F428488

General Info

Members Datasets Scaffolds Average Seq Length
379 143 758 145

Family's Representative Sequence

Representative Sequence 3300049591|Ga0501075_0673354|Ga0501075_0673354_110_634
Length 174
Sequence MMLDNATYHLMETEAGHARRVRRVPGCEEDIMKPLPHRYTVRIAGGSAGHATLSSEGVADLLTAPPVDFDGPGDVWSPEQLLLAAVQSCFLMTFRAVAQASGIEFTSLAVEGEGTVDRQDGGLRFTEIVLRPRVALPAGVDYVRVRRALEKAEHACLVSRSLGTPIRLEPEVAG

Samples

Sample ID Description Type Environment
1 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
2 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
3 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
4 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
5 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
6 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
7 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
8 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
9 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
10 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
11 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
12 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
13 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
14 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
15 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
16 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
17 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
18 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
19 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
20 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
21 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
22 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
23 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
24 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
25 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
26 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
27 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
28 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
29 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
30 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
31 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
32 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
33 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
34 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
35 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
36 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
37 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
38 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
39 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
40 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
41 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
42 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
43 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
44 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
45 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
46 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
47 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
48 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
49 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
50 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
51 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
52 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
53 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
54 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
55 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
69 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
70 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
71 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
73 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
74 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
75 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
76 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
77 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
78 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
79 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
80 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
81 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
82 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
83 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
84 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
85 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
86 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
87 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
88 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
89 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
90 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
91 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
92 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
93 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
94 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
95 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
96 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
97 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
98 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
99 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
100 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
101 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
102 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
103 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
104 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
105 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
106 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
107 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
108 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
109 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
110 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
111 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
112 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
113 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
114 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
115 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
116 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
117 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
118 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
119 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
120 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
121 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
122 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
123 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
124 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
125 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
126 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
127 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
128 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
129 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
130 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
131 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
132 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
133 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
134 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
135 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
136 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
137 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
138 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
139 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
140 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
141 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
142 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
143 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 4.22
Rhizosphere 95.78
Stem 0
Stem Tuber 0
Unclassified 24.27

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501075_0673354 3300049591 Bacteria 788
2 JGI25405J52794_10042910 3300003911 Unclassified 959
3 Ga0065707_10206855 3300005295 Bacteria 1284
4 Ga0065707_10421473 3300005295 Bacteria 828
5 Ga0070690_100109888 3300005330 Bacteria 1838
6 Ga0070670_100673075 3300005331 Archaea 929
7 Ga0068869_100456720 3300005334 Bacteria 1060
8 Ga0070666_10198309 3300005335 Bacteria 1412
9 Ga0070680_100166534 3300005336 Unclassified 1853
10 Ga0070713_100243231 3300005436 Bacteria 1639
11 Ga0070694_100037950 3300005444 Bacteria 3198
12 Ga0070694_101259765 3300005444 Unclassified 621
13 Ga0070708_100165752 3300005445 Bacteria 2061
14 Ga0070662_101355141 3300005457 Bacteria 613
15 Ga0070681_10162786 3300005458 Bacteria 2155
16 Ga0068867_100412946 3300005459 Unclassified 1141
17 Ga0070698_100022216 3300005471 Bacteria 6640
18 Ga0070698_100827890 3300005471 Bacteria 870
19 Ga0070679_100155467 3300005530 Bacteria 2262
20 Ga0070684_102154482 3300005535 Unclassified 526
21 Ga0070672_100153836 3300005543 Unclassified 1904
22 Ga0070672_100474823 3300005543 Bacteria 1079
23 Ga0070672_101612372 3300005543 Unclassified 582
24 Ga0070695_100051677 3300005545 Bacteria 2638
25 Ga0070696_100402770 3300005546 Bacteria 1071
26 Ga0070704_100038766 3300005549 Archaea 3267
27 Ga0070664_100111124 3300005564 Bacteria 2392
28 Ga0068854_100712806 3300005578 Bacteria 867
29 Ga0068859_100271158 3300005617 Bacteria 1789
30 Ga0068859_100359615 3300005617 Bacteria 1551
31 Ga0068859_101418110 3300005617 Unclassified 766
32 Ga0068866_10828308 3300005718 Unclassified 645
33 Ga0068861_101335840 3300005719 Unclassified 698
34 Ga0068870_10911417 3300005840 Bacteria 622
35 Ga0068858_101053430 3300005842 Bacteria 798
36 Ga0068860_100415990 3300005843 Bacteria 1332
37 Ga0068860_101349017 3300005843 Unclassified 734
38 Ga0068862_100087503 3300005844 Bacteria 2710
39 Ga0068862_102275237 3300005844 Bacteria 554
40 Ga0081455_10000506 3300005937 Bacteria 50493
41 Ga0075431_100069866 3300006847 Bacteria 3623
42 Ga0075433_10510109 3300006852 Bacteria 1058
43 Ga0097620_100271160 3300006931 Bacteria 1789
44 Ga0097620_100359614 3300006931 Bacteria 1551
45 Ga0097620_101418321 3300006931 Unclassified 766
46 Ga0075435_100295934 3300007076 Bacteria 1384
47 Ga0105240_10598800 3300009093 Unclassified 1214
48 Ga0111539_10094344 3300009094 Bacteria 3515
49 Ga0105245_10667548 3300009098 Unclassified 1071
50 Ga0105247_10842490 3300009101 Bacteria 703
51 Ga0114129_10142894 3300009147 Bacteria 3279
52 Ga0114129_10148701 3300009147 Bacteria 3207
53 Ga0114129_10261349 3300009147 Bacteria 2320
54 Ga0114129_11727125 3300009147 Unclassified 763
55 Ga0105242_10066431 3300009176 Bacteria 2978
56 Ga0105248_10116812 3300009177 Unclassified 3009
57 Ga0105237_10080063 3300009545 Bacteria 3257
58 Ga0105238_10242706 3300009551 Bacteria 1779
59 Ga0105249_10303877 3300009553 Bacteria 1601
60 Ga0105249_12075681 3300009553 Unclassified 641
61 Ga0105239_12407472 3300010375 Unclassified 613
62 Ga0105246_10783367 3300011119 Bacteria 844
63 Ga0163162_10268584 3300013306 Unclassified 1837
64 Ga0157372_11125403 3300013307 Bacteria 908
65 Ga0157379_10017337 3300014968 Bacteria 6346
66 Ga0157379_10093521 3300014968 Bacteria 2697
67 Ga0157376_10443122 3300014969 Bacteria 1265
68 Ga0197907_10063042 3300020069 Unclassified 2595
69 Ga0206350_10791738 3300020080 Unclassified 2434
70 Ga0224712_10020030 3300022467 Unclassified 2265
71 Ga0207688_11001184 3300025901 Unclassified 528
72 Ga0207680_10316434 3300025903 Unclassified 1090
73 Ga0207643_10633517 3300025908 Bacteria 689
74 Ga0207707_10125380 3300025912 Bacteria 2246
75 Ga0207695_10254052 3300025913 Unclassified 1657
76 Ga0207671_10840443 3300025914 Bacteria 727
77 Ga0207660_10211420 3300025917 Unclassified 1519
78 Ga0207646_10025047 3300025922 Bacteria 5461
79 Ga0207706_10140301 3300025933 Bacteria 2126
80 Ga0207706_10200965 3300025933 Bacteria 1748
81 Ga0207709_11116702 3300025935 Bacteria 648
82 Ga0207691_10448554 3300025940 Bacteria 1098
83 Ga0207711_10131646 3300025941 Unclassified 2243
84 Ga0207679_10869095 3300025945 Bacteria 824
85 Ga0207639_10684646 3300026041 Bacteria 950
86 Ga0207676_10314589 3300026095 Unclassified 1435
87 Ga0209998_10019703 3300027717 Bacteria 1439
88 Ga0268264_11317134 3300028381 Unclassified 732
89 Ga0268264_12380996 3300028381 Unclassified 536
90 Ga0307408_100030590 3300031548 Bacteria 3740
91 Ga0307408_100183969 3300031548 Bacteria 1678
92 Ga0307405_10219711 3300031731 Bacteria 1393
93 Ga0307410_10077077 3300031852 Bacteria 2329
94 Ga0307406_10694481 3300031901 Unclassified 849
95 Ga0307407_10378603 3300031903 Bacteria 1010
96 Ga0307409_100018305 3300031995 Bacteria 4705
97 Ga0307409_100426462 3300031995 Bacteria 1274
98 Ga0307416_100136653 3300032002 Bacteria 2219
99 Ga0373943_0594850 3300035170 Bacteria 651
100 Ga0373935_0485841 3300035692 Bacteria 895
101 Ga0373947_0065466 3300035725 Bacteria 2217
102 Ga0373925_0159006 3300037068 Bacteria 1778
103 Ga0439461_0124227 3300041410 Bacteria 648
104 Ga0439433_0103272 3300041999 Bacteria 709
105 Ga0439434_0178424 3300042435 Unclassified 711
106 Ga0439460_0029459 3300042461 Bacteria 1554
107 Ga0439460_0118022 3300042461 Unclassified 866
108 Ga0451577_0473442 3300042876 Bacteria 1137
109 Ga0453684_0328457 3300044712 Unclassified 1730
110 Ga0451576_0170455 3300045051 Unclassified 2272
111 Ga0451576_0440748 3300045051 Unclassified 1367
112 Ga0495580_0002679 3300046472 Bacteria 15434
113 Ga0495580_0003912 3300046472 Bacteria 12580
114 Ga0495580_0045683 3300046472 Unclassified 3110
115 Ga0495580_0548564 3300046472 Unclassified 768
116 Ga0495639_0332910 3300046475 Unclassified 760
117 Ga0495643_0004352 3300046522 Bacteria 9930
118 Ga0495663_0078046 3300046525 Bacteria 1063
119 Ga0495647_0111974 3300046681 Unclassified 1140
120 Ga0495670_0422126 3300046691 Unclassified 721
121 Ga0496102_0029367 3300048905 Bacteria 4921
122 Ga0496102_0268550 3300048905 Bacteria 1608
123 Ga0496106_0183870 3300048909 Unclassified 1660
124 Ga0496106_0423136 3300048909 Bacteria 1070
125 Ga0496107_0502219 3300048910 Unclassified 900
126 Ga0496107_1144198 3300048910 Unclassified 561
127 Ga0496108_1062952 3300048911 Unclassified 689
128 Ga0496108_1530799 3300048911 Unclassified 554
129 Ga0496109_0086091 3300048912 Bacteria 2902
130 Ga0496109_0514673 3300048912 Unclassified 1130
131 Ga0496109_1726842 3300048912 Unclassified 559
132 Ga0496110_0196689 3300048913 Bacteria 1831
133 Ga0496110_1182891 3300048913 Unclassified 673
134 Ga0496111_0048394 3300048914 Bacteria 3063
135 Ga0496112_1197013 3300048915 Bacteria 677
136 Ga0496113_0056725 3300048916 Bacteria 2942
137 Ga0501031_0093413 3300049568 Bacteria 1963
138 Ga0501031_0171926 3300049568 Bacteria 1416
139 Ga0501032_0023130 3300049569 Bacteria 4302
140 Ga0501034_1265789 3300049571 Unclassified 615
141 Ga0501036_0001793 3300049572 Bacteria 16672
142 Ga0501036_0013385 3300049572 Bacteria 6817
143 Ga0501036_0161569 3300049572 Bacteria 1888
144 Ga0501036_0546933 3300049572 Bacteria 962
145 Ga0501037_0043481 3300049573 Bacteria 3301
146 Ga0501037_0073121 3300049573 Bacteria 2493
147 Ga0501037_0183245 3300049573 Bacteria 1485
148 Ga0501038_0005202 3300049574 Bacteria 12107
149 Ga0501038_0150004 3300049574 Bacteria 1901
150 Ga0501038_0204251 3300049574 Bacteria 1584
151 Ga0501038_0245606 3300049574 Unclassified 1419
152 Ga0501038_0379967 3300049574 Bacteria 1096
153 Ga0501039_0003197 3300049575 Bacteria 12250
154 Ga0501039_0022402 3300049575 Bacteria 4849
155 Ga0501039_0150926 3300049575 Unclassified 1825
156 Ga0501039_0167521 3300049575 Bacteria 1727
157 Ga0501039_0242560 3300049575 Bacteria 1417
158 Ga0501039_0689530 3300049575 Unclassified 799
159 Ga0501040_0000630 3300049576 Bacteria 21526
160 Ga0501040_0004799 3300049576 Bacteria 8768
161 Ga0501040_0010492 3300049576 Bacteria 6060
162 Ga0501040_0039093 3300049576 Bacteria 3226
163 Ga0501040_0061542 3300049576 Bacteria 2582
164 Ga0501040_0084600 3300049576 Bacteria 2201
165 Ga0501040_0110911 3300049576 Bacteria 1918
166 Ga0501040_0415935 3300049576 Bacteria 966
167 Ga0501040_0447491 3300049576 Unclassified 930
168 Ga0501040_0644513 3300049576 Unclassified 765
169 Ga0501041_0002888 3300049577 Bacteria 9838
170 Ga0501041_0008812 3300049577 Bacteria 5938
171 Ga0501041_0320081 3300049577 Bacteria 978
172 Ga0501041_0507786 3300049577 Unclassified 767
173 Ga0501042_0009735 3300049578 Bacteria 6419
174 Ga0501042_0018083 3300049578 Bacteria 4875
175 Ga0501042_0027800 3300049578 Bacteria 3979
176 Ga0501042_0070177 3300049578 Bacteria 2506
177 Ga0501042_0102876 3300049578 Bacteria 2055
178 Ga0501042_0236917 3300049578 Bacteria 1317
179 Ga0501042_0293761 3300049578 Bacteria 1174
180 Ga0501042_0355704 3300049578 Bacteria 1060
181 Ga0501042_0502438 3300049578 Bacteria 880
182 Ga0501042_0595058 3300049578 Unclassified 804
183 Ga0501042_1081418 3300049578 Unclassified 585
184 Ga0501043_0038710 3300049579 Bacteria 3750
185 Ga0501043_0068470 3300049579 Bacteria 2787
186 Ga0501043_0086215 3300049579 Bacteria 2468
187 Ga0501043_0172674 3300049579 Bacteria 1686
188 Ga0501043_0221649 3300049579 Bacteria 1463
189 Ga0501043_0414145 3300049579 Unclassified 1017
190 Ga0501043_1023298 3300049579 Bacteria 587
191 Ga0501046_0002849 3300049580 Bacteria 16092
192 Ga0501046_0058789 3300049580 Bacteria 3013
193 Ga0501046_0128092 3300049580 Bacteria 1927
194 Ga0501046_0192559 3300049580 Bacteria 1520
195 Ga0501046_0367664 3300049580 Bacteria 1042
196 Ga0501047_0930047 3300049581 Bacteria 683
197 Ga0501048_0023886 3300049582 Bacteria 4465
198 Ga0501048_0047736 3300049582 Bacteria 3055
199 Ga0501048_0087074 3300049582 Bacteria 2203
200 Ga0501048_0141358 3300049582 Unclassified 1702
201 Ga0501048_0240477 3300049582 Bacteria 1285
202 Ga0501048_0279999 3300049582 Bacteria 1186
203 Ga0501048_0553515 3300049582 Bacteria 825
204 Ga0501048_0651457 3300049582 Unclassified 756
205 Ga0501048_0721235 3300049582 Bacteria 716
206 Ga0501048_1084016 3300049582 Bacteria 576
207 Ga0501068_0085070 3300049584 Bacteria 1946
208 Ga0501068_0105349 3300049584 Bacteria 1750
209 Ga0501068_0159049 3300049584 Unclassified 1423
210 Ga0501068_0195515 3300049584 Bacteria 1282
211 Ga0501068_0416338 3300049584 Bacteria 867
212 Ga0501068_0714678 3300049584 Unclassified 655
213 Ga0501069_0155240 3300049585 Bacteria 1316
214 Ga0501069_0408329 3300049585 Unclassified 804
215 Ga0501070_0103087 3300049586 Bacteria 2360
216 Ga0501070_0267562 3300049586 Unclassified 1396
217 Ga0501071_0018364 3300049587 Bacteria 4841
218 Ga0501071_0058882 3300049587 Bacteria 2778
219 Ga0501071_0110346 3300049587 Unclassified 2033
220 Ga0501071_0121563 3300049587 Bacteria 1935
221 Ga0501071_0160588 3300049587 Unclassified 1679
222 Ga0501071_0367953 3300049587 Bacteria 1095
223 Ga0501071_0476514 3300049587 Bacteria 956
224 Ga0501071_0557020 3300049587 Bacteria 881
225 Ga0501072_0005601 3300049588 Bacteria 9554
226 Ga0501072_0012352 3300049588 Bacteria 6526
227 Ga0501072_0012932 3300049588 Bacteria 6385
228 Ga0501072_0025777 3300049588 Bacteria 4581
229 Ga0501072_0050754 3300049588 Bacteria 3266
230 Ga0501072_0061828 3300049588 Bacteria 2954
231 Ga0501072_0178567 3300049588 Bacteria 1693
232 Ga0501072_0186836 3300049588 Bacteria 1653
233 Ga0501072_0220346 3300049588 Bacteria 1512
234 Ga0501072_0247000 3300049588 Bacteria 1421
235 Ga0501072_0350424 3300049588 Bacteria 1172
236 Ga0501072_0350767 3300049588 Bacteria 1171
237 Ga0501072_1113453 3300049588 Unclassified 614
238 Ga0501073_0243922 3300049589 Bacteria 1240
239 Ga0501073_0513867 3300049589 Bacteria 828
240 Ga0501073_0594814 3300049589 Unclassified 764
241 Ga0501074_0104550 3300049590 Bacteria 2027
242 Ga0501074_0106096 3300049590 Bacteria 2011
243 Ga0501074_0164156 3300049590 Bacteria 1586
244 Ga0501074_0394466 3300049590 Bacteria 981
245 Ga0501074_0645255 3300049590 Bacteria 748
246 Ga0501074_0656855 3300049590 Unclassified 741
247 Ga0501074_0978132 3300049590 Unclassified 595
248 Ga0501075_0000580 3300049591 Bacteria 22326
249 Ga0501075_0004410 3300049591 Bacteria 9522
250 Ga0501075_0049307 3300049591 Bacteria 3165
251 Ga0501075_0117564 3300049591 Bacteria 2021
252 Ga0501075_0121637 3300049591 Bacteria 1986
253 Ga0501075_0154089 3300049591 Bacteria 1752
254 Ga0501075_0174002 3300049591 Bacteria 1643
255 Ga0501075_0174947 3300049591 Bacteria 1638
256 Ga0501075_0223157 3300049591 Bacteria 1437
257 Ga0501075_0326176 3300049591 Bacteria 1170
258 Ga0501075_0416542 3300049591 Unclassified 1024
259 Ga0501075_0545388 3300049591 Bacteria 885
260 Ga0501075_1031777 3300049591 Unclassified 625
261 Ga0501075_1245546 3300049591 Bacteria 564
262 Ga0501076_0002968 3300049592 Bacteria 11767
263 Ga0501076_0003803 3300049592 Bacteria 10625
264 Ga0501076_0022609 3300049592 Bacteria 4833
265 Ga0501076_0089580 3300049592 Bacteria 2473
266 Ga0501076_0139882 3300049592 Bacteria 1966
267 Ga0501076_0190622 3300049592 Bacteria 1673
268 Ga0501076_0232406 3300049592 Bacteria 1507
269 Ga0501077_0005244 3300049593 Bacteria 7873
270 Ga0501077_0005805 3300049593 Bacteria 7521
271 Ga0501077_0021003 3300049593 Bacteria 4132
272 Ga0501077_0038464 3300049593 Bacteria 3046
273 Ga0501077_0043796 3300049593 Bacteria 2844
274 Ga0501077_0067330 3300049593 Bacteria 2271
275 Ga0501077_0159630 3300049593 Bacteria 1431
276 Ga0501077_0323874 3300049593 Bacteria 982
277 Ga0501077_0436479 3300049593 Bacteria 838
278 Ga0501077_0483902 3300049593 Bacteria 793
279 Ga0501077_0574724 3300049593 Bacteria 723
280 Ga0501077_0599508 3300049593 Bacteria 707
281 Ga0501077_0717897 3300049593 Unclassified 642
282 Ga0501077_0961867 3300049593 Bacteria 549
283 Ga0501079_0000171 3300049741 Bacteria 36387
284 Ga0501079_0006409 3300049741 Bacteria 8832
285 Ga0501079_0034090 3300049741 Bacteria 3916
286 Ga0501079_0390386 3300049741 Bacteria 1091
287 Ga0501079_0507472 3300049741 Bacteria 948
288 Ga0501079_0513054 3300049741 Unclassified 943
289 Ga0501079_0524513 3300049741 Unclassified 931
290 Ga0501079_0810112 3300049741 Bacteria 737
291 Ga0501079_1056440 3300049741 Unclassified 640
292 Ga0501079_1389262 3300049741 Bacteria 552
293 Ga0501080_0000923 3300049742 Bacteria 24005
294 Ga0501080_0036487 3300049742 Bacteria 4588
295 Ga0501080_0116636 3300049742 Bacteria 2475
296 Ga0501080_0175941 3300049742 Bacteria 1971
297 Ga0501080_0306062 3300049742 Bacteria 1441
298 Ga0501080_0468719 3300049742 Unclassified 1128
299 Ga0501080_0579585 3300049742 Bacteria 997
300 Ga0501081_0000270 3300049743 Bacteria 27320
301 Ga0501081_0008178 3300049743 Bacteria 6786
302 Ga0501081_0020600 3300049743 Bacteria 4395
303 Ga0501081_0077285 3300049743 Bacteria 2326
304 Ga0501081_0079265 3300049743 Bacteria 2297
305 Ga0501081_0133032 3300049743 Bacteria 1778
306 Ga0501081_0239883 3300049743 Unclassified 1322
307 Ga0501081_0259134 3300049743 Bacteria 1270
308 Ga0501081_0286177 3300049743 Bacteria 1207
309 Ga0501081_0329118 3300049743 Bacteria 1124
310 Ga0501081_0371061 3300049743 Unclassified 1056
311 Ga0501081_0409318 3300049743 Bacteria 1005
312 Ga0501081_0442313 3300049743 Unclassified 965
313 Ga0501081_0455793 3300049743 Unclassified 950
314 Ga0501081_0458451 3300049743 Bacteria 947
315 Ga0501081_0495782 3300049743 Bacteria 910
316 Ga0501081_0555794 3300049743 Unclassified 858
317 Ga0501081_1428068 3300049743 Bacteria 525
318 Ga0501083_0059246 3300049744 Bacteria 2561
319 Ga0501083_0390562 3300049744 Unclassified 905
320 Ga0501083_0565020 3300049744 Bacteria 740
321 Ga0501035_0009901 3300049822 Bacteria 8850
322 Ga0501035_0135341 3300049822 Bacteria 2146
323 Ga0501035_0149287 3300049822 Bacteria 2029
324 Ga0501035_0186856 3300049822 Bacteria 1783
325 Ga0501035_0272904 3300049822 Bacteria 1431
326 Ga0501035_0455613 3300049822 Bacteria 1058
327 Ga0501035_0723444 3300049822 Bacteria 801
328 Ga0501044_0261779 3300049823 Bacteria 1668
329 Ga0501045_0004614 3300049824 Bacteria 9513
330 Ga0501045_0076018 3300049824 Bacteria 2474
331 Ga0501045_0094926 3300049824 Bacteria 2206
332 Ga0501045_0202669 3300049824 Bacteria 1478
333 Ga0501045_0467070 3300049824 Bacteria 938
334 Ga0501045_0475706 3300049824 Bacteria 928
335 Ga0501045_0783310 3300049824 Bacteria 702
336 Ga0501045_1055633 3300049824 Unclassified 595
337 nmdc:mga05p37_672924_c1 3300050507 Bacteria 1155
338 nmdc:mga05p37_83033_c1 3300050507 Bacteria 3947
339 nmdc:mga06r32_337047_c1 3300050510 Bacteria 1493
340 nmdc:mga08y16_54267_c1 3300050511 Bacteria 4187
341 nmdc:mga0n895_310767_c1 3300050512 Bacteria 1597
342 nmdc:mga0a205_499648_c1 3300050515 Bacteria 1073
343 Ga0501084_0006784 3300054114 Bacteria 9412
344 Ga0501084_0025554 3300054114 Bacteria 4926
345 Ga0501084_0033256 3300054114 Bacteria 4313
346 Ga0501084_0045906 3300054114 Bacteria 3657
347 Ga0501084_0051058 3300054114 Bacteria 3461
348 Ga0501084_0114980 3300054114 Bacteria 2262
349 Ga0501084_0330784 3300054114 Bacteria 1287
350 Ga0501084_0359196 3300054114 Bacteria 1231
351 Ga0501084_0514838 3300054114 Bacteria 1011
352 Ga0501084_1048355 3300054114 Unclassified 685
353 Ga0501084_1113856 3300054114 Bacteria 663
354 Ga0590075_120387 3300059424 Unclassified 687
355 Ga0501082_0010312 3300060353 Bacteria 8046
356 Ga0501082_0010585 3300060353 Bacteria 7938
357 Ga0501082_0019736 3300060353 Bacteria 5812
358 Ga0501082_0091824 3300060353 Bacteria 2622
359 Ga0501082_0124495 3300060353 Bacteria 2235
360 Ga0501082_0184402 3300060353 Unclassified 1815
361 Ga0501082_0219700 3300060353 Bacteria 1653
362 Ga0501082_0354547 3300060353 Bacteria 1279
363 Ga0501082_0556265 3300060353 Bacteria 1003
364 Ga0501082_0833840 3300060353 Unclassified 807
365 Ga0501082_1038153 3300060353 Unclassified 717
366 Ga0501082_1433797 3300060353 Unclassified 603
367 Ga0530510_0000122 3300061734 Bacteria 44511
368 Ga0530510_0000305 3300061734 Bacteria 31282
369 Ga0530510_0012901 3300061734 Bacteria 5875
370 Ga0530510_0029840 3300061734 Bacteria 3915
371 Ga0530510_0080840 3300061734 Bacteria 2365
372 Ga0530510_0089734 3300061734 Bacteria 2241
373 Ga0530510_0090119 3300061734 Bacteria 2236
374 Ga0530510_0124062 3300061734 Bacteria 1897
375 Ga0530510_0206620 3300061734 Bacteria 1459
376 Ga0530510_0313377 3300061734 Bacteria 1175
377 Ga0530510_0541990 3300061734 Bacteria 883
378 Ga0530510_0622241 3300061734 Bacteria 821
379 Ga0530510_1264811 3300061734 Unclassified 566
380 Ga0501075_0673354
381 JGI25405J52794_10042910
382 Ga0065707_10206855
383 Ga0065707_10421473
384 Ga0070690_100109888
385 Ga0070670_100673075
386 Ga0068869_100456720
387 Ga0070666_10198309
388 Ga0070680_100166534
389 Ga0070713_100243231
390 Ga0070694_100037950
391 Ga0070694_101259765
392 Ga0070708_100165752
393 Ga0070662_101355141
394 Ga0070681_10162786
395 Ga0068867_100412946
396 Ga0070698_100022216
397 Ga0070698_100827890
398 Ga0070679_100155467
399 Ga0070684_102154482
400 Ga0070672_100153836
401 Ga0070672_100474823
402 Ga0070672_101612372
403 Ga0070695_100051677
404 Ga0070696_100402770
405 Ga0070704_100038766
406 Ga0070664_100111124
407 Ga0068854_100712806
408 Ga0068859_100271158
409 Ga0068859_100359615
410 Ga0068859_101418110
411 Ga0068866_10828308
412 Ga0068861_101335840
413 Ga0068870_10911417
414 Ga0068858_101053430
415 Ga0068860_100415990
416 Ga0068860_101349017
417 Ga0068862_100087503
418 Ga0068862_102275237
419 Ga0081455_10000506
420 Ga0075431_100069866
421 Ga0075433_10510109
422 Ga0097620_100271160
423 Ga0097620_100359614
424 Ga0097620_101418321
425 Ga0075435_100295934
426 Ga0105240_10598800
427 Ga0111539_10094344
428 Ga0105245_10667548
429 Ga0105247_10842490
430 Ga0114129_10142894
431 Ga0114129_10148701
432 Ga0114129_10261349
433 Ga0114129_11727125
434 Ga0105242_10066431
435 Ga0105248_10116812
436 Ga0105237_10080063
437 Ga0105238_10242706
438 Ga0105249_10303877
439 Ga0105249_12075681
440 Ga0105239_12407472
441 Ga0105246_10783367
442 Ga0163162_10268584
443 Ga0157372_11125403
444 Ga0157379_10017337
445 Ga0157379_10093521
446 Ga0157376_10443122
447 Ga0197907_10063042
448 Ga0206350_10791738
449 Ga0224712_10020030
450 Ga0207688_11001184
451 Ga0207680_10316434
452 Ga0207643_10633517
453 Ga0207707_10125380
454 Ga0207695_10254052
455 Ga0207671_10840443
456 Ga0207660_10211420
457 Ga0207646_10025047
458 Ga0207706_10140301
459 Ga0207706_10200965
460 Ga0207709_11116702
461 Ga0207691_10448554
462 Ga0207711_10131646
463 Ga0207679_10869095
464 Ga0207639_10684646
465 Ga0207676_10314589
466 Ga0209998_10019703
467 Ga0268264_11317134
468 Ga0268264_12380996
469 Ga0307408_100030590
470 Ga0307408_100183969
471 Ga0307405_10219711
472 Ga0307410_10077077
473 Ga0307406_10694481
474 Ga0307407_10378603
475 Ga0307409_100018305
476 Ga0307409_100426462
477 Ga0307416_100136653
478 Ga0373943_0594850
479 Ga0373935_0485841
480 Ga0373947_0065466
481 Ga0373925_0159006
482 Ga0439461_0124227
483 Ga0439433_0103272
484 Ga0439434_0178424
485 Ga0439460_0029459
486 Ga0439460_0118022
487 Ga0451577_0473442
488 Ga0453684_0328457
489 Ga0451576_0170455
490 Ga0451576_0440748
491 Ga0495580_0002679
492 Ga0495580_0003912
493 Ga0495580_0045683
494 Ga0495580_0548564
495 Ga0495639_0332910
496 Ga0495643_0004352
497 Ga0495663_0078046
498 Ga0495647_0111974
499 Ga0495670_0422126
500 Ga0496102_0029367
501 Ga0496102_0268550
502 Ga0496106_0183870
503 Ga0496106_0423136
504 Ga0496107_0502219
505 Ga0496107_1144198
506 Ga0496108_1062952
507 Ga0496108_1530799
508 Ga0496109_0086091
509 Ga0496109_0514673
510 Ga0496109_1726842
511 Ga0496110_0196689
512 Ga0496110_1182891
513 Ga0496111_0048394
514 Ga0496112_1197013
515 Ga0496113_0056725
516 Ga0501031_0093413
517 Ga0501031_0171926
518 Ga0501032_0023130
519 Ga0501034_1265789
520 Ga0501036_0001793
521 Ga0501036_0013385
522 Ga0501036_0161569
523 Ga0501036_0546933
524 Ga0501037_0043481
525 Ga0501037_0073121
526 Ga0501037_0183245
527 Ga0501038_0005202
528 Ga0501038_0150004
529 Ga0501038_0204251
530 Ga0501038_0245606
531 Ga0501038_0379967
532 Ga0501039_0003197
533 Ga0501039_0022402
534 Ga0501039_0150926
535 Ga0501039_0167521
536 Ga0501039_0242560
537 Ga0501039_0689530
538 Ga0501040_0000630
539 Ga0501040_0004799
540 Ga0501040_0010492
541 Ga0501040_0039093
542 Ga0501040_0061542
543 Ga0501040_0084600
544 Ga0501040_0110911
545 Ga0501040_0415935
546 Ga0501040_0447491
547 Ga0501040_0644513
548 Ga0501041_0002888
549 Ga0501041_0008812
550 Ga0501041_0320081
551 Ga0501041_0507786
552 Ga0501042_0009735
553 Ga0501042_0018083
554 Ga0501042_0027800
555 Ga0501042_0070177
556 Ga0501042_0102876
557 Ga0501042_0236917
558 Ga0501042_0293761
559 Ga0501042_0355704
560 Ga0501042_0502438
561 Ga0501042_0595058
562 Ga0501042_1081418
563 Ga0501043_0038710
564 Ga0501043_0068470
565 Ga0501043_0086215
566 Ga0501043_0172674
567 Ga0501043_0221649
568 Ga0501043_0414145
569 Ga0501043_1023298
570 Ga0501046_0002849
571 Ga0501046_0058789
572 Ga0501046_0128092
573 Ga0501046_0192559
574 Ga0501046_0367664
575 Ga0501047_0930047
576 Ga0501048_0023886
577 Ga0501048_0047736
578 Ga0501048_0087074
579 Ga0501048_0141358
580 Ga0501048_0240477
581 Ga0501048_0279999
582 Ga0501048_0553515
583 Ga0501048_0651457
584 Ga0501048_0721235
585 Ga0501048_1084016
586 Ga0501068_0085070
587 Ga0501068_0105349
588 Ga0501068_0159049
589 Ga0501068_0195515
590 Ga0501068_0416338
591 Ga0501068_0714678
592 Ga0501069_0155240
593 Ga0501069_0408329
594 Ga0501070_0103087
595 Ga0501070_0267562
596 Ga0501071_0018364
597 Ga0501071_0058882
598 Ga0501071_0110346
599 Ga0501071_0121563
600 Ga0501071_0160588
601 Ga0501071_0367953
602 Ga0501071_0476514
603 Ga0501071_0557020
604 Ga0501072_0005601
605 Ga0501072_0012352
606 Ga0501072_0012932
607 Ga0501072_0025777
608 Ga0501072_0050754
609 Ga0501072_0061828
610 Ga0501072_0178567
611 Ga0501072_0186836
612 Ga0501072_0220346
613 Ga0501072_0247000
614 Ga0501072_0350424
615 Ga0501072_0350767
616 Ga0501072_1113453
617 Ga0501073_0243922
618 Ga0501073_0513867
619 Ga0501073_0594814
620 Ga0501074_0104550
621 Ga0501074_0106096
622 Ga0501074_0164156
623 Ga0501074_0394466
624 Ga0501074_0645255
625 Ga0501074_0656855
626 Ga0501074_0978132
627 Ga0501075_0000580
628 Ga0501075_0004410
629 Ga0501075_0049307
630 Ga0501075_0117564
631 Ga0501075_0121637
632 Ga0501075_0154089
633 Ga0501075_0174002
634 Ga0501075_0174947
635 Ga0501075_0223157
636 Ga0501075_0326176
637 Ga0501075_0416542
638 Ga0501075_0545388
639 Ga0501075_1031777
640 Ga0501075_1245546
641 Ga0501076_0002968
642 Ga0501076_0003803
643 Ga0501076_0022609
644 Ga0501076_0089580
645 Ga0501076_0139882
646 Ga0501076_0190622
647 Ga0501076_0232406
648 Ga0501077_0005244
649 Ga0501077_0005805
650 Ga0501077_0021003
651 Ga0501077_0038464
652 Ga0501077_0043796
653 Ga0501077_0067330
654 Ga0501077_0159630
655 Ga0501077_0323874
656 Ga0501077_0436479
657 Ga0501077_0483902
658 Ga0501077_0574724
659 Ga0501077_0599508
660 Ga0501077_0717897
661 Ga0501077_0961867
662 Ga0501079_0000171
663 Ga0501079_0006409
664 Ga0501079_0034090
665 Ga0501079_0390386
666 Ga0501079_0507472
667 Ga0501079_0513054
668 Ga0501079_0524513
669 Ga0501079_0810112
670 Ga0501079_1056440
671 Ga0501079_1389262
672 Ga0501080_0000923
673 Ga0501080_0036487
674 Ga0501080_0116636
675 Ga0501080_0175941
676 Ga0501080_0306062
677 Ga0501080_0468719
678 Ga0501080_0579585
679 Ga0501081_0000270
680 Ga0501081_0008178
681 Ga0501081_0020600
682 Ga0501081_0077285
683 Ga0501081_0079265
684 Ga0501081_0133032
685 Ga0501081_0239883
686 Ga0501081_0259134
687 Ga0501081_0286177
688 Ga0501081_0329118
689 Ga0501081_0371061
690 Ga0501081_0409318
691 Ga0501081_0442313
692 Ga0501081_0455793
693 Ga0501081_0458451
694 Ga0501081_0495782
695 Ga0501081_0555794
696 Ga0501081_1428068
697 Ga0501083_0059246
698 Ga0501083_0390562
699 Ga0501083_0565020
700 Ga0501035_0009901
701 Ga0501035_0135341
702 Ga0501035_0149287
703 Ga0501035_0186856
704 Ga0501035_0272904
705 Ga0501035_0455613
706 Ga0501035_0723444
707 Ga0501044_0261779
708 Ga0501045_0004614
709 Ga0501045_0076018
710 Ga0501045_0094926
711 Ga0501045_0202669
712 Ga0501045_0467070
713 Ga0501045_0475706
714 Ga0501045_0783310
715 Ga0501045_1055633
716 nmdc:mga05p37_672924_c1
717 nmdc:mga05p37_83033_c1
718 nmdc:mga06r32_337047_c1
719 nmdc:mga08y16_54267_c1
720 nmdc:mga0n895_310767_c1
721 nmdc:mga0a205_499648_c1
722 Ga0501084_0006784
723 Ga0501084_0025554
724 Ga0501084_0033256
725 Ga0501084_0045906
726 Ga0501084_0051058
727 Ga0501084_0114980
728 Ga0501084_0330784
729 Ga0501084_0359196
730 Ga0501084_0514838
731 Ga0501084_1048355
732 Ga0501084_1113856
733 Ga0590075_120387
734 Ga0501082_0010312
735 Ga0501082_0010585
736 Ga0501082_0019736
737 Ga0501082_0091824
738 Ga0501082_0124495
739 Ga0501082_0184402
740 Ga0501082_0219700
741 Ga0501082_0354547
742 Ga0501082_0556265
743 Ga0501082_0833840
744 Ga0501082_1038153
745 Ga0501082_1433797
746 Ga0530510_0000122
747 Ga0530510_0000305
748 Ga0530510_0012901
749 Ga0530510_0029840
750 Ga0530510_0080840
751 Ga0530510_0089734
752 Ga0530510_0090119
753 Ga0530510_0124062
754 Ga0530510_0206620
755 Ga0530510_0313377
756 Ga0530510_0541990
757 Ga0530510_0622241
758 Ga0530510_1264811

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02566

OsmC

OsmC-like protein

71

171

0.9

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.9356 5 139
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.88 5 144
2d7v-assembly1.cif.gz_B structure of osmc-like protein of unknown function vca0330 from vibrio cholerae o1 biovar eltor str. n16961 0.8739 5 139
2onf-assembly1.cif.gz_B crystal structure of a putative osmotically inducible protein c (ta0195) from thermoplasma acidophilum at 1.70 a resolution 0.8684 5 144
2e8c-assembly1.cif.gz_A crystal structure of a hypothetical protein (aq_1549) from aquifex aeolicus vf5 0.8522 5 144
ID Description Score Start End Superfamily
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.9158 6 139 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8698 11 144 3.30.300.20
2onfB01 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8578 11 144 3.30.300.20
2e8fA00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.8528 5 144 3.30.300.20
2d7vB00 Alpha Beta;2-Layer Sandwich;GMP Synthetase; Chain A, domain 3;K homology (KH) domain 0.85 6 139 3.30.300.20
ID Description Score Start End GO Terms
AF-A0A7Y3MEX1-F1-model_v4 OsmC family protein 0.9767 1 144
AF-A0A7X3WNY2-F1-model_v4 OsmC family peroxiredoxin 0.9765 1 144
AF-A0A2E0VKH8-F1-model_v4 Osmotically inducible protein OsmC 0.9742 1 144
AF-A0A1F9CQ94-F1-model_v4 Osmotically inducible protein OsmC 0.9732 1 144
AF-T0DF02-F1-model_v4 OsmC-like protein 0.9719 5 144

Map