_10016392
650 Ga0207683_10018000
651 Ga0207683_10024285
652 Ga0207683_10027291
653 Ga0207683_10152182
654 Ga0268266_10012428
655 Ga0268266_10039518
656 Ga0268266_10275047
657 Ga0268266_10309145
658 Ga0268265_10100804
659 Ga0268265_10909459
660 Ga0268264_10552189
661 Ga0268264_10915500
662 Ga0265327_10002005
663 Ga0265314_10199006
664 Ga0373934_0071648
665 Ga0373945_0084003
666 Ga0373953_0201357
667 Ga0373957_0017738
668 Ga0373946_0050837
669 Ga0373955_0100851
670 Ga0373931_0343388
671 Ga0373935_0199063
672 Ga0373927_0384474
673 Ga0373933_0416083
674 Ga0373947_0040085
675 Ga0373947_0052388
676 Ga0373947_0263280
677 Ga0373947_0306391
678 Ga0373947_0409517
679 Ga0373937_0040640
680 Ga0373937_0165711
681 Ga0373937_0442183
682 Ga0373937_1059012
683 Ga0373925_0213916
684 Ga0373925_0551998
685 Ga0395899_0264270
686 Ga0395898_0310681
687 Ga0436364_1392031
688 Ga0395901_0185821
689 Ga0395901_0331906
690 Ga0395901_0377411
691 Ga0436365_1596478
692 Ga0436360_0468345
693 Ga0436360_0642466
694 Ga0436361_0630809
695 Ga0436363_1130723
696 Ga0436363_1665071
697 Ga0436362_0101906
698 Ga0439448_0089170
699 Ga0495592_0057386
700 Ga0495603_0145005
701 Ga0495641_0039309
702 Ga0495651_0006596
703 Ga0495630_0136722
704 Ga0495652_0041030
705 Ga0495640_0350331
706 Ga0495587_0072843
707 Ga0495598_0191499
708 Ga0495609_0203500
709 Ga0495634_0217549
710 Ga0495635_0113925
711 Ga0495599_0033505
712 Ga0495623_0022779
713 Ga0495646_0055775
714 Ga0495658_0106776
715 Ga0495613_0287288
716 Ga0495600_0077638
717 Ga0495600_0425935
718 Ga0495581_0149408
719 Ga0495674_0036755
720 Ga0495674_0724971
721 Ga0495676_0078236
722 Ga0495680_0121525
723 Ga0495675_0077460
724 Ga0495684_0191163
725 Ga0496101_0107851
726 Ga0496102_0066821
727 Ga0496102_0402895
728 Ga0496104_0241224
729 Ga0496104_0335443
730 Ga0496104_0498330
731 Ga0496105_0448138
732 Ga0496106_0099178
733 Ga0496107_0202948
734 Ga0496108_0092460
735 Ga0496108_0240135
736 Ga0496109_0035666
737 Ga0496109_0067823
738 Ga0496109_0078169
739 Ga0496109_0428242
740 Ga0496110_0060409
741 Ga0496111_0175840
742 Ga0496111_0282981
743 Ga0496112_0072132
744 Ga0496112_0172790
745 Ga0496112_0301149
746 Ga0496113_0142834
747 Ga0496113_0275663
748 Ga0496114_0014493
749 Ga0496114_0147814
750 Ga0496115_0006050
751 Ga0496115_0086532
752 Ga0496115_0209171
753 Ga0496121_0347721
754 Ga0501080_0234803
755 nmdc:mga0n895_65165_c1
756 nmdc:mga08x19_54664_c1
757 nmdc:mga08x19_80387_c1
758 nmdc:mga0a205_446239_c1
759 Ga0495601_0014864
760 Ga0500616_0083597

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

72

218

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
1f3o-assembly1.cif.gz_A-2 crystal structure of mj0796 atp-binding cassette 0.9666 6 220
2pcj-assembly1.cif.gz_B crystal structure of abc transporter (aq_297) from aquifex aeolicus vf5 0.9581 3 221
3tuj-assembly1.cif.gz_C inward facing conformations of the metni methionine abc transporter: dm crystal form 0.9556 5 221
7w7a-assembly2.cif.gz_E heme exporter in complex with mn-containing protoporphyrin ix, mn-anomalous data 0.9536 4 219
7w7b-assembly2.cif.gz_G heme exporter hrtba in complex with protoporphyrin ix containing manganese(iii), high resolution data 0.9517 3 221
ID Description Score Start End Superfamily
af_A4I4M8_123_401_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9741 32 221 3.40.50.300
af_P14175_33_289_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9724 24 220 3.40.50.300
af_P9WQK1_1_231_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9684 3 221 3.40.50.300
af_P0A9T8_2_228_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9665 4 221 3.40.50.300
af_Q4DP20_46_317_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9638 3 221 3.40.50.300
ID Description Score Start End GO Terms
AF-A9KJN2-F1-model_v4 ABC transporter related 0.9839 1 220 GO:0005524
GO:0016887
AF-R6CP31-F1-model_v4 deleted 0.9828 3 221
AF-A0A087DEU0-F1-model_v4 ATP-binding protein of ABC transporter system (EC 3.6.3.36) 0.9813 4 220 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-A0A7C9JAV8-F1-model_v4 ATP-binding cassette domain-containing protein 0.9796 3 220 GO:0005524
GO:0005886
GO:0016887
GO:0022857
AF-U3BNP7-F1-model_v4 Putative ABC transporter ATP-binding protein 0.9772 89 221 GO:0005524
GO:0005886
GO:0016887
GO:0022857
GO:0044874
GO:0089705

Map