F428567

General Info

Members Datasets Scaffolds Average Seq Length
380 201 760 194

Family's Representative Sequence

Representative Sequence 3300005434|Ga0070709_10000448|Ga0070709_100004484
Length 221
Sequence MATDQDRYPASYPVQFTIDYPDRPLNRLTSFFRIFVIIPISIVLGTVSAATWESAGSNSTLHQSTMYYGAGAGGLLFFGPLLMILFRQKYPRWWFDWNLELQRFINRVWTYLALMNDSYPSTDDHQWVQLDYAYPDAATDLNRWLPLVKWLLAIPHYIVLIFLEIGAFFAVIVTWFAILFTGRYPRGIFSFVEGVFRWHNRVAAYAFVLVTDRYPPFRLAP

Samples

Sample ID Description Type Environment
1 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
2 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
3 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
4 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
8 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
9 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
10 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
11 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
12 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
13 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
14 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
15 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
16 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
17 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
18 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
19 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
20 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
21 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
22 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
23 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
24 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
25 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
26 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
27 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
28 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
29 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
30 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
31 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
32 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
33 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
34 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
35 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
36 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
37 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
38 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
39 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
40 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
41 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
42 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
43 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
44 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
45 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
46 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
47 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
48 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
49 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
50 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
54 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
55 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
73 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
76 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
79 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
80 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
81 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
82 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
83 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
84 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
85 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
86 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
87 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
88 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
89 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
90 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
91 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
92 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
93 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
94 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
95 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
96 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
97 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
98 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
99 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
100 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
101 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
102 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
103 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
104 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
105 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
106 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
107 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
108 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
109 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
110 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
111 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
112 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
113 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
114 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
115 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
116 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
117 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
118 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
119 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
120 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
121 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
122 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
123 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
124 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
125 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
126 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
127 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
128 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
131 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
132 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
133 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
134 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
135 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
136 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
137 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
138 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
139 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
140 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
141 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
142 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
143 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
144 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
145 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
146 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
147 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
148 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
149 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
150 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
151 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
152 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
153 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
154 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
155 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
156 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
157 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
158 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
159 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
160 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
161 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
162 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
163 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
164 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
165 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
166 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
167 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
168 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
169 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
170 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
171 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
172 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
173 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
174 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
175 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
176 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
177 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
178 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
179 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
180 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
181 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
182 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
183 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
184 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
185 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
186 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
187 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
188 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
189 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
190 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
191 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
192 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
193 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
194 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
195 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
196 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
197 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
198 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
199 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
200 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
201 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.47
Metatranscriptomes 0.53
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 8.42
Rhizosphere 90.26
Stem 0
Stem Tuber 0
Unclassified 1.32

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070709_10000448 3300005434 Bacteria 24889
2 Ga0070683_100105765 3300005329 Bacteria 2653
3 Ga0070683_101095149 3300005329 Bacteria 765
4 Ga0070690_100689158 3300005330 Bacteria 784
5 Ga0070680_100400523 3300005336 Bacteria 1170
6 Ga0070682_100017028 3300005337 Bacteria 4233
7 Ga0068868_100190909 3300005338 Bacteria 1703
8 Ga0070709_10001749 3300005434 Bacteria 11805
9 Ga0070709_10012735 3300005434 Bacteria 4713
10 Ga0070709_10030679 3300005434 Bacteria 3228
11 Ga0070709_10156902 3300005434 Bacteria 1578
12 Ga0070709_10402272 3300005434 Bacteria 1022
13 Ga0070714_100000468 3300005435 Bacteria 29346
14 Ga0070714_100001111 3300005435 Bacteria 19303
15 Ga0070714_100001869 3300005435 Bacteria 15349
16 Ga0070714_100001999 3300005435 Bacteria 14908
17 Ga0070714_100010022 3300005435 Bacteria 7475
18 Ga0070714_100099516 3300005435 Bacteria 2559
19 Ga0070714_100549578 3300005435 Bacteria 1105
20 Ga0070714_100711951 3300005435 Bacteria 969
21 Ga0070713_100000493 3300005436 Bacteria 25221
22 Ga0070713_100001354 3300005436 Bacteria 15667
23 Ga0070713_100014471 3300005436 Bacteria 5862
24 Ga0070713_100299400 3300005436 Bacteria 1480
25 Ga0070713_100359013 3300005436 Bacteria 1353
26 Ga0070713_100630186 3300005436 Bacteria 1020
27 Ga0070713_100718745 3300005436 Bacteria 954
28 Ga0070710_10000247 3300005437 Bacteria 25471
29 Ga0070710_10054759 3300005437 Bacteria 2251
30 Ga0070710_10081128 3300005437 Bacteria 1893
31 Ga0070710_10099335 3300005437 Bacteria 1730
32 Ga0070710_10133254 3300005437 Bacteria 1517
33 Ga0070711_100004008 3300005439 Bacteria 8661
34 Ga0070711_100011939 3300005439 Bacteria 5407
35 Ga0070711_100014640 3300005439 Bacteria 4944
36 Ga0070711_100112184 3300005439 Bacteria 2003
37 Ga0070705_100213925 3300005440 Bacteria 1330
38 Ga0070694_100756332 3300005444 Bacteria 794
39 Ga0070708_100016579 3300005445 Bacteria 6118
40 Ga0070708_100022959 3300005445 Bacteria 5299
41 Ga0070708_100031190 3300005445 Bacteria 4611
42 Ga0070708_100116634 3300005445 Bacteria 2459
43 Ga0070663_100212500 3300005455 Bacteria 1515
44 Ga0070678_100121892 3300005456 Bacteria 2057
45 Ga0070681_10820917 3300005458 Bacteria 847
46 Ga0070707_100068244 3300005468 Bacteria 3421
47 Ga0070707_100323200 3300005468 Bacteria 1499
48 Ga0070698_100022208 3300005471 Bacteria 6643
49 Ga0070698_100087395 3300005471 Bacteria 3103
50 Ga0070698_100643174 3300005471 Bacteria 1001
51 Ga0070699_100042016 3300005518 Bacteria 3956
52 Ga0070679_100689902 3300005530 Bacteria 964
53 Ga0070679_101005734 3300005530 Bacteria 778
54 Ga0070684_100014651 3300005535 Bacteria 6359
55 Ga0070684_101183603 3300005535 Bacteria 719
56 Ga0070697_100000992 3300005536 Bacteria 21465
57 Ga0070686_100116737 3300005544 Bacteria 1827
58 Ga0070696_100117246 3300005546 Bacteria 1924
59 Ga0070693_100146274 3300005547 Bacteria 1493
60 Ga0070693_100227552 3300005547 Bacteria 1225
61 Ga0070665_101355344 3300005548 Bacteria 721
62 Ga0070704_100666438 3300005549 Bacteria 920
63 Ga0070704_100917313 3300005549 Bacteria 789
64 Ga0068856_100242537 3300005614 Bacteria 1817
65 Ga0068863_100077822 3300005841 Bacteria 3139
66 Ga0081540_1001484 3300005983 Bacteria 20251
67 Ga0070717_10019004 3300006028 Bacteria 5380
68 Ga0070717_10032425 3300006028 Bacteria 4210
69 Ga0070717_10036668 3300006028 Bacteria 3978
70 Ga0070717_10089705 3300006028 Bacteria 2593
71 Ga0070717_10266770 3300006028 Bacteria 1516
72 Ga0070715_10007405 3300006163 Bacteria 3777
73 Ga0070715_10027131 3300006163 Bacteria 2285
74 Ga0070715_10051778 3300006163 Bacteria 1768
75 Ga0070716_100000820 3300006173 Bacteria 13386
76 Ga0070716_100001505 3300006173 Bacteria 10417
77 Ga0070716_100009035 3300006173 Bacteria 4960
78 Ga0070716_100054158 3300006173 Bacteria 2291
79 Ga0070712_100018735 3300006175 Bacteria 4502
80 Ga0070712_100053532 3300006175 Bacteria 2818
81 Ga0070712_100056082 3300006175 Bacteria 2762
82 Ga0097621_100379048 3300006237 Bacteria 1263
83 Ga0097621_100544802 3300006237 Bacteria 1055
84 Ga0068871_100156771 3300006358 Bacteria 1944
85 Ga0075431_100100602 3300006847 Bacteria 2983
86 Ga0075433_10009300 3300006852 Bacteria 7859
87 Ga0075434_100023597 3300006871 Bacteria 5998
88 Ga0075434_100518118 3300006871 Bacteria 1213
89 Ga0075435_100245425 3300007076 Bacteria 1524
90 Ga0075435_100473642 3300007076 Bacteria 1081
91 Ga0099795_10129037 3300007788 Bacteria 1018
92 Ga0111539_10083952 3300009094 Bacteria 3745
93 Ga0111539_10265256 3300009094 Unclassified 1999
94 Ga0105245_11024095 3300009098 Bacteria 871
95 Ga0105247_10572939 3300009101 Bacteria 833
96 Ga0114129_10089580 3300009147 Bacteria 4265
97 Ga0105243_10086718 3300009148 Bacteria 2568
98 Ga0105243_10565398 3300009148 Bacteria 1089
99 Ga0105241_10215814 3300009174 Bacteria 1610
100 Ga0105241_10543538 3300009174 Bacteria 1042
101 Ga0105237_10515052 3300009545 Bacteria 1203
102 Ga0105237_10611595 3300009545 Bacteria 1097
103 Ga0099796_10079901 3300010159 Bacteria 1197
104 Ga0157373_10222599 3300013100 Bacteria 1331
105 Ga0157369_11156583 3300013105 Unclassified 790
106 Ga0157374_10213691 3300013296 Bacteria 1891
107 Ga0157372_10242146 3300013307 Bacteria 2093
108 Ga0157376_10163754 3300014969 Bacteria 2018
109 Ga0157376_11024085 3300014969 Bacteria 849
110 Ga0207653_10106241 3300025885 Bacteria 998
111 Ga0207692_10000414 3300025898 Bacteria 14934
112 Ga0207692_10003154 3300025898 Bacteria 6398
113 Ga0207692_10017404 3300025898 Bacteria 3205
114 Ga0207692_10096839 3300025898 Bacteria 1612
115 Ga0207710_10325916 3300025900 Bacteria 779
116 Ga0207685_10014948 3300025905 Bacteria 2445
117 Ga0207685_10136703 3300025905 Bacteria 1094
118 Ga0207685_10168186 3300025905 Bacteria 1007
119 Ga0207685_10182785 3300025905 Bacteria 973
120 Ga0207699_10003553 3300025906 Bacteria 7437
121 Ga0207699_10009959 3300025906 Bacteria 4752
122 Ga0207699_10059348 3300025906 Bacteria 2292
123 Ga0207699_10109099 3300025906 Bacteria 1771
124 Ga0207699_10160338 3300025906 Bacteria 1497
125 Ga0207699_10320376 3300025906 Bacteria 1087
126 Ga0207684_10253528 3300025910 Bacteria 1518
127 Ga0207684_10685206 3300025910 Bacteria 872
128 Ga0207654_10555901 3300025911 Bacteria 815
129 Ga0207671_10525643 3300025914 Bacteria 943
130 Ga0207693_10004836 3300025915 Bacteria 11333
131 Ga0207693_10058560 3300025915 Bacteria 3018
132 Ga0207663_10022209 3300025916 Bacteria 3625
133 Ga0207663_10036943 3300025916 Bacteria 2941
134 Ga0207663_10040571 3300025916 Bacteria 2830
135 Ga0207663_10143939 3300025916 Bacteria 1664
136 Ga0207652_10895971 3300025921 Bacteria 784
137 Ga0207646_10008032 3300025922 Bacteria 10638
138 Ga0207646_10047485 3300025922 Bacteria 3850
139 Ga0207646_10195476 3300025922 Bacteria 1827
140 Ga0207646_10615564 3300025922 Bacteria 974
141 Ga0207700_10000433 3300025928 Bacteria 24650
142 Ga0207700_10000546 3300025928 Bacteria 22038
143 Ga0207700_10084575 3300025928 Bacteria 2487
144 Ga0207700_10202813 3300025928 Bacteria 1672
145 Ga0207700_10266181 3300025928 Bacteria 1469
146 Ga0207664_10000122 3300025929 Bacteria 68140
147 Ga0207664_10000387 3300025929 Bacteria 31822
148 Ga0207664_10001919 3300025929 Bacteria 13653
149 Ga0207664_10002838 3300025929 Bacteria 11505
150 Ga0207664_10008072 3300025929 Bacteria 7323
151 Ga0207664_10217834 3300025929 Bacteria 1654
152 Ga0207664_10292670 3300025929 Bacteria 1431
153 Ga0207664_10356462 3300025929 Bacteria 1295
154 Ga0207664_10681459 3300025929 Bacteria 924
155 Ga0207709_10813036 3300025935 Bacteria 755
156 Ga0207665_10000052 3300025939 Bacteria 74914
157 Ga0207665_10009645 3300025939 Bacteria 6340
158 Ga0207665_10021057 3300025939 Bacteria 4285
159 Ga0207665_10022646 3300025939 Bacteria 4135
160 Ga0207665_10641372 3300025939 Bacteria 832
161 Ga0207661_10068690 3300025944 Bacteria 2886
162 Ga0207661_10537585 3300025944 Bacteria 1070
163 Ga0207677_10224598 3300026023 Bacteria 1508
164 Ga0207703_10935172 3300026035 Bacteria 831
165 Ga0207678_10212224 3300026067 Bacteria 1656
166 Ga0207702_10015009 3300026078 Bacteria 6424
167 Ga0207702_10245510 3300026078 Bacteria 1679
168 Ga0207675_100435003 3300026118 Bacteria 1298
169 Ga0207683_10004419 3300026121 Bacteria 12152
170 Ga0265319_1002152 3300028563 Bacteria 11021
171 Ga0265760_10007455 3300031090 Bacteria 3127
172 Ga0265760_10079484 3300031090 Bacteria 1014
173 Ga0307405_10213730 3300031731 Bacteria 1410
174 Ga0307410_10081548 3300031852 Bacteria 2273
175 Ga0307412_10524484 3300031911 Bacteria 990
176 Ga0307415_100308915 3300032126 Bacteria 1313
177 Ga0373959_0034407 3300034820 Bacteria 1037
178 Ga0373926_0005880 3300035083 Bacteria 4056
179 Ga0373926_0007467 3300035083 Bacteria 3640
180 Ga0373929_0023821 3300035085 Bacteria 1260
181 Ga0373934_0016828 3300035086 Bacteria 2783
182 Ga0373934_0034328 3300035086 Bacteria 1993
183 Ga0373940_0125063 3300035088 Bacteria 801
184 Ga0373944_0003269 3300035089 Bacteria 4170
185 Ga0373949_0011452 3300035090 Bacteria 1955
186 Ga0373952_0018191 3300035092 Bacteria 1452
187 Ga0373923_0009900 3300035111 Bacteria 3452
188 Ga0373923_0027608 3300035111 Bacteria 2265
189 Ga0373932_0014529 3300035112 Bacteria 1981
190 Ga0373936_0002110 3300035113 Bacteria 7388
191 Ga0373936_0058893 3300035113 Bacteria 1564
192 Ga0373941_0074951 3300035115 Bacteria 1131
193 Ga0373945_0001232 3300035116 Bacteria 7795
194 Ga0373945_0007643 3300035116 Bacteria 3504
195 Ga0373953_0000973 3300035117 Bacteria 8031
196 Ga0373953_0007704 3300035117 Bacteria 3620
197 Ga0373954_0028110 3300035118 Bacteria 2583
198 Ga0373954_0053403 3300035118 Bacteria 1899
199 Ga0373956_0011390 3300035119 Bacteria 3663
200 Ga0373956_0119353 3300035119 Bacteria 1231
201 Ga0373957_0019740 3300035120 Bacteria 2374
202 Ga0373957_0058135 3300035120 Bacteria 1493
203 Ga0373960_0054743 3300035121 Bacteria 1194
204 Ga0373960_0161924 3300035121 Bacteria 771
205 Ga0373943_0001508 3300035170 Bacteria 10534
206 Ga0373943_0033521 3300035170 Bacteria 2447
207 Ga0373943_0225291 3300035170 Bacteria 1045
208 Ga0373946_0002668 3300035171 Bacteria 6299
209 Ga0373946_0039292 3300035171 Bacteria 1931
210 Ga0373946_0116780 3300035171 Bacteria 1214
211 Ga0373955_0129979 3300035172 Bacteria 1469
212 Ga0373961_0024705 3300035241 Bacteria 1628
213 Ga0373962_0090120 3300035242 Bacteria 943
214 Ga0316574_0601030 3300035398 Bacteria 680
215 Ga0373924_0008647 3300035410 Bacteria 3709
216 Ga0373931_0256402 3300035691 Bacteria 1065
217 Ga0373935_0027052 3300035692 Bacteria 3545
218 Ga0373935_0092335 3300035692 Bacteria 1983
219 Ga0373935_0466843 3300035692 Bacteria 913
220 Ga0373927_0111288 3300035695 Bacteria 1784
221 Ga0373933_0015368 3300035724 Bacteria 4266
222 Ga0373933_0100098 3300035724 Bacteria 1797
223 Ga0373947_0018569 3300035725 Bacteria 4004
224 Ga0373947_0028333 3300035725 Bacteria 3283
225 Ga0373947_0032349 3300035725 Bacteria 3082
226 Ga0373947_0096206 3300035725 Bacteria 1853
227 Ga0373947_0169622 3300035725 Bacteria 1415
228 Ga0373937_0006304 3300036401 Bacteria 10228
229 Ga0373937_0072398 3300036401 Bacteria 3179
230 Ga0373925_0002973 3300037068 Bacteria 13381
231 Ga0373925_0010385 3300037068 Bacteria 6757
232 Ga0373925_0117486 3300037068 Bacteria 2061
233 Ga0373925_0150785 3300037068 Bacteria 1825
234 Ga0395900_0064493 3300037418 Bacteria 3764
235 Ga0395898_0011146 3300037466 Bacteria 9361
236 Ga0395905_0009595 3300037471 Bacteria 9452
237 Ga0395901_0037311 3300038443 Bacteria 5026
238 Ga0242420_000239 3300038996 Bacteria 5926
239 Ga0436362_0365072 3300039453 Bacteria 883
240 Ga0451797_1095673 3300041453 Bacteria 1934
241 Ga0451837_1318211 3300041494 Bacteria 1509
242 Ga0451839_0955164 3300041496 Unclassified 876
243 Ga0451841_0762173 3300041498 Bacteria 960
244 Ga0451849_0308856 3300041505 Bacteria 1487
245 Ga0451843_0729711 3300041509 Bacteria 1640
246 Ga0439458_0048405 3300042157 Bacteria 1045
247 Ga0466957_0228587 3300044842 Bacteria 1231
248 Ga0466958_0115192 3300045836 Bacteria 1680
249 Ga0466967_0501866 3300045976 Bacteria 1191
250 Ga0495603_0020084 3300046455 Bacteria 4048
251 Ga0495603_0027179 3300046455 Bacteria 3454
252 Ga0495603_0103435 3300046455 Bacteria 1662
253 Ga0495629_0020299 3300046459 Bacteria 4744
254 Ga0495629_0031674 3300046459 Bacteria 3743
255 Ga0495629_0037164 3300046459 Bacteria 3432
256 Ga0495641_0016178 3300046461 Bacteria 3939
257 Ga0495641_0040930 3300046461 Bacteria 2154
258 Ga0495653_0083248 3300046463 Bacteria 2359
259 Ga0495653_0123161 3300046463 Bacteria 1844
260 Ga0495580_0015741 3300046472 Bacteria 5697
261 Ga0495580_0197569 3300046472 Bacteria 1386
262 Ga0495582_0001550 3300046473 Bacteria 12957
263 Ga0495582_0005091 3300046473 Bacteria 7361
264 Ga0495639_0005924 3300046475 Bacteria 5260
265 Ga0495639_0013775 3300046475 Bacteria 3497
266 Ga0495662_0032419 3300046476 Bacteria 2523
267 Ga0495664_0009591 3300046477 Bacteria 5418
268 Ga0495664_0013553 3300046477 Bacteria 4624
269 Ga0495664_0033592 3300046477 Bacteria 3014
270 Ga0495594_0041862 3300046499 Bacteria 2508
271 Ga0495594_0045341 3300046499 Bacteria 2413
272 Ga0495594_0083890 3300046499 Bacteria 1781
273 Ga0495608_0024140 3300046511 Bacteria 4159
274 Ga0495608_0044893 3300046511 Bacteria 2947
275 Ga0495618_0000582 3300046514 Bacteria 26040
276 Ga0495628_0030068 3300046516 Bacteria 4400
277 Ga0495628_0033406 3300046516 Bacteria 4147
278 Ga0495630_0016158 3300046517 Bacteria 5454
279 Ga0495630_0117816 3300046517 Bacteria 2013
280 Ga0495666_0006535 3300046526 Bacteria 5864
281 Ga0495652_0072679 3300046529 Bacteria 2865
282 Ga0495665_0024997 3300046531 Bacteria 3209
283 Ga0495665_0040492 3300046531 Bacteria 2480
284 Ga0495665_0140729 3300046531 Bacteria 1261
285 Ga0495640_0005510 3300046533 Bacteria 10070
286 Ga0495640_0035111 3300046533 Bacteria 3550
287 Ga0495586_0019112 3300046535 Bacteria 3645
288 Ga0495586_0035079 3300046535 Bacteria 2694
289 Ga0495587_0026159 3300046536 Bacteria 3559
290 Ga0495645_0029175 3300046543 Bacteria 4011
291 Ga0495667_0024369 3300046559 Bacteria 4074
292 Ga0495634_0072188 3300046642 Bacteria 2270
293 Ga0495634_0091268 3300046642 Bacteria 1977
294 Ga0495635_0013597 3300046663 Bacteria 5694
295 Ga0495635_0021846 3300046663 Bacteria 4460
296 Ga0495588_0012097 3300046674 Bacteria 4068
297 Ga0495588_0190650 3300046674 Bacteria 1083
298 Ga0495657_0044616 3300046675 Bacteria 3014
299 Ga0495657_0079183 3300046675 Bacteria 2128
300 Ga0495657_0141139 3300046675 Bacteria 1501
301 Ga0495599_0149587 3300046678 Bacteria 1446
302 Ga0495623_0031952 3300046679 Bacteria 3384
303 Ga0495646_0000810 3300046680 Bacteria 17516
304 Ga0495646_0038132 3300046680 Bacteria 2968
305 Ga0495647_0022079 3300046681 Bacteria 2298
306 Ga0495658_0000895 3300046683 Bacteria 16018
307 Ga0495658_0001321 3300046683 Bacteria 12989
308 Ga0495658_0074834 3300046683 Bacteria 1974
309 Ga0495613_0000972 3300046689 Bacteria 21864
310 Ga0495613_0058535 3300046689 Bacteria 2827
311 Ga0495613_0099194 3300046689 Bacteria 2104
312 Ga0495624_0016018 3300046690 Bacteria 5046
313 Ga0495624_0078843 3300046690 Bacteria 2042
314 Ga0495624_0271949 3300046690 Bacteria 1023
315 Ga0495600_0150408 3300046809 Bacteria 1507
316 Ga0495600_0155654 3300046809 Bacteria 1478
317 Ga0495581_0019678 3300047315 Bacteria 3918
318 Ga0495581_0020552 3300047315 Bacteria 3831
319 Ga0495581_0081170 3300047315 Bacteria 1877
320 Ga0495604_0001814 3300047317 Bacteria 17399
321 Ga0495604_0054858 3300047317 Bacteria 3073
322 Ga0495604_0460629 3300047317 Bacteria 829
323 Ga0495674_0006147 3300047319 Bacteria 11531
324 Ga0495674_0082709 3300047319 Bacteria 2752
325 Ga0495676_0039723 3300047321 Bacteria 3893
326 Ga0495676_0108702 3300047321 Bacteria 2039
327 Ga0495680_0046974 3300047322 Bacteria 3400
328 Ga0495680_0062506 3300047322 Bacteria 2862
329 Ga0495680_0213703 3300047322 Bacteria 1379
330 Ga0495675_0082625 3300047444 Bacteria 2022
331 Ga0495684_0163454 3300047471 Bacteria 1659
332 Ga0495684_0174270 3300047471 Bacteria 1597
333 Ga0495684_0337912 3300047471 Bacteria 1072
334 Ga0495593_0000200 3300047673 Bacteria 31534
335 Ga0495593_0018634 3300047673 Bacteria 3899
336 Ga0495614_0042725 3300048089 Bacteria 1943
337 Ga0495614_0123366 3300048089 Bacteria 1143
338 Ga0496100_0019407 3300048903 Bacteria 4055
339 Ga0496100_0322110 3300048903 Bacteria 1161
340 Ga0496101_0075943 3300048904 Bacteria 2474
341 Ga0496101_0224974 3300048904 Bacteria 1457
342 Ga0496101_0478214 3300048904 Bacteria 983
343 Ga0496102_0137132 3300048905 Bacteria 2293
344 Ga0496102_0248890 3300048905 Bacteria 1675
345 Ga0496102_0396516 3300048905 Bacteria 1298
346 Ga0496103_0004231 3300048906 Bacteria 8715
347 Ga0496104_0007419 3300048907 Bacteria 9689
348 Ga0496104_0051504 3300048907 Bacteria 3885
349 Ga0496105_0023065 3300048908 Bacteria 5046
350 Ga0496105_0030347 3300048908 Bacteria 4429
351 Ga0496105_0293751 3300048908 Bacteria 1308
352 Ga0496106_0020614 3300048909 Bacteria 4893
353 Ga0496106_0070515 3300048909 Bacteria 2669
354 Ga0496107_0302946 3300048910 Bacteria 1189
355 Ga0496108_0214578 3300048911 Bacteria 1671
356 Ga0496109_0121385 3300048912 Bacteria 2435
357 Ga0496109_0186585 3300048912 Bacteria 1948
358 Ga0496110_0270012 3300048913 Bacteria 1549
359 Ga0496111_0657846 3300048914 Bacteria 764
360 Ga0496112_0001827 3300048915 Bacteria 16738
361 Ga0496112_0070181 3300048915 Bacteria 3462
362 Ga0496113_0007432 3300048916 Bacteria 7050
363 Ga0496113_0325814 3300048916 Bacteria 1232
364 Ga0496113_0818764 3300048916 Bacteria 739
365 Ga0496114_0237630 3300048917 Bacteria 1601
366 Ga0496114_0764581 3300048917 Bacteria 844
367 Ga0496115_0034933 3300048918 Bacteria 3974
368 Ga0496115_0048189 3300048918 Bacteria 3408
369 Ga0501043_0312903 3300049579 Bacteria 1198
370 Ga0501072_0238474 3300049588 Bacteria 1448
371 Ga0501075_0214285 3300049591 Bacteria 1469
372 nmdc:mga06r32_87879_c1 3300050510 Bacteria 3033
373 nmdc:mga08y16_172941_c1 3300050511 Bacteria 2243
374 nmdc:mga08y16_516279_c1 3300050511 Unclassified 1212
375 nmdc:mga0n895_1133542_c1 3300050512 Bacteria 758
376 nmdc:mga0rr50_590331_c1 3300050513 Bacteria 947
377 Ga0495601_0006035 3300053077 Bacteria 7066
378 Ga0495612_0034717 3300053078 Bacteria 2042
379 Ga0495595_0074170 3300053084 Bacteria 1612
380 Ga0530510_0332009 3300061734 Unclassified 1141
381 Ga0070709_10000448
382 Ga0070683_100105765
383 Ga0070683_101095149
384 Ga0070690_100689158
385 Ga0070680_100400523
386 Ga0070682_100017028
387 Ga0068868_100190909
388 Ga0070709_10001749
389 Ga0070709_10012735
390 Ga0070709_10030679
391 Ga0070709_10156902
392 Ga0070709_10402272
393 Ga0070714_100000468
394 Ga0070714_100001111
395 Ga0070714_100001869
396 Ga0070714_100001999
397 Ga0070714_100010022
398 Ga0070714_100099516
399 Ga0070714_100549578
400 Ga0070714_100711951
401 Ga0070713_100000493
402 Ga0070713_100001354
403 Ga0070713_100014471
404 Ga0070713_100299400
405 Ga0070713_100359013
406 Ga0070713_100630186
407 Ga0070713_100718745
408 Ga0070710_10000247
409 Ga0070710_10054759
410 Ga0070710_10081128
411 Ga0070710_10099335
412 Ga0070710_10133254
413 Ga0070711_100004008
414 Ga0070711_100011939
415 Ga0070711_100014640
416 Ga0070711_100112184
417 Ga0070705_100213925
418 Ga0070694_100756332
419 Ga0070708_100016579
420 Ga0070708_100022959
421 Ga0070708_100031190
422 Ga0070708_100116634
423 Ga0070663_100212500
424 Ga0070678_100121892
425 Ga0070681_10820917
426 Ga0070707_100068244
427 Ga0070707_100323200
428 Ga0070698_100022208
429 Ga0070698_100087395
430 Ga0070698_100643174
431 Ga0070699_100042016
432 Ga0070679_100689902
433 Ga0070679_101005734
434 Ga0070684_100014651
435 Ga0070684_101183603
436 Ga0070697_100000992
437 Ga0070686_100116737
438 Ga0070696_100117246
439 Ga0070693_100146274
440 Ga0070693_100227552
441 Ga0070665_101355344
442 Ga0070704_100666438
443 Ga0070704_100917313
444 Ga0068856_100242537
445 Ga0068863_100077822
446 Ga0081540_1001484
447 Ga0070717_10019004
448 Ga0070717_10032425
449 Ga0070717_10036668
450 Ga0070717_10089705
451 Ga0070717_10266770
452 Ga0070715_10007405
453 Ga0070715_10027131
454 Ga0070715_10051778
455 Ga0070716_100000820
456 Ga0070716_100001505
457 Ga0070716_100009035
458 Ga0070716_100054158
459 Ga0070712_100018735
460 Ga0070712_100053532
461 Ga0070712_100056082
462 Ga0097621_100379048
463 Ga0097621_100544802
464 Ga0068871_100156771
465 Ga0075431_100100602
466 Ga0075433_10009300
467 Ga0075434_100023597
468 Ga0075434_100518118
469 Ga0075435_100245425
470 Ga0075435_100473642
471 Ga0099795_10129037
472 Ga0111539_10083952
473 Ga0111539_10265256
474 Ga0105245_11024095
475 Ga0105247_10572939
476 Ga0114129_10089580
477 Ga0105243_10086718
478 Ga0105243_10565398
479 Ga0105241_10215814
480 Ga0105241_10543538
481 Ga0105237_10515052
482 Ga0105237_10611595
483 Ga0099796_10079901
484 Ga0157373_10222599
485 Ga0157369_11156583
486 Ga0157374_10213691
487 Ga0157372_10242146
488 Ga0157376_10163754
489 Ga0157376_11024085
490 Ga0207653_10106241
491 Ga0207692_10000414
492 Ga0207692_10003154
493 Ga0207692_10017404
494 Ga0207692_10096839
495 Ga0207710_10325916
496 Ga0207685_10014948
497 Ga0207685_10136703
498 Ga0207685_10168186
499 Ga0207685_10182785
500 Ga0207699_10003553
501 Ga0207699_10009959
502 Ga0207699_10059348
503 Ga0207699_10109099
504 Ga0207699_10160338
505 Ga0207699_10320376
506 Ga0207684_10253528
507 Ga0207684_10685206
508 Ga0207654_10555901
509 Ga0207671_10525643
510 Ga0207693_10004836
511 Ga0207693_10058560
512 Ga0207663_10022209
513 Ga0207663_10036943
514 Ga0207663_10040571
515 Ga0207663_10143939
516 Ga0207652_10895971
517 Ga0207646_10008032
518 Ga0207646_10047485
519 Ga0207646_10195476
520 Ga0207646_10615564
521 Ga0207700_10000433
522 Ga0207700_10000546
523 Ga0207700_10084575
524 Ga0207700_10202813
525 Ga0207700_10266181
526 Ga0207664_10000122
527 Ga0207664_10000387
528 Ga0207664_10001919
529 Ga0207664_10002838
530 Ga0207664_10008072
531 Ga0207664_10217834
532 Ga0207664_10292670
533 Ga0207664_10356462
534 Ga0207664_10681459
535 Ga0207709_10813036
536 Ga0207665_10000052
537 Ga0207665_10009645
538 Ga0207665_10021057
539 Ga0207665_10022646
540 Ga0207665_10641372
541 Ga0207661_10068690
542 Ga0207661_10537585
543 Ga0207677_10224598
544 Ga0207703_10935172
545 Ga0207678_10212224
546 Ga0207702_10015009
547 Ga0207702_10245510
548 Ga0207675_100435003
549 Ga0207683_10004419
550 Ga0265319_1002152
551 Ga0265760_10007455
552 Ga0265760_10079484
553 Ga0307405_10213730
554 Ga0307410_10081548
555 Ga0307412_10524484
556 Ga0307415_100308915
557 Ga0373959_0034407
558 Ga0373926_0005880
559 Ga0373926_0007467
560 Ga0373929_0023821
561 Ga0373934_0016828
562 Ga0373934_0034328
563 Ga0373940_0125063
564 Ga0373944_0003269
565 Ga0373949_0011452
566 Ga0373952_0018191
567 Ga0373923_0009900
568 Ga0373923_0027608
569 Ga0373932_0014529
570 Ga0373936_0002110
571 Ga0373936_0058893
572 Ga0373941_0074951
573 Ga0373945_0001232
574 Ga0373945_0007643
575 Ga0373953_0000973
576 Ga0373953_0007704
577 Ga0373954_0028110
578 Ga0373954_0053403
579 Ga0373956_0011390
580 Ga0373956_0119353
581 Ga0373957_0019740
582 Ga0373957_0058135
583 Ga0373960_0054743
584 Ga0373960_0161924
585 Ga0373943_0001508
586 Ga0373943_0033521
587 Ga0373943_0225291
588 Ga0373946_0002668
589 Ga0373946_0039292
590 Ga0373946_0116780
591 Ga0373955_0129979
592 Ga0373961_0024705
593 Ga0373962_0090120
594 Ga0316574_0601030
595 Ga0373924_0008647
596 Ga0373931_0256402
597 Ga0373935_0027052
598 Ga0373935_0092335
599 Ga0373935_0466843
600 Ga0373927_0111288
601 Ga0373933_0015368
602 Ga0373933_0100098
603 Ga0373947_0018569
604 Ga0373947_0028333
605 Ga0373947_0032349
606 Ga0373947_0096206
607 Ga0373947_0169622
608 Ga0373937_0006304
609 Ga0373937_0072398
610 Ga0373925_0002973
611 Ga0373925_0010385
612 Ga0373925_0117486
613 Ga0373925_0150785
614 Ga0395900_0064493
615 Ga0395898_0011146
616 Ga0395905_0009595
617 Ga0395901_0037311
618 Ga0242420_000239
619 Ga0436362_0365072
620 Ga0451797_1095673
621 Ga0451837_1318211
622 Ga0451839_0955164
623 Ga0451841_0762173
624 Ga0451849_0308856
625 Ga0451843_0729711
626 Ga0439458_0048405
627 Ga0466957_0228587
628 Ga0466958_0115192
629 Ga0466967_0501866
630 Ga0495603_0020084
631 Ga0495603_0027179
632 Ga0495603_0103435
633 Ga0495629_0020299
634 Ga0495629_0031674
635 Ga0495629_0037164
636 Ga0495641_0016178
637 Ga0495641_0040930
638 Ga0495653_0083248
639 Ga0495653_0123161
640 Ga0495580_0015741
641 Ga0495580_0197569
642 Ga0495582_0001550
643 Ga0495582_0005091
644 Ga0495639_0005924
645 Ga0495639_0013775
646 Ga0495662_0032419
647 Ga0495664_0009591
648 Ga0495664_0013553
649 Ga0495664_0033592
650 Ga0495594_0041862
651 Ga0495594_0045341
652 Ga0495594_0083890
653 Ga0495608_0024140
654 Ga0495608_0044893
655 Ga0495618_0000582
656 Ga0495628_0030068
657 Ga0495628_0033406
658 Ga0495630_0016158
659 Ga0495630_0117816
660 Ga0495666_0006535
661 Ga0495652_0072679
662 Ga0495665_0024997
663 Ga0495665_0040492
664 Ga0495665_0140729
665 Ga0495640_0005510
666 Ga0495640_0035111
667 Ga0495586_0019112
668 Ga0495586_0035079
669 Ga0495587_0026159
670 Ga0495645_0029175
671 Ga0495667_0024369
672 Ga0495634_0072188
673 Ga0495634_0091268
674 Ga0495635_0013597
675 Ga0495635_0021846
676 Ga0495588_0012097
677 Ga0495588_0190650
678 Ga0495657_0044616
679 Ga0495657_0079183
680 Ga0495657_0141139
681 Ga0495599_0149587
682 Ga0495623_0031952
683 Ga0495646_0000810
684 Ga0495646_0038132
685 Ga0495647_0022079
686 Ga0495658_0000895
687 Ga0495658_0001321
688 Ga0495658_0074834
689 Ga0495613_0000972
690 Ga0495613_0058535
691 Ga0495613_0099194
692 Ga0495624_0016018
693 Ga0495624_0078843
694 Ga0495624_0271949
695 Ga0495600_0150408
696 Ga0495600_0155654
697 Ga0495581_0019678
698 Ga0495581_0020552
699 Ga0495581_0081170
700 Ga0495604_0001814
701 Ga0495604_0054858
702 Ga0495604_0460629
703 Ga0495674_0006147
704 Ga0495674_0082709
705 Ga0495676_0039723
706 Ga0495676_0108702
707 Ga0495680_0046974
708 Ga0495680_0062506
709 Ga0495680_0213703
710 Ga0495675_0082625
711 Ga0495684_0163454
712 Ga0495684_0174270
713 Ga0495684_0337912
714 Ga0495593_0000200
715 Ga0495593_0018634
716 Ga0495614_0042725
717 Ga0495614_0123366
718 Ga0496100_0019407
719 Ga0496100_0322110
720 Ga0496101_0075943
721 Ga0496101_0224974
722 Ga0496101_0478214
723 Ga0496102_0137132
724 Ga0496102_0248890
725 Ga0496102_0396516
726 Ga0496103_0004231
727 Ga0496104_0007419
728 Ga0496104_0051504
729 Ga0496105_0023065
730 Ga0496105_0030347
731 Ga0496105_0293751
732 Ga0496106_0020614
733 Ga0496106_0070515
734 Ga0496107_0302946
735 Ga0496108_0214578
736 Ga0496109_0121385
737 Ga0496109_0186585
738 Ga0496110_0270012
739 Ga0496111_0657846
740 Ga0496112_0001827
741 Ga0496112_0070181
742 Ga0496113_0007432
743 Ga0496113_0325814
744 Ga0496113_0818764
745 Ga0496114_0237630
746 Ga0496114_0764581
747 Ga0496115_0034933
748 Ga0496115_0048189
749 Ga0501043_0312903
750 Ga0501072_0238474
751 Ga0501075_0214285
752 nmdc:mga06r32_87879_c1
753 nmdc:mga08y16_172941_c1
754 nmdc:mga08y16_516279_c1
755 nmdc:mga0n895_1133542_c1
756 nmdc:mga0rr50_590331_c1
757 Ga0495601_0006035
758 Ga0495612_0034717
759 Ga0495595_0074170
760 Ga0530510_0332009

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF14333

DUF4389

Domain of unknown function (DUF4389)

144

218

0.93

Map