F428536

General Info

Members Datasets Scaffolds Average Seq Length
380 229 760 337

Family's Representative Sequence

Representative Sequence 3300003578|Ga0006562J51391_1043687|Ga0006562J51391_10436872
Length 369
Sequence MSRPQPSTRTSSGVSVPNVQLRPALATLAVVLSISAAAAPAGAKPAAGVTTGSGLVFKVNPVQSSGDESLVDAKDSASAVPSSEYATVPLRNLDGSGYLRGRWVTVESATGTPAYSATGVYNYNRKDDQFEQVMAYFWVNQAQEYIQSLGFGSTLRPVVKRSFSVKIDQYGGDNSYQTDKPYRIRLGKGGVDDAEDAEVIVHEYGHAVHASQVPGYGTSLDAGSIGEAWGDYLAVSVGLDAAEEYGWPVQAPEACVMDWDSTSYTSGPVHCLRRLDTDLTVADRKGEVHYDGQIWSRGLWDARAGYEALGLTSRDFDTTVIDAQFDFAPDTSFDAAATAIYDKALVRDGAAAADVVKEAFAARGIVVTP

Samples

Sample ID Description Type Environment
1 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
4 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
5 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
10 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
11 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
12 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
13 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
14 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
15 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
16 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
19 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
20 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
21 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
22 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
23 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
24 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
25 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
26 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
27 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
28 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
29 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
30 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
31 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
32 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
33 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
34 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
35 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
36 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
37 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
38 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
39 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
40 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
41 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
42 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
43 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
44 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
45 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
46 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
47 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
48 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
49 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
50 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
51 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
52 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
53 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
54 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
55 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
56 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
57 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
58 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
59 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
60 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
61 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
62 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
63 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
64 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
65 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
66 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
67 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
68 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
71 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
72 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
73 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
74 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
75 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
76 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
77 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
78 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
79 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
80 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
81 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
82 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
83 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
84 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
85 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
90 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
91 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
92 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
93 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
94 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
95 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
96 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
97 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
98 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
99 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
100 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
145 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
148 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
149 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
150 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
151 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
152 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
153 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
154 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
155 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
156 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
157 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
158 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
159 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
160 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
161 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
162 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
163 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
164 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
165 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
166 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
167 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
168 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
169 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
170 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
171 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
172 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
173 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
174 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
175 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
176 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
177 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
178 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
179 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
180 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
181 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
182 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
183 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
184 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
185 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
186 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
187 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
188 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
189 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
190 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
191 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
192 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
193 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
194 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
195 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
196 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
197 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
198 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
199 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
200 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
201 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
202 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
203 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
204 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
205 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
206 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
207 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
208 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
209 2643221567 Phycicoccus sp. Root563 Isolate Unclassified
210 2643221576 Nocardioides sp. Root614 Isolate Unclassified
211 2643221590 Nocardioides sp. Root682 Isolate Unclassified
212 2643221617 Nocardioides sp. Root79 Isolate Unclassified
213 2643221620 Nocardioides sp. Root240 Isolate Unclassified
214 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
215 2738541305 Nocardioides sp. CF167 Isolate Unclassified
216 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
217 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
218 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
219 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
220 2818991318 Humibacillus xanthopallidus SLBN-155 Isolate Unclassified
221 2818991458 Terrabacter sp. 3211 Isolate Rhizosphere
222 2818991462 Terrabacter sp. 3264 Isolate Rhizosphere
223 2818991469 Terrabacter lapilli 3265 Isolate Rhizosphere
224 2858868258 Micromonospora sp. MH33 Isolate Unclassified
225 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
226 2902582711 Micromonospora sp. AP08 Isolate Unclassified
227 2919446982 Phycicoccus sp. 3266 Isolate Rhizosphere
228 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
229 8055172936 Sphaerisporangium perillae NEAU-ZS1 Isolate Unclassified

Type Distribution

Type Percentage (%)
Metagenomes 93.42
Metatranscriptomes 0.79
Isolates 5.79

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.58
Nodule 0
Rhizoplane 11.32
Rhizosphere 82.11
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0006562J51391_1043687 3300003578 Bacteria 1630
2 JGI24739J22299_10000936 3300001989 Bacteria 10868
3 JGI24737J22298_10006173 3300001990 Bacteria 4102
4 JGI24743J22301_10002929 3300001991 Bacteria 2641
5 rootH1_10023263 3300003316 Bacteria 4582
6 Ga0070683_100002574 3300005329 Bacteria 14500
7 Ga0070666_10037519 3300005335 Bacteria 3222
8 Ga0070680_100112202 3300005336 Bacteria 2270
9 Ga0070680_100282595 3300005336 Bacteria 1406
10 Ga0070682_100022600 3300005337 Bacteria 3727
11 Ga0068868_100011392 3300005338 Bacteria 6475
12 Ga0068868_100025732 3300005338 Bacteria 4479
13 Ga0068868_100058283 3300005338 Bacteria 3052
14 Ga0070660_100039731 3300005339 Bacteria 3577
15 Ga0070660_100121451 3300005339 Bacteria 2085
16 Ga0070691_10027590 3300005341 Bacteria 2650
17 Ga0070687_100019389 3300005343 Bacteria 3163
18 Ga0070692_10005752 3300005345 Bacteria 5325
19 Ga0070668_100141932 3300005347 Bacteria 1936
20 Ga0070669_100032913 3300005353 Bacteria 3747
21 Ga0070675_100140373 3300005354 Bacteria 2065
22 Ga0070673_100037863 3300005364 Bacteria 3679
23 Ga0070673_100261991 3300005364 Bacteria 1511
24 Ga0070659_100040425 3300005366 Bacteria 3644
25 Ga0070659_100057087 3300005366 Bacteria 3077
26 Ga0070659_100092445 3300005366 Bacteria 2426
27 Ga0070714_100000008 3300005435 Bacteria 278734
28 Ga0070711_100004096 3300005439 Bacteria 8571
29 Ga0070705_100302345 3300005440 Bacteria 1147
30 Ga0070700_100000007 3300005441 Bacteria 198866
31 Ga0070700_100021918 3300005441 Bacteria 3718
32 Ga0070694_100021142 3300005444 Bacteria 4155
33 Ga0070663_100026903 3300005455 Bacteria 3901
34 Ga0070663_100107334 3300005455 Bacteria 2093
35 Ga0070678_100047203 3300005456 Bacteria 3093
36 Ga0070662_100017510 3300005457 Bacteria 4832
37 Ga0070662_100259717 3300005457 Bacteria 1399
38 Ga0068867_100009302 3300005459 Bacteria 6931
39 Ga0070684_100098038 3300005535 Bacteria 2615
40 Ga0070684_100371452 3300005535 Bacteria 1317
41 Ga0070684_100484701 3300005535 Bacteria 1145
42 Ga0068853_100039654 3300005539 Bacteria 4017
43 Ga0068853_100232728 3300005539 Bacteria 1686
44 Ga0070686_100122908 3300005544 Bacteria 1784
45 Ga0070695_100041354 3300005545 Bacteria 2921
46 Ga0070696_100035633 3300005546 Bacteria 3427
47 Ga0070665_100069304 3300005548 Bacteria 3534
48 Ga0070704_100045532 3300005549 Bacteria 3053
49 Ga0070704_100095577 3300005549 Bacteria 2226
50 Ga0068855_100009049 3300005563 Bacteria 12032
51 Ga0068855_100089418 3300005563 Bacteria 3555
52 Ga0070664_100012248 3300005564 Bacteria 6969
53 Ga0070664_100074347 3300005564 Bacteria 2917
54 Ga0068857_100052447 3300005577 Bacteria 3619
55 Ga0068857_100134769 3300005577 Bacteria 2230
56 Ga0068854_100042222 3300005578 Bacteria 3227
57 Ga0068856_100041154 3300005614 Bacteria 4540
58 Ga0068856_100180252 3300005614 Bacteria 2125
59 Ga0070702_100010863 3300005615 Bacteria 4506
60 Ga0070702_100020321 3300005615 Bacteria 3476
61 Ga0070702_100043978 3300005615 Bacteria 2519
62 Ga0068852_100050000 3300005616 Bacteria 3579
63 Ga0068852_100052526 3300005616 Bacteria 3503
64 Ga0068859_100010572 3300005617 Bacteria 9293
65 Ga0068859_100066921 3300005617 Bacteria 3628
66 Ga0068864_100034086 3300005618 Bacteria 4329
67 Ga0068866_10029247 3300005718 Bacteria 2633
68 Ga0068861_100038593 3300005719 Bacteria 3559
69 Ga0068861_100056165 3300005719 Bacteria 3004
70 Ga0068851_10053070 3300005834 Bacteria 2063
71 Ga0068851_10093759 3300005834 Bacteria 1585
72 Ga0068870_10028112 3300005840 Bacteria 2820
73 Ga0068863_100037610 3300005841 Bacteria 4608
74 Ga0068858_100222315 3300005842 Bacteria 1789
75 Ga0068860_100000696 3300005843 Bacteria 38651
76 Ga0068862_100310340 3300005844 Bacteria 1454
77 Ga0081540_1000905 3300005983 Bacteria 26763
78 Ga0081540_1000964 3300005983 Bacteria 25975
79 Ga0081540_1003321 3300005983 Bacteria 12754
80 Ga0081539_10005383 3300005985 Bacteria 13100
81 Ga0081539_10088289 3300005985 Bacteria 1609
82 Ga0081539_10104461 3300005985 Bacteria 1437
83 Ga0070717_10173826 3300006028 Bacteria 1874
84 Ga0075365_10015812 3300006038 Bacteria 4571
85 Ga0075365_10035088 3300006038 Bacteria 3243
86 Ga0075364_10029684 3300006051 Bacteria 3507
87 Ga0075364_10036387 3300006051 Bacteria 3182
88 Ga0070716_100084617 3300006173 Bacteria 1903
89 Ga0070712_100048102 3300006175 Bacteria 2955
90 Ga0097621_100029088 3300006237 Bacteria 4361
91 Ga0068871_100076954 3300006358 Bacteria 2757
92 Ga0075428_100000071 3300006844 Bacteria 82288
93 Ga0075428_100069121 3300006844 Bacteria 3863
94 Ga0075428_100319723 3300006844 Bacteria 1668
95 Ga0075428_100504774 3300006844 Bacteria 1294
96 Ga0075430_100048191 3300006846 Bacteria 3597
97 Ga0075433_10024125 3300006852 Bacteria 5129
98 Ga0075434_100082110 3300006871 Bacteria 3220
99 Ga0075429_100074824 3300006880 Bacteria 2950
100 Ga0075429_100185699 3300006880 Bacteria 1822
101 Ga0075429_100344700 3300006880 Bacteria 1304
102 Ga0068865_100001007 3300006881 Bacteria 16180
103 Ga0068865_100062804 3300006881 Bacteria 2608
104 Ga0068865_100085731 3300006881 Bacteria 2272
105 Ga0097620_100010572 3300006931 Bacteria 9293
106 Ga0097620_100066928 3300006931 Bacteria 3628
107 Ga0075435_100034191 3300007076 Bacteria 4025
108 Ga0105240_10048274 3300009093 Bacteria 5382
109 Ga0105240_10048644 3300009093 Bacteria 5358
110 Ga0105240_10057090 3300009093 Bacteria 4880
111 Ga0111539_10075308 3300009094 Bacteria 3976
112 Ga0111539_10816720 3300009094 Bacteria 1085
113 Ga0105245_10044877 3300009098 Bacteria 3945
114 Ga0105245_10261387 3300009098 Bacteria 1685
115 Ga0105245_10281408 3300009098 Bacteria 1626
116 Ga0105247_10007552 3300009101 Bacteria 6661
117 Ga0105247_10016110 3300009101 Bacteria 4478
118 Ga0114129_10021110 3300009147 Bacteria 9247
119 Ga0114129_10214577 3300009147 Bacteria 2599
120 Ga0114129_10254617 3300009147 Bacteria 2355
121 Ga0105243_10016153 3300009148 Bacteria 5647
122 Ga0105243_10021639 3300009148 Bacteria 4882
123 Ga0105243_10023226 3300009148 Bacteria 4720
124 Ga0105243_10190610 3300009148 Bacteria 1790
125 Ga0105243_10470662 3300009148 Bacteria 1184
126 Ga0105241_10077919 3300009174 Bacteria 2589
127 Ga0105242_10212674 3300009176 Bacteria 1724
128 Ga0105248_10014374 3300009177 Bacteria 8712
129 Ga0105248_10082718 3300009177 Bacteria 3611
130 Ga0105248_10113467 3300009177 Bacteria 3056
131 Ga0105248_10187485 3300009177 Bacteria 2331
132 Ga0105237_10053183 3300009545 Bacteria 4062
133 Ga0105238_10065116 3300009551 Bacteria 3645
134 Ga0105238_10113992 3300009551 Bacteria 2683
135 Ga0105249_10010951 3300009553 Bacteria 7971
136 Ga0105249_10016947 3300009553 Bacteria 6464
137 Ga0105239_10017056 3300010375 Bacteria 8028
138 Ga0105239_10029749 3300010375 Bacteria 6005
139 Ga0105239_10151384 3300010375 Bacteria 2589
140 Ga0105239_10211321 3300010375 Bacteria 2175
141 Ga0105246_10041435 3300011119 Bacteria 3112
142 Ga0105246_10265015 3300011119 Bacteria 1371
143 Ga0157370_10015495 3300013104 Bacteria 7751
144 Ga0157370_10057668 3300013104 Bacteria 3691
145 Ga0157370_10082952 3300013104 Bacteria 3014
146 Ga0157369_10009702 3300013105 Bacteria 11009
147 Ga0157369_10015464 3300013105 Bacteria 8598
148 Ga0157374_10208598 3300013296 Bacteria 1915
149 Ga0157378_10132723 3300013297 Bacteria 2307
150 Ga0157378_10616499 3300013297 Bacteria 1098
151 Ga0163162_10021416 3300013306 Bacteria 6366
152 Ga0157372_10000175 3300013307 Bacteria 71177
153 Ga0157372_10047529 3300013307 Bacteria 4769
154 Ga0157372_10070973 3300013307 Bacteria 3921
155 Ga0157372_10087813 3300013307 Bacteria 3529
156 Ga0157372_10363189 3300013307 Bacteria 1687
157 Ga0157375_10127312 3300013308 Bacteria 2663
158 Ga0163163_10066208 3300014325 Bacteria 3588
159 Ga0157380_10035781 3300014326 Bacteria 3837
160 Ga0157380_10116785 3300014326 Bacteria 2253
161 Ga0157380_10160140 3300014326 Bacteria 1955
162 Ga0157377_10022243 3300014745 Bacteria 3345
163 Ga0157379_10209977 3300014968 Bacteria 1762
164 Ga0157376_10057406 3300014969 Bacteria 3256
165 Ga0163161_10003917 3300017792 Bacteria 10441
166 Ga0163161_10168177 3300017792 Bacteria 1675
167 Ga0206353_11959871 3300020082 Bacteria 3885
168 Ga0224712_10115796 3300022467 Bacteria 1155
169 Ga0207653_10006719 3300025885 Bacteria 3593
170 Ga0207642_10043933 3300025899 Bacteria 1974
171 Ga0207688_10006687 3300025901 Bacteria 6274
172 Ga0207688_10008385 3300025901 Bacteria 5621
173 Ga0207688_10009939 3300025901 Bacteria 5176
174 Ga0207647_10014038 3300025904 Bacteria 5539
175 Ga0207647_10108870 3300025904 Bacteria 1639
176 Ga0207643_10007206 3300025908 Bacteria 5970
177 Ga0207707_10291846 3300025912 Bacteria 1411
178 Ga0207695_10057762 3300025913 Bacteria 4030
179 Ga0207671_10090675 3300025914 Bacteria 2302
180 Ga0207693_10006371 3300025915 Bacteria 9779
181 Ga0207693_10013682 3300025915 Bacteria 6536
182 Ga0207693_10014145 3300025915 Bacteria 6426
183 Ga0207663_10009744 3300025916 Bacteria 5085
184 Ga0207662_10038662 3300025918 Bacteria 2796
185 Ga0207662_10042749 3300025918 Bacteria 2672
186 Ga0207657_10015898 3300025919 Bacteria 7270
187 Ga0207649_10227984 3300025920 Bacteria 1331
188 Ga0207694_10024767 3300025924 Bacteria 4559
189 Ga0207687_10079422 3300025927 Bacteria 2366
190 Ga0207664_10000002 3300025929 Bacteria 657053
191 Ga0207644_10101747 3300025931 Bacteria 2160
192 Ga0207644_10160026 3300025931 Bacteria 1750
193 Ga0207690_10048308 3300025932 Bacteria 2829
194 Ga0207706_10027410 3300025933 Bacteria 5093
195 Ga0207686_10065586 3300025934 Bacteria 2316
196 Ga0207709_10028352 3300025935 Bacteria 3237
197 Ga0207709_10063193 3300025935 Bacteria 2320
198 Ga0207709_10096944 3300025935 Bacteria 1941
199 Ga0207709_10106603 3300025935 Bacteria 1864
200 Ga0207709_10232229 3300025935 Bacteria 1337
201 Ga0207670_10100007 3300025936 Bacteria 2070
202 Ga0207669_10003700 3300025937 Bacteria 6652
203 Ga0207704_10053006 3300025938 Bacteria 2462
204 Ga0207665_10000395 3300025939 Bacteria 29961
205 Ga0207691_10003397 3300025940 Bacteria 15481
206 Ga0207691_10060098 3300025940 Bacteria 3455
207 Ga0207711_10133533 3300025941 Bacteria 2227
208 Ga0207689_10131830 3300025942 Bacteria 2057
209 Ga0207689_10182793 3300025942 Bacteria 1729
210 Ga0207661_10145577 3300025944 Bacteria 2044
211 Ga0207679_10207607 3300025945 Bacteria 1640
212 Ga0207667_10036613 3300025949 Bacteria 5256
213 Ga0207667_10227922 3300025949 Bacteria 1908
214 Ga0207712_10021181 3300025961 Bacteria 4265
215 Ga0207668_10017260 3300025972 Bacteria 4519
216 Ga0207677_10007924 3300026023 Bacteria 5907
217 Ga0207703_10085035 3300026035 Bacteria 2646
218 Ga0207703_10303273 3300026035 Bacteria 1457
219 Ga0207703_10318952 3300026035 Bacteria 1423
220 Ga0207639_10064171 3300026041 Bacteria 2846
221 Ga0207639_10174209 3300026041 Bacteria 1825
222 Ga0207678_10030276 3300026067 Bacteria 4725
223 Ga0207678_10031340 3300026067 Bacteria 4638
224 Ga0207678_10096654 3300026067 Bacteria 2524
225 Ga0207708_10000006 3300026075 Bacteria 266916
226 Ga0207708_10000180 3300026075 Bacteria 49555
227 Ga0207708_10152763 3300026075 Bacteria 1819
228 Ga0207708_10171328 3300026075 Bacteria 1719
229 Ga0207702_10052974 3300026078 Bacteria 3435
230 Ga0207641_10032517 3300026088 Bacteria 4331
231 Ga0207648_10005348 3300026089 Bacteria 12943
232 Ga0207648_10014668 3300026089 Bacteria 7235
233 Ga0207676_10034851 3300026095 Bacteria 3814
234 Ga0207676_10102366 3300026095 Bacteria 2377
235 Ga0207674_10149807 3300026116 Bacteria 2290
236 Ga0207674_10174894 3300026116 Bacteria 2099
237 Ga0207675_100002352 3300026118 Bacteria 18701
238 Ga0207675_100006710 3300026118 Bacteria 10882
239 Ga0207698_10055218 3300026142 Bacteria 3059
240 Ga0207698_10062220 3300026142 Bacteria 2913
241 Ga0207428_10063049 3300027907 Bacteria 2929
242 Ga0207428_10065133 3300027907 Bacteria 2876
243 Ga0268265_10109853 3300028380 Bacteria 2249
244 Ga0268265_10157125 3300028380 Bacteria 1926
245 Ga0268264_10000697 3300028381 Bacteria 39075
246 Ga0307406_10208465 3300031901 Bacteria 1444
247 Ga0307412_10244588 3300031911 Bacteria 1390
248 Ga0307409_100109291 3300031995 Bacteria 2315
249 Ga0307415_100395963 3300032126 Bacteria 1177
250 Ga0373932_0021186 3300035112 Bacteria 1714
251 Ga0373939_0025792 3300035114 Bacteria 1651
252 Ga0373942_0004569 3300035207 Bacteria 3209
253 Ga0373931_0113463 3300035691 Bacteria 1540
254 Ga0395899_0001284 3300037312 Bacteria 21770
255 Ga0395899_0021072 3300037312 Bacteria 4943
256 Ga0395900_0032799 3300037418 Bacteria 5342
257 Ga0395900_0556303 3300037418 Bacteria 1091
258 Ga0395898_0169152 3300037466 Bacteria 2089
259 Ga0395898_0299421 3300037466 Bacteria 1534
260 Ga0395905_0034756 3300037471 Bacteria 4733
261 Ga0395901_0035057 3300038443 Bacteria 5185
262 Ga0395901_0110227 3300038443 Bacteria 2890
263 Ga0395901_0133910 3300038443 Bacteria 2604
264 Ga0395901_0651783 3300038443 Bacteria 1056
265 Ga0439464_0027794 3300042439 Bacteria 1574
266 Ga0466972_0009996 3300044658 Bacteria 4765
267 Ga0466972_0039777 3300044658 Bacteria 2294
268 Ga0466965_0005796 3300044683 Bacteria 5574
269 Ga0466966_0007611 3300044684 Bacteria 7176
270 Ga0466966_0034622 3300044684 Bacteria 3265
271 Ga0466961_0017219 3300044693 Bacteria 4642
272 Ga0466961_0130871 3300044693 Bacteria 1573
273 Ga0466963_0018951 3300044694 Bacteria 4308
274 Ga0466963_0028044 3300044694 Bacteria 3611
275 Ga0466968_0077639 3300044735 Bacteria 1455
276 Ga0466968_0100275 3300044735 Bacteria 1292
277 Ga0466970_0025139 3300044765 Bacteria 3117
278 Ga0466970_0044503 3300044765 Bacteria 2363
279 Ga0466970_0046408 3300044765 Bacteria 2314
280 Ga0466957_0014042 3300044842 Bacteria 4658
281 Ga0466957_0021037 3300044842 Bacteria 3841
282 Ga0466957_0025601 3300044842 Bacteria 3497
283 Ga0466960_0078267 3300044901 Bacteria 1660
284 Ga0466959_0198222 3300045049 Bacteria 1399
285 Ga0466958_0053200 3300045836 Bacteria 2455
286 Ga0466958_0096441 3300045836 Bacteria 1834
287 Ga0466967_0000813 3300045976 Bacteria 16370
288 Ga0466967_0012586 3300045976 Bacteria 6483
289 Ga0466967_0019182 3300045976 Bacteria 5492
290 Ga0466967_0098852 3300045976 Bacteria 2665
291 Ga0466967_0101741 3300045976 Bacteria 2627
292 Ga0495629_0118336 3300046459 Bacteria 1846
293 Ga0495641_0015743 3300046461 Bacteria 4017
294 Ga0495653_0205722 3300046463 Bacteria 1333
295 Ga0495634_0122356 3300046642 Bacteria 1666
296 Ga0495635_0293483 3300046663 Bacteria 1091
297 Ga0495676_0103519 3300047321 Bacteria 2102
298 Ga0496100_0114849 3300048903 Bacteria 1876
299 Ga0496101_0061373 3300048904 Bacteria 2730
300 Ga0496101_0089708 3300048904 Bacteria 2285
301 Ga0496102_0000029 3300048905 Bacteria 222195
302 Ga0496102_0000908 3300048905 Bacteria 28014
303 Ga0496102_0071506 3300048905 Bacteria 3185
304 Ga0496102_0149725 3300048905 Bacteria 2192
305 Ga0496102_0151342 3300048905 Bacteria 2180
306 Ga0496102_0272219 3300048905 Bacteria 1597
307 Ga0496103_0000143 3300048906 Bacteria 74753
308 Ga0496103_0003639 3300048906 Bacteria 9384
309 Ga0496104_0058727 3300048907 Bacteria 3641
310 Ga0496104_0155826 3300048907 Bacteria 2192
311 Ga0496105_0077118 3300048908 Bacteria 2752
312 Ga0496106_0217773 3300048909 Bacteria 1522
313 Ga0496107_0080118 3300048910 Bacteria 2381
314 Ga0496108_0013238 3300048911 Bacteria 6723
315 Ga0496108_0021326 3300048911 Bacteria 5325
316 Ga0496108_0043561 3300048911 Bacteria 3749
317 Ga0496108_0056213 3300048911 Bacteria 3305
318 Ga0496108_0220135 3300048911 Bacteria 1649
319 Ga0496108_0264591 3300048911 Bacteria 1496
320 Ga0496108_0341674 3300048911 Bacteria 1306
321 Ga0496109_0043255 3300048912 Bacteria 4082
322 Ga0496109_0103145 3300048912 Bacteria 2647
323 Ga0496109_0119475 3300048912 Bacteria 2454
324 Ga0496109_0132775 3300048912 Bacteria 2325
325 Ga0496109_0187996 3300048912 Bacteria 1940
326 Ga0496109_0304496 3300048912 Bacteria 1503
327 Ga0496110_0065450 3300048913 Bacteria 3213
328 Ga0496110_0083982 3300048913 Bacteria 2842
329 Ga0496111_0029352 3300048914 Bacteria 3906
330 Ga0496111_0106982 3300048914 Bacteria 2059
331 Ga0496111_0388376 3300048914 Bacteria 1032
332 Ga0496112_0044198 3300048915 Bacteria 4364
333 Ga0496112_0087680 3300048915 Bacteria 3079
334 Ga0496112_0138839 3300048915 Bacteria 2400
335 Ga0496113_0004333 3300048916 Bacteria 8695
336 Ga0496113_0062184 3300048916 Bacteria 2819
337 Ga0496113_0076623 3300048916 Bacteria 2555
338 Ga0496114_0008882 3300048917 Bacteria 7966
339 Ga0496114_0043243 3300048917 Bacteria 3735
340 Ga0496114_0276902 3300048917 Bacteria 1479
341 Ga0501067_0043003 3300049583 Bacteria 2509
342 Ga0501070_0048156 3300049586 Bacteria 3541
343 Ga0501044_0470086 3300049823 Bacteria 1162
344 nmdc:mga0yw44_122900_c1 3300050492 Bacteria 1674
345 nmdc:mga0yw44_131371_c1 3300050492 Bacteria 1621
346 nmdc:mga05p37_655459_c1 3300050507 Bacteria 1175
347 nmdc:mga09592_184885_c1 3300050508 Bacteria 1803
348 nmdc:mga09592_352457_c1 3300050508 Bacteria 1274
349 nmdc:mga0qj67_121883_c1 3300050509 Bacteria 2109
350 nmdc:mga06r32_13850_c1 3300050510 Bacteria 7316
351 nmdc:mga08y16_105034_c1 3300050511 Bacteria 2941
352 nmdc:mga0n895_219061_c1 3300050512 Bacteria 1932
353 nmdc:mga0rr50_88511_c1 3300050513 Bacteria 2406
354 nmdc:mga08x19_44283_c1 3300050514 Bacteria 2841
355 nmdc:mga0a205_23870_c1 3300050515 Bacteria 5804
356 Ga0466962_0011100 3300061719 Bacteria 4335
357 Ga0466962_0028874 3300061719 Bacteria 2656
358 Ga0466962_0069308 3300061719 Bacteria 1684
359 2623589596 2622736626 Bacteria 7181580
360 2643853172 2643221567 Bacteria 4163945
361 2643893022 2643221576 Bacteria 5214352
362 2643961919 2643221590 Bacteria 5214697
363 2644098294 2643221617 Bacteria 5139111
364 2644118979 2643221620 Bacteria 5134593
365 2644137155 2643221624 Bacteria 4384879
366 2738869273 2738541305 Bacteria 4910150
367 2774392236 2773857762 Bacteria 5971770
368 2809196036 2808606439 Bacteria 5952208
369 2812331358 2811994874 Bacteria 5367947
370 2812351827 2811994878 Bacteria 5992952
371 2819424818 2818991318 Bacteria 5266538
372 2819667645 2818991458 Bacteria 4794049
373 2819690942 2818991462 Bacteria 4320267
374 2819727715 2818991469 Bacteria 4644110
375 2858870925 2858868258 Bacteria 7683772
376 2891970543 2891968417 Bacteria 5821697
377 2902583171 2902582711 Bacteria 6187705
378 2919450799 2919446982 Bacteria 3994487
379 2996225022 2996221748 Bacteria 6799777
380 8055178466 8055172936 Bacteria 9305943
381 Ga0006562J51391_1043687
382 JGI24739J22299_10000936
383 JGI24737J22298_10006173
384 JGI24743J22301_10002929
385 rootH1_10023263
386 Ga0070683_100002574
387 Ga0070666_10037519
388 Ga0070680_100112202
389 Ga0070680_100282595
390 Ga0070682_100022600
391 Ga0068868_100011392
392 Ga0068868_100025732
393 Ga0068868_100058283
394 Ga0070660_100039731
395 Ga0070660_100121451
396 Ga0070691_10027590
397 Ga0070687_100019389
398 Ga0070692_10005752
399 Ga0070668_100141932
400 Ga0070669_100032913
401 Ga0070675_100140373
402 Ga0070673_100037863
403 Ga0070673_100261991
404 Ga0070659_100040425
405 Ga0070659_100057087
406 Ga0070659_100092445
407 Ga0070714_100000008
408 Ga0070711_100004096
409 Ga0070705_100302345
410 Ga0070700_100000007
411 Ga0070700_100021918
412 Ga0070694_100021142
413 Ga0070663_100026903
414 Ga0070663_100107334
415 Ga0070678_100047203
416 Ga0070662_100017510
417 Ga0070662_100259717
418 Ga0068867_100009302
419 Ga0070684_100098038
420 Ga0070684_100371452
421 Ga0070684_100484701
422 Ga0068853_100039654
423 Ga0068853_100232728
424 Ga0070686_100122908
425 Ga0070695_100041354
426 Ga0070696_100035633
427 Ga0070665_100069304
428 Ga0070704_100045532
429 Ga0070704_100095577
430 Ga0068855_100009049
431 Ga0068855_100089418
432 Ga0070664_100012248
433 Ga0070664_100074347
434 Ga0068857_100052447
435 Ga0068857_100134769
436 Ga0068854_100042222
437 Ga0068856_100041154
438 Ga0068856_100180252
439 Ga0070702_100010863
440 Ga0070702_100020321
441 Ga0070702_100043978
442 Ga0068852_100050000
443 Ga0068852_100052526
444 Ga0068859_100010572
445 Ga0068859_100066921
446 Ga0068864_100034086
447 Ga0068866_10029247
448 Ga0068861_100038593
449 Ga0068861_100056165
450 Ga0068851_10053070
451 Ga0068851_10093759
452 Ga0068870_10028112
453 Ga0068863_100037610
454 Ga0068858_100222315
455 Ga0068860_100000696
456 Ga0068862_100310340
457 Ga0081540_1000905
458 Ga0081540_1000964
459 Ga0081540_1003321
460 Ga0081539_10005383
461 Ga0081539_10088289
462 Ga0081539_10104461
463 Ga0070717_10173826
464 Ga0075365_10015812
465 Ga0075365_10035088
466 Ga0075364_10029684
467 Ga0075364_10036387
468 Ga0070716_100084617
469 Ga0070712_100048102
470 Ga0097621_100029088
471 Ga0068871_100076954
472 Ga0075428_100000071
473 Ga0075428_100069121
474 Ga0075428_100319723
475 Ga0075428_100504774
476 Ga0075430_100048191
477 Ga0075433_10024125
478 Ga0075434_100082110
479 Ga0075429_100074824
480 Ga0075429_100185699
481 Ga0075429_100344700
482 Ga0068865_100001007
483 Ga0068865_100062804
484 Ga0068865_100085731
485 Ga0097620_100010572
486 Ga0097620_100066928
487 Ga0075435_100034191
488 Ga0105240_10048274
489 Ga0105240_10048644
490 Ga0105240_10057090
491 Ga0111539_10075308
492 Ga0111539_10816720
493 Ga0105245_10044877
494 Ga0105245_10261387
495 Ga0105245_10281408
496 Ga0105247_10007552
497 Ga0105247_10016110
498 Ga0114129_10021110
499 Ga0114129_10214577
500 Ga0114129_10254617
501 Ga0105243_10016153
502 Ga0105243_10021639
503 Ga0105243_10023226
504 Ga0105243_10190610
505 Ga0105243_10470662
506 Ga0105241_10077919
507 Ga0105242_10212674
508 Ga0105248_10014374
509 Ga0105248_10082718
510 Ga0105248_10113467
511 Ga0105248_10187485
512 Ga0105237_10053183
513 Ga0105238_10065116
514 Ga0105238_10113992
515 Ga0105249_10010951
516 Ga0105249_10016947
517 Ga0105239_10017056
518 Ga0105239_10029749
519 Ga0105239_10151384
520 Ga0105239_10211321
521 Ga0105246_10041435
522 Ga0105246_10265015
523 Ga0157370_10015495
524 Ga0157370_10057668
525 Ga0157370_10082952
526 Ga0157369_10009702
527 Ga0157369_10015464
528 Ga0157374_10208598
529 Ga0157378_10132723
530 Ga0157378_10616499
531 Ga0163162_10021416
532 Ga0157372_10000175
533 Ga0157372_10047529
534 Ga0157372_10070973
535 Ga0157372_10087813
536 Ga0157372_10363189
537 Ga0157375_10127312
538 Ga0163163_10066208
539 Ga0157380_10035781
540 Ga0157380_10116785
541 Ga0157380_10160140
542 Ga0157377_10022243
543 Ga0157379_10209977
544 Ga0157376_10057406
545 Ga0163161_10003917
546 Ga0163161_10168177
547 Ga0206353_11959871
548 Ga0224712_10115796
549 Ga0207653_10006719
550 Ga0207642_10043933
551 Ga0207688_10006687
552 Ga0207688_10008385
553 Ga0207688_10009939
554 Ga0207647_10014038
555 Ga0207647_10108870
556 Ga0207643_10007206
557 Ga0207707_10291846
558 Ga0207695_10057762
559 Ga0207671_10090675
560 Ga0207693_10006371
561 Ga0207693_10013682
562 Ga0207693_10014145
563 Ga0207663_10009744
564 Ga0207662_10038662
565 Ga0207662_10042749
566 Ga0207657_10015898
567 Ga0207649_10227984
568 Ga0207694_10024767
569 Ga0207687_10079422
570 Ga0207664_10000002
571 Ga0207644_10101747
572 Ga0207644_10160026
573 Ga0207690_10048308
574 Ga0207706_10027410
575 Ga0207686_10065586
576 Ga0207709_10028352
577 Ga0207709_10063193
578 Ga0207709_10096944
579 Ga0207709_10106603
580 Ga0207709_10232229
581 Ga0207670_10100007
582 Ga0207669_10003700
583 Ga0207704_10053006
584 Ga0207665_10000395
585 Ga0207691_10003397
586 Ga0207691_10060098
587 Ga0207711_10133533
588 Ga0207689_10131830
589 Ga0207689_10182793
590 Ga0207661_10145577
591 Ga0207679_10207607
592 Ga0207667_10036613
593 Ga0207667_10227922
594 Ga0207712_10021181
595 Ga0207668_10017260
596 Ga0207677_10007924
597 Ga0207703_10085035
598 Ga0207703_10303273
599 Ga0207703_10318952
600 Ga0207639_10064171
601 Ga0207639_10174209
602 Ga0207678_10030276
603 Ga0207678_10031340
604 Ga0207678_10096654
605 Ga0207708_10000006
606 Ga0207708_10000180
607 Ga0207708_10152763
608 Ga0207708_10171328
609 Ga0207702_10052974
610 Ga0207641_10032517
611 Ga0207648_10005348
612 Ga0207648_10014668
613 Ga0207676_10034851
614 Ga0207676_10102366
615 Ga0207674_10149807
616 Ga0207674_10174894
617 Ga0207675_100002352
618 Ga0207675_100006710
619 Ga0207698_10055218
620 Ga0207698_10062220
621 Ga0207428_10063049
622 Ga0207428_10065133
623 Ga0268265_10109853
624 Ga0268265_10157125
625 Ga0268264_10000697
626 Ga0307406_10208465
627 Ga0307412_10244588
628 Ga0307409_100109291
629 Ga0307415_100395963
630 Ga0373932_0021186
631 Ga0373939_0025792
632 Ga0373942_0004569
633 Ga0373931_0113463
634 Ga0395899_0001284
635 Ga0395899_0021072
636 Ga0395900_0032799
637 Ga0395900_0556303
638 Ga0395898_0169152
639 Ga0395898_0299421
640 Ga0395905_0034756
641 Ga0395901_0035057
642 Ga0395901_0110227
643 Ga0395901_0133910
644 Ga0395901_0651783
645 Ga0439464_0027794
646 Ga0466972_0009996
647 Ga0466972_0039777
648 Ga0466965_0005796
649 Ga0466966_0007611
650 Ga0466966_0034622
651 Ga0466961_0017219
652 Ga0466961_0130871
653 Ga0466963_0018951
654 Ga0466963_0028044
655 Ga0466968_0077639
656 Ga0466968_0100275
657 Ga0466970_0025139
658 Ga0466970_0044503
659 Ga0466970_0046408
660 Ga0466957_0014042
661 Ga0466957_0021037
662 Ga0466957_0025601
663 Ga0466960_0078267
664 Ga0466959_0198222
665 Ga0466958_0053200
666 Ga0466958_0096441
667 Ga0466967_0000813
668 Ga0466967_0012586
669 Ga0466967_0019182
670 Ga0466967_0098852
671 Ga0466967_0101741
672 Ga0495629_0118336
673 Ga0495641_0015743
674 Ga0495653_0205722
675 Ga0495634_0122356
676 Ga0495635_0293483
677 Ga0495676_0103519
678 Ga0496100_0114849
679 Ga0496101_0061373
680 Ga0496101_0089708
681 Ga0496102_0000029
682 Ga0496102_0000908
683 Ga0496102_0071506
684 Ga0496102_0149725
685 Ga0496102_0151342
686 Ga0496102_0272219
687 Ga0496103_0000143
688 Ga0496103_0003639
689 Ga0496104_0058727
690 Ga0496104_0155826
691 Ga0496105_0077118
692 Ga0496106_0217773
693 Ga0496107_0080118
694 Ga0496108_0013238
695 Ga0496108_0021326
696 Ga0496108_0043561
697 Ga0496108_0056213
698 Ga0496108_0220135
699 Ga0496108_0264591
700 Ga0496108_0341674
701 Ga0496109_0043255
702 Ga0496109_0103145
703 Ga0496109_0119475
704 Ga0496109_0132775
705 Ga0496109_0187996
706 Ga0496109_0304496
707 Ga0496110_0065450
708 Ga0496110_0083982
709 Ga0496111_0029352
710 Ga0496111_0106982
711 Ga0496111_0388376
712 Ga0496112_0044198
713 Ga0496112_0087680
714 Ga0496112_0138839
715 Ga0496113_0004333
716 Ga0496113_0062184
717 Ga0496113_0076623
718 Ga0496114_0008882
719 Ga0496114_0043243
720 Ga0496114_0276902
721 Ga0501067_0043003
722 Ga0501070_0048156
723 Ga0501044_0470086
724 nmdc:mga0yw44_122900_c1
725 nmdc:mga0yw44_131371_c1
726 nmdc:mga05p37_655459_c1
727 nmdc:mga09592_184885_c1
728 nmdc:mga09592_352457_c1
729 nmdc:mga0qj67_121883_c1
730 nmdc:mga06r32_13850_c1
731 nmdc:mga08y16_105034_c1
732 nmdc:mga0n895_219061_c1
733 nmdc:mga0rr50_88511_c1
734 nmdc:mga08x19_44283_c1
735 nmdc:mga0a205_23870_c1
736 Ga0466962_0011100
737 Ga0466962_0028874
738 Ga0466962_0069308
739 2623589596
740 2643853172
741 2643893022
742 2643961919
743 2644098294
744 2644118979
745 2644137155
746 2738869273
747 2774392236
748 2809196036
749 2812331358
750 2812351827
751 2819424818
752 2819667645
753 2819690942
754 2819727715
755 2858870925
756 2891970543
757 2902583171
758 2919450799
759 2996225022
760 8055178466

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02128

Peptidase_M36

Fungalysin metallopeptidase (M36)

182

367

0.7

Structural Annotation

Top 5 Hits

ID Description Score Start End
4tnl-assembly1.cif.gz_A 1.8 a resolution room temperature structure of thermolysin recorded using an xfel 0.7623 50 329
6fj2-assembly1.cif.gz_A structure of thermolysin solved from sad data collected at the peak of the zn absorption edge on id30b 0.7496 52 326
8cr4-assembly1.cif.gz_A crystal structure of recombinant lasbartif from pseudomonas aeruginosa azpae14816 0.7479 18 326
3nqy-assembly1.cif.gz_B crystal structure of the autoprocessed complex of vibriolysin mcp-02 with a single point mutation e346a 0.7402 18 328
1esp-assembly1.cif.gz_A neutral protease mutant e144s 0.7382 50 326
ID Description Score Start End Superfamily
2vqxA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.8089 188 329 1.10.390.10
1bqbA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.7748 188 327 1.10.390.10
1bqbA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.7399 188 327 1.10.390.10
2vqxA02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.6901 188 329 1.10.390.10
4k90A02 Mainly Alpha;Orthogonal Bundle;Neutral Protease; domain 2;Neutral Protease Domain 2 0.6751 185 328 1.10.390.10
ID Description Score Start End GO Terms
AF-F2RID2-F1-model_v4 Bacillolysin 0.9731 167 327 GO:0004222
GO:0006508
AF-A0A2W5SSX8-F1-model_v4 FTP domain-containing protein 0.9572 18 328
AF-A0A077M453-F1-model_v4 Bacillolysin 0.9539 18 329 GO:0004222
GO:0006508
AF-A0A0S4LEC8-F1-model_v4 Putative Bacillolysin 0.9531 15 329 GO:0004222
GO:0005615
GO:0006508
GO:0008270
AF-A0A3M2ANX1-F1-model_v4 FTP domain-containing protein 0.9528 15 329 GO:0004222
GO:0005615
GO:0006508
GO:0008270

Map