F428379

General Info

Members Datasets Scaffolds Average Seq Length
379 215 758 249

Family's Representative Sequence

Representative Sequence 3300025933|Ga0207706_10192335|Ga0207706_101923352
Length 267
Sequence MKTTGLITRRRAIVAGLASIGGLAAARLPRDLPPTYGNLLRMGDTLTYAAHRTLLPAGSLVREYSVGDLTSFPATGTTNPAVSVKSALGEEYRRQQAGAFADWRLAVEGRVARPRSFSLAELKQLPSRTQITRHTCEEGWTAIGQWTGVPLSLVLDAVGILPTARFVVLHSVDDWVDSLDLIDALHPQTILAYGMNGGDLPIAHGAPVRLRLERQIGYKSMKYVRRLVVSDEFDDGGLSGSIYRHREDPKHSEYCGGEHTTSGRREK

Samples

Sample ID Description Type Environment
1 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
2 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
3 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
4 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
5 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
18 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
19 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
35 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
36 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
37 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
41 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
42 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
43 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
44 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
45 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
51 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
52 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
53 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
54 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
55 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
56 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
57 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
58 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
59 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
60 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
61 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
62 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
63 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
64 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
65 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
66 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
67 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
68 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
69 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
70 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
71 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
72 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
73 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
74 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
75 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
76 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
77 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
78 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
79 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
80 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
81 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
82 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
85 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
86 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
87 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
88 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
89 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
90 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
91 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
92 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
93 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
94 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
95 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
96 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
98 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
99 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
100 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
101 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
103 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
104 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
106 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
110 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
111 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
112 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
113 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
114 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
115 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
116 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
117 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
118 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
141 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
142 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
146 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
147 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
148 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
149 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
150 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
151 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
152 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
153 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
154 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
155 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
156 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
157 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
158 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
159 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
160 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
161 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
162 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
163 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
164 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
165 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
166 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
167 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
168 3300042132 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_070716_133 Metagenome Rhizosphere
169 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
170 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
171 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
172 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
173 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
174 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
175 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
176 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
177 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
178 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
179 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
180 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
181 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
182 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
183 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
184 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
185 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
186 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
187 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
188 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
189 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
190 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
195 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
196 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
197 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
198 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
199 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
200 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
201 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
202 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
203 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
204 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
205 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
206 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
207 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
208 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
209 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
210 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
211 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
212 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
213 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
214 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
215 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 7.92
Nodule 0
Rhizoplane 3.43
Rhizosphere 88.13
Stem 0
Stem Tuber 0
Unclassified 19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0207706_10192335 3300025933 Bacteria 1791
2 JGI24746J21847_1000084 3300001977 Bacteria 10172
3 Ga0055530_10000949 3300003791 Bacteria 23707
4 Ga0055531_10001263 3300003794 Bacteria 19144
5 Ga0065165_1001262 3300005262 Bacteria 28613
6 Ga0065165_1007987 3300005262 Bacteria 5062
7 Ga0065712_10074444 3300005290 Bacteria 4094
8 Ga0065715_10001548 3300005293 Bacteria 6005
9 Ga0065715_10114580 3300005293 Bacteria 2409
10 Ga0065715_10114673 3300005293 Bacteria 2442
11 Ga0065707_10127240 3300005295 Unclassified 1986
12 Ga0070676_10007615 3300005328 Bacteria 5818
13 Ga0070690_100015807 3300005330 Bacteria 4509
14 Ga0070690_100052355 3300005330 Bacteria 2609
15 Ga0070670_100094723 3300005331 Bacteria 2568
16 Ga0070670_100276665 3300005331 Bacteria 1465
17 Ga0070677_10019370 3300005333 Bacteria 2464
18 Ga0070677_10031311 3300005333 Bacteria 2032
19 Ga0068869_100012760 3300005334 Bacteria 5558
20 Ga0068869_100013704 3300005334 Bacteria 5401
21 Ga0068869_100037990 3300005334 Bacteria 3427
22 Ga0068869_100286514 3300005334 Bacteria 1326
23 Ga0070666_10111577 3300005335 Unclassified 1891
24 Ga0068868_100052708 3300005338 Bacteria 3202
25 Ga0068868_100071607 3300005338 Bacteria 2764
26 Ga0068868_100106393 3300005338 Bacteria 2275
27 Ga0070689_100028487 3300005340 Bacteria 4222
28 Ga0070689_100048471 3300005340 Bacteria 3276
29 Ga0070687_100011165 3300005343 Bacteria 3918
30 Ga0070687_100067113 3300005343 Unclassified 1914
31 Ga0070687_100233022 3300005343 Bacteria 1134
32 Ga0070661_100068047 3300005344 Bacteria 2617
33 Ga0070692_10065715 3300005345 Unclassified 1921
34 Ga0070668_100482539 3300005347 Bacteria 1071
35 Ga0070669_100005139 3300005353 Bacteria 9464
36 Ga0070669_100059210 3300005353 Bacteria 2813
37 Ga0070675_100088655 3300005354 Bacteria 2589
38 Ga0070675_100147516 3300005354 Bacteria 2015
39 Ga0070675_100158753 3300005354 Unclassified 1943
40 Ga0070671_100025017 3300005355 Bacteria 4893
41 Ga0070671_100057947 3300005355 Bacteria 3224
42 Ga0070674_100056432 3300005356 Bacteria 2723
43 Ga0070674_100134042 3300005356 Bacteria 1851
44 Ga0070673_100044253 3300005364 Bacteria 3446
45 Ga0070673_100067938 3300005364 Bacteria 2852
46 Ga0070673_100179971 3300005364 Unclassified 1809
47 Ga0070673_100235229 3300005364 Bacteria 1591
48 Ga0070688_100007734 3300005365 Bacteria 5804
49 Ga0070688_100023933 3300005365 Unclassified 3597
50 Ga0070688_100228444 3300005365 Bacteria 1315
51 Ga0070659_100113075 3300005366 Unclassified 2193
52 Ga0070667_100014589 3300005367 Bacteria 6494
53 Ga0070667_100100380 3300005367 Bacteria 2499
54 Ga0070667_100209497 3300005367 Bacteria 1732
55 Ga0070713_100068712 3300005436 Bacteria 2986
56 Ga0070710_10440458 3300005437 Unclassified 881
57 Ga0070701_10042007 3300005438 Unclassified 2332
58 Ga0070711_100088926 3300005439 Bacteria 2221
59 Ga0070700_100194467 3300005441 Unclassified 1421
60 Ga0070694_100154217 3300005444 Unclassified 1680
61 Ga0070663_100058585 3300005455 Bacteria 2766
62 Ga0070663_100273359 3300005455 Bacteria 1344
63 Ga0070678_100014929 3300005456 Bacteria 4919
64 Ga0070678_100019608 3300005456 Bacteria 4416
65 Ga0070678_100201841 3300005456 Unclassified 1642
66 Ga0070662_100368907 3300005457 Unclassified 1179
67 Ga0068867_100020075 3300005459 Bacteria 4761
68 Ga0068867_100039070 3300005459 Bacteria 3458
69 Ga0068867_100080868 3300005459 Bacteria 2448
70 Ga0068867_100131646 3300005459 Bacteria 1945
71 Ga0070685_10048354 3300005466 Bacteria 2449
72 Ga0070685_10082835 3300005466 Bacteria 1926
73 Ga0070698_100263402 3300005471 Bacteria 1656
74 Ga0070684_100007004 3300005535 Bacteria 8759
75 Ga0068853_100183805 3300005539 Bacteria 1897
76 Ga0070672_100015838 3300005543 Bacteria 5382
77 Ga0070672_100016667 3300005543 Bacteria 5267
78 Ga0070672_100123565 3300005543 Bacteria 2121
79 Ga0070686_100003079 3300005544 Bacteria 9134
80 Ga0070696_100086223 3300005546 Bacteria 2229
81 Ga0070665_100026057 3300005548 Bacteria 5888
82 Ga0070665_100049251 3300005548 Bacteria 4228
83 Ga0070665_100064941 3300005548 Unclassified 3661
84 Ga0070665_100402954 3300005548 Bacteria 1376
85 Ga0070704_100371681 3300005549 Unclassified 1212
86 Ga0070664_100003565 3300005564 Bacteria 12563
87 Ga0070664_100047696 3300005564 Bacteria 3619
88 Ga0070664_100220057 3300005564 Bacteria 1699
89 Ga0070664_100228110 3300005564 Bacteria 1669
90 Ga0068857_100291633 3300005577 Bacteria 1502
91 Ga0068854_100120005 3300005578 Bacteria 1995
92 Ga0068856_100094817 3300005614 Bacteria 2972
93 Ga0070702_100053457 3300005615 Unclassified 2320
94 Ga0068852_100140593 3300005616 Unclassified 2234
95 Ga0068859_100191622 3300005617 Bacteria 2129
96 Ga0068859_100213297 3300005617 Unclassified 2017
97 Ga0068859_100449318 3300005617 Bacteria 1385
98 Ga0068864_100065584 3300005618 Bacteria 3150
99 Ga0068861_100145715 3300005719 Unclassified 1938
100 Ga0068861_100197285 3300005719 Bacteria 1687
101 Ga0068861_100385285 3300005719 Bacteria 1240
102 Ga0068870_10013263 3300005840 Bacteria 3871
103 Ga0068870_10213443 3300005840 Bacteria 1177
104 Ga0068863_100072947 3300005841 Bacteria 3247
105 Ga0068858_100128521 3300005842 Unclassified 2375
106 Ga0068858_100129704 3300005842 Unclassified 2363
107 Ga0068860_100014993 3300005843 Bacteria 7574
108 Ga0068860_100022983 3300005843 Bacteria 6030
109 Ga0068860_100170939 3300005843 Bacteria 2099
110 Ga0068862_100035272 3300005844 Bacteria 4235
111 Ga0068862_100043224 3300005844 Bacteria 3841
112 Ga0068862_100074158 3300005844 Unclassified 2941
113 Ga0068862_100458296 3300005844 Bacteria 1203
114 Ga0068862_100512850 3300005844 Unclassified 1140
115 Ga0081455_10136435 3300005937 Unclassified 1911
116 Ga0075365_10113722 3300006038 Bacteria 1862
117 Ga0075364_10176473 3300006051 Bacteria 1445
118 Ga0075367_10048890 3300006178 Bacteria 2493
119 Ga0075367_10106778 3300006178 Unclassified 1716
120 Ga0075366_10064118 3300006195 Bacteria 2185
121 Ga0097621_100069929 3300006237 Bacteria 2898
122 Ga0075370_10020170 3300006353 Bacteria 3640
123 Ga0068871_100021214 3300006358 Bacteria 4990
124 Ga0068871_100054986 3300006358 Bacteria 3231
125 Ga0068871_100106257 3300006358 Bacteria 2356
126 Ga0075428_100016339 3300006844 Bacteria 8201
127 Ga0075428_100070574 3300006844 Bacteria 3818
128 Ga0075428_100139235 3300006844 Unclassified 2638
129 Ga0075428_100145952 3300006844 Bacteria 2571
130 Ga0075428_100190987 3300006844 Bacteria 2215
131 Ga0075430_100007744 3300006846 Bacteria 9074
132 Ga0075430_100115015 3300006846 Bacteria 2241
133 Ga0075430_100605319 3300006846 Bacteria 904
134 Ga0075431_100020669 3300006847 Bacteria 6727
135 Ga0075431_100069583 3300006847 Bacteria 3631
136 Ga0075431_100083232 3300006847 Bacteria 3303
137 Ga0075431_100615222 3300006847 Unclassified 1069
138 Ga0075433_10002455 3300006852 Bacteria 14098
139 Ga0075429_100003757 3300006880 Bacteria 12944
140 Ga0075429_100051014 3300006880 Bacteria 3600
141 Ga0075429_100155789 3300006880 Unclassified 2000
142 Ga0068865_100012078 3300006881 Bacteria 5427
143 Ga0068865_100028344 3300006881 Bacteria 3706
144 Ga0097620_100191623 3300006931 Bacteria 2129
145 Ga0097620_100213280 3300006931 Unclassified 2017
146 Ga0097620_100449267 3300006931 Bacteria 1385
147 Ga0111539_10004011 3300009094 Bacteria 19326
148 Ga0111539_10005096 3300009094 Bacteria 17047
149 Ga0111539_10013230 3300009094 Bacteria 10313
150 Ga0111539_10195755 3300009094 Bacteria 2358
151 Ga0111539_10390484 3300009094 Bacteria 1621
152 Ga0111539_10575540 3300009094 Bacteria 1312
153 Ga0105245_10271128 3300009098 Bacteria 1655
154 Ga0105247_10336071 3300009101 Bacteria 1058
155 Ga0114129_10090374 3300009147 Bacteria 4245
156 Ga0114129_10190433 3300009147 Bacteria 2786
157 Ga0105241_10009923 3300009174 Bacteria 6998
158 Ga0105248_10052553 3300009177 Bacteria 4572
159 Ga0105248_10185753 3300009177 Bacteria 2342
160 Ga0105249_10003271 3300009553 Bacteria 14038
161 Ga0105249_10100276 3300009553 Bacteria 2723
162 Ga0105239_10220043 3300010375 Bacteria 2129
163 Ga0105246_10022021 3300011119 Bacteria 4110
164 Ga0105246_10098052 3300011119 Bacteria 2128
165 Ga0157374_10075403 3300013296 Bacteria 3187
166 Ga0157378_10190804 3300013297 Bacteria 1932
167 Ga0157378_10834757 3300013297 Unclassified 949
168 Ga0163162_10037167 3300013306 Bacteria 4857
169 Ga0163162_10251822 3300013306 Bacteria 1898
170 Ga0157375_10088277 3300013308 Bacteria 3155
171 Ga0157375_10613937 3300013308 Bacteria 1246
172 Ga0163163_10026501 3300014325 Bacteria 5543
173 Ga0163163_10258093 3300014325 Bacteria 1794
174 Ga0157380_10049515 3300014326 Bacteria 3314
175 Ga0157380_10953340 3300014326 Bacteria 888
176 Ga0157379_10274360 3300014968 Bacteria 1534
177 Ga0157379_10737062 3300014968 Bacteria 927
178 Ga0157376_10034535 3300014969 Bacteria 4084
179 Ga0157376_10085263 3300014969 Bacteria 2721
180 Ga0163161_10044739 3300017792 Bacteria 3190
181 Ga0163161_10057043 3300017792 Bacteria 2837
182 Ga0163161_10198590 3300017792 Bacteria 1545
183 Ga0209026_1001143 3300025250 Bacteria 12484
184 Ga0207666_1026657 3300025271 Bacteria 872
185 Ga0209758_1000894 3300025297 Bacteria 40579
186 Ga0209050_1000173 3300025298 Bacteria 149800
187 Ga0209257_1000196 3300025304 Bacteria 149656
188 Ga0207697_10002564 3300025315 Bacteria 9354
189 Ga0207697_10029984 3300025315 Unclassified 2226
190 Ga0207697_10044843 3300025315 Bacteria 1820
191 Ga0207682_10003387 3300025893 Bacteria 6940
192 Ga0207682_10011546 3300025893 Bacteria 3450
193 Ga0207682_10052353 3300025893 Bacteria 1692
194 Ga0207692_10281323 3300025898 Unclassified 1007
195 Ga0207710_10055258 3300025900 Bacteria 1790
196 Ga0207688_10000759 3300025901 Bacteria 16052
197 Ga0207688_10068062 3300025901 Bacteria 2015
198 Ga0207680_10044493 3300025903 Bacteria 2611
199 Ga0207680_10120598 3300025903 Bacteria 1714
200 Ga0207680_10528993 3300025903 Bacteria 841
201 Ga0207645_10001553 3300025907 Bacteria 18788
202 Ga0207645_10009419 3300025907 Bacteria 6756
203 Ga0207643_10002505 3300025908 Bacteria 9927
204 Ga0207643_10113799 3300025908 Bacteria 1596
205 Ga0207684_10865536 3300025910 Bacteria 761
206 Ga0207663_10213330 3300025916 Unclassified 1400
207 Ga0207662_10004023 3300025918 Bacteria 7667
208 Ga0207662_10226664 3300025918 Bacteria 1219
209 Ga0207649_10082384 3300025920 Unclassified 2086
210 Ga0207681_10009196 3300025923 Bacteria 6038
211 Ga0207681_10013412 3300025923 Bacteria 5073
212 Ga0207650_10133590 3300025925 Bacteria 1944
213 Ga0207650_10256832 3300025925 Bacteria 1416
214 Ga0207687_10585910 3300025927 Unclassified 939
215 Ga0207700_10054975 3300025928 Unclassified 2991
216 Ga0207644_10039005 3300025931 Bacteria 3351
217 Ga0207644_10100182 3300025931 Bacteria 2175
218 Ga0207706_10015704 3300025933 Bacteria 6845
219 Ga0207706_10344441 3300025933 Unclassified 1296
220 Ga0207686_10219794 3300025934 Bacteria 1371
221 Ga0207670_10483407 3300025936 Unclassified 1003
222 Ga0207669_10068085 3300025937 Bacteria 2221
223 Ga0207669_10203137 3300025937 Bacteria 1440
224 Ga0207704_10467323 3300025938 Bacteria 1010
225 Ga0207691_10001136 3300025940 Bacteria 26407
226 Ga0207691_10021791 3300025940 Bacteria 6048
227 Ga0207691_10058955 3300025940 Bacteria 3492
228 Ga0207711_10178800 3300025941 Bacteria 1928
229 Ga0207689_10002594 3300025942 Bacteria 16721
230 Ga0207689_10008407 3300025942 Bacteria 8987
231 Ga0207689_10023416 3300025942 Bacteria 5184
232 Ga0207689_10504761 3300025942 Bacteria 1013
233 Ga0207679_10038579 3300025945 Unclassified 3404
234 Ga0207679_10132237 3300025945 Bacteria 2003
235 Ga0207679_10175225 3300025945 Unclassified 1770
236 Ga0207651_10004893 3300025960 Bacteria 6829
237 Ga0207651_10033708 3300025960 Bacteria 3306
238 Ga0207651_10184894 3300025960 Unclassified 1657
239 Ga0207651_10211522 3300025960 Bacteria 1561
240 Ga0207712_10031366 3300025961 Unclassified 3579
241 Ga0207712_10538598 3300025961 Bacteria 1003
242 Ga0207668_10191278 3300025972 Bacteria 1622
243 Ga0207658_10077431 3300025986 Bacteria 2537
244 Ga0207658_10184741 3300025986 Bacteria 1728
245 Ga0207677_10070430 3300026023 Bacteria 2465
246 Ga0207677_10092584 3300026023 Bacteria 2201
247 Ga0207677_10240429 3300026023 Bacteria 1464
248 Ga0207703_10249127 3300026035 Bacteria 1600
249 Ga0207703_10312744 3300026035 Bacteria 1436
250 Ga0207678_10081844 3300026067 Bacteria 2763
251 Ga0207678_10340772 3300026067 Bacteria 1292
252 Ga0207708_10144541 3300026075 Unclassified 1868
253 Ga0207708_10550682 3300026075 Bacteria 973
254 Ga0207702_10061134 3300026078 Bacteria 3212
255 Ga0207641_10082506 3300026088 Unclassified 2793
256 Ga0207641_10137934 3300026088 Bacteria 2197
257 Ga0207648_10127225 3300026089 Bacteria 2241
258 Ga0207648_10211625 3300026089 Bacteria 1721
259 Ga0207648_10473191 3300026089 Bacteria 1143
260 Ga0207676_10014603 3300026095 Bacteria 5655
261 Ga0207676_10265806 3300026095 Bacteria 1551
262 Ga0207676_10330517 3300026095 Unclassified 1402
263 Ga0207674_10066052 3300026116 Unclassified 3645
264 Ga0207675_100000920 3300026118 Bacteria 29365
265 Ga0207675_100048132 3300026118 Bacteria 3980
266 Ga0207675_100088517 3300026118 Unclassified 2908
267 Ga0207675_100425747 3300026118 Bacteria 1312
268 Ga0207683_10000198 3300026121 Bacteria 51725
269 Ga0207683_10033765 3300026121 Bacteria 4446
270 Ga0207683_10468894 3300026121 Unclassified 1162
271 Ga0209813_10005945 3300027866 Bacteria 2995
272 Ga0207428_10001173 3300027907 Bacteria 28216
273 Ga0207428_10014934 3300027907 Bacteria 6728
274 Ga0207428_10029266 3300027907 Bacteria 4567
275 Ga0268266_10718826 3300028379 Bacteria 963
276 Ga0268265_10066426 3300028380 Bacteria 2788
277 Ga0268265_10104645 3300028380 Bacteria 2294
278 Ga0268264_10031544 3300028381 Bacteria 4343
279 Ga0268264_10039280 3300028381 Bacteria 3910
280 Ga0265313_10005222 3300031595 Bacteria 9625
281 Ga0265314_10000503 3300031711 Bacteria 50401
282 Ga0307410_10175207 3300031852 Bacteria 1620
283 Ga0307416_100440855 3300032002 Unclassified 1352
284 Ga0307416_101123165 3300032002 Bacteria 891
285 Ga0307510_10197918 3300033180 Bacteria 1548
286 Ga0373934_0000814 3300035086 Bacteria 11267
287 Ga0373934_0035031 3300035086 Unclassified 1974
288 Ga0373923_0022924 3300035111 Unclassified 2452
289 Ga0373932_0006054 3300035112 Unclassified 2855
290 Ga0373945_0143150 3300035116 Unclassified 965
291 Ga0373953_0295019 3300035117 Bacteria 707
292 Ga0373954_0007108 3300035118 Bacteria 4885
293 Ga0373955_0073654 3300035172 Bacteria 1915
294 Ga0373924_0124548 3300035410 Unclassified 1119
295 Ga0373931_0058648 3300035691 Unclassified 2068
296 Ga0373927_0025858 3300035695 Bacteria 3837
297 Ga0373933_0003665 3300035724 Bacteria 8503
298 Ga0373947_0006710 3300035725 Bacteria 6677
299 Ga0373937_0013322 3300036401 Bacteria 7244
300 Ga0373937_0035454 3300036401 Unclassified 4541
301 Ga0373937_0050128 3300036401 Unclassified 3823
302 Ga0373937_0917872 3300036401 Bacteria 824
303 Ga0373925_0004186 3300037068 Bacteria 10950
304 Ga0439453_0012244 3300041408 Bacteria 1442
305 Ga0451807_2351741 3300041486 Bacteria 2328
306 Ga0450920_010012 3300042122 Bacteria 1753
307 Ga0450894_004141 3300042131 Bacteria 1889
308 Ga0450895_010370 3300042132 Bacteria 795
309 Ga0450896_001232 3300042133 Unclassified 3088
310 Ga0439435_0003386 3300042436 Unclassified 3314
311 Ga0439435_0021357 3300042436 Bacteria 1680
312 Ga0451577_0071441 3300042876 Bacteria 3095
313 Ga0453684_0056378 3300044712 Bacteria 5097
314 Ga0451576_0017425 3300045051 Bacteria 7898
315 Ga0495628_0172656 3300046516 Bacteria 1639
316 Ga0495630_0006036 3300046517 Bacteria 8580
317 Ga0495666_0021823 3300046526 Unclassified 3169
318 Ga0495652_0020257 3300046529 Bacteria 5913
319 Ga0495645_0095217 3300046543 Bacteria 2123
320 Ga0495667_0031996 3300046559 Bacteria 3528
321 Ga0495668_0029306 3300046616 Bacteria 3111
322 Ga0495599_0000984 3300046678 Bacteria 15958
323 Ga0495613_0223027 3300046689 Bacteria 1323
324 Ga0495613_0330469 3300046689 Unclassified 1051
325 Ga0495670_0440186 3300046691 Bacteria 706
326 Ga0495676_0528634 3300047321 Unclassified 772
327 Ga0495675_0178125 3300047444 Unclassified 1303
328 Ga0495686_0001454 3300047472 Bacteria 25799
329 Ga0496100_0310770 3300048903 Unclassified 1182
330 Ga0496101_0420036 3300048904 Bacteria 1054
331 Ga0496104_0008372 3300048907 Bacteria 9190
332 Ga0496104_0051214 3300048907 Unclassified 3897
333 Ga0496104_0445201 3300048907 Bacteria 1207
334 Ga0496105_0053297 3300048908 Bacteria 3341
335 Ga0496107_0214140 3300048910 Bacteria 1433
336 Ga0496108_0010680 3300048911 Bacteria 7451
337 Ga0496109_0661452 3300048912 Bacteria 982
338 Ga0496111_0030199 3300048914 Bacteria 3854
339 Ga0496112_0006466 3300048915 Bacteria 10289
340 Ga0496113_0090097 3300048916 Bacteria 2362
341 Ga0501073_0056707 3300049589 Unclassified 2740
342 Ga0501080_0161863 3300049742 Bacteria 2067
343 Ga0501081_0171814 3300049743 Unclassified 1565
344 nmdc:mga00v17_154503_c1 3300050491 Bacteria 1475
345 nmdc:mga00v17_48844_c1 3300050491 Bacteria 2565
346 nmdc:mga0yw44_109099_c1 3300050492 Bacteria 1771
347 nmdc:mga0k408_115068_c1 3300050493 Bacteria 1591
348 nmdc:mga0k408_15059_c1 3300050493 Bacteria 4274
349 nmdc:mga0k408_195922_c1 3300050493 Bacteria 1206
350 nmdc:mga06z11_114194_c1 3300050494 Unclassified 1499
351 nmdc:mga06z11_140690_c1 3300050494 Bacteria 1364
352 nmdc:mga06z11_47228_c1 3300050494 Bacteria 2186
353 nmdc:mga04h51_109644_c1 3300050495 Bacteria 1016
354 nmdc:mga07m45_237336_c1 3300050496 Bacteria 1061
355 nmdc:mga07m45_42471_c1 3300050496 Bacteria 2549
356 nmdc:mga07m45_8180_c1 3300050496 Bacteria 5366
357 nmdc:mga05p37_230486_c1 3300050507 Bacteria 2232
358 nmdc:mga05p37_514031_c1 3300050507 Bacteria 1371
359 nmdc:mga05p37_68957_c1 3300050507 Bacteria 4349
360 nmdc:mga09592_238900_c1 3300050508 Unclassified 1574
361 nmdc:mga09592_32443_c1 3300050508 Bacteria 4354
362 nmdc:mga0qj67_111360_c1 3300050509 Unclassified 2210
363 nmdc:mga0qj67_344241_c1 3300050509 Bacteria 1206
364 nmdc:mga0qj67_564695_c1 3300050509 Bacteria 912
365 nmdc:mga06r32_13419_c1 3300050510 Bacteria 7418
366 nmdc:mga06r32_3817_c1 3300050510 Bacteria 13497
367 nmdc:mga06r32_406135_c1 3300050510 Bacteria 1344
368 nmdc:mga06r32_46864_c1 3300050510 Bacteria 4126
369 nmdc:mga08y16_12228_c1 3300050511 Bacteria 9020
370 nmdc:mga08y16_196658_c1 3300050511 Bacteria 2090
371 nmdc:mga08y16_199486_c1 3300050511 Bacteria 2074
372 nmdc:mga08y16_29252_c1 3300050511 Bacteria 5805
373 nmdc:mga08y16_4742_c1 3300050511 Bacteria 14177
374 nmdc:mga0a205_1171_c1 3300050515 Bacteria 21856
375 nmdc:mga0a205_358753_c1 3300050515 Bacteria 1324
376 Ga0495619_0372649 3300053085 Unclassified 987
377 Ga0500593_058017 3300053117 Bacteria 1706
378 Ga0500608_151401 3300053122 Bacteria 1016
379 Ga0500645_003307 3300053730 Bacteria 6634
380 Ga0207706_10192335
381 JGI24746J21847_1000084
382 Ga0055530_10000949
383 Ga0055531_10001263
384 Ga0065165_1001262
385 Ga0065165_1007987
386 Ga0065712_10074444
387 Ga0065715_10001548
388 Ga0065715_10114580
389 Ga0065715_10114673
390 Ga0065707_10127240
391 Ga0070676_10007615
392 Ga0070690_100015807
393 Ga0070690_100052355
394 Ga0070670_100094723
395 Ga0070670_100276665
396 Ga0070677_10019370
397 Ga0070677_10031311
398 Ga0068869_100012760
399 Ga0068869_100013704
400 Ga0068869_100037990
401 Ga0068869_100286514
402 Ga0070666_10111577
403 Ga0068868_100052708
404 Ga0068868_100071607
405 Ga0068868_100106393
406 Ga0070689_100028487
407 Ga0070689_100048471
408 Ga0070687_100011165
409 Ga0070687_100067113
410 Ga0070687_100233022
411 Ga0070661_100068047
412 Ga0070692_10065715
413 Ga0070668_100482539
414 Ga0070669_100005139
415 Ga0070669_100059210
416 Ga0070675_100088655
417 Ga0070675_100147516
418 Ga0070675_100158753
419 Ga0070671_100025017
420 Ga0070671_100057947
421 Ga0070674_100056432
422 Ga0070674_100134042
423 Ga0070673_100044253
424 Ga0070673_100067938
425 Ga0070673_100179971
426 Ga0070673_100235229
427 Ga0070688_100007734
428 Ga0070688_100023933
429 Ga0070688_100228444
430 Ga0070659_100113075
431 Ga0070667_100014589
432 Ga0070667_100100380
433 Ga0070667_100209497
434 Ga0070713_100068712
435 Ga0070710_10440458
436 Ga0070701_10042007
437 Ga0070711_100088926
438 Ga0070700_100194467
439 Ga0070694_100154217
440 Ga0070663_100058585
441 Ga0070663_100273359
442 Ga0070678_100014929
443 Ga0070678_100019608
444 Ga0070678_100201841
445 Ga0070662_100368907
446 Ga0068867_100020075
447 Ga0068867_100039070
448 Ga0068867_100080868
449 Ga0068867_100131646
450 Ga0070685_10048354
451 Ga0070685_10082835
452 Ga0070698_100263402
453 Ga0070684_100007004
454 Ga0068853_100183805
455 Ga0070672_100015838
456 Ga0070672_100016667
457 Ga0070672_100123565
458 Ga0070686_100003079
459 Ga0070696_100086223
460 Ga0070665_100026057
461 Ga0070665_100049251
462 Ga0070665_100064941
463 Ga0070665_100402954
464 Ga0070704_100371681
465 Ga0070664_100003565
466 Ga0070664_100047696
467 Ga0070664_100220057
468 Ga0070664_100228110
469 Ga0068857_100291633
470 Ga0068854_100120005
471 Ga0068856_100094817
472 Ga0070702_100053457
473 Ga0068852_100140593
474 Ga0068859_100191622
475 Ga0068859_100213297
476 Ga0068859_100449318
477 Ga0068864_100065584
478 Ga0068861_100145715
479 Ga0068861_100197285
480 Ga0068861_100385285
481 Ga0068870_10013263
482 Ga0068870_10213443
483 Ga0068863_100072947
484 Ga0068858_100128521
485 Ga0068858_100129704
486 Ga0068860_100014993
487 Ga0068860_100022983
488 Ga0068860_100170939
489 Ga0068862_100035272
490 Ga0068862_100043224
491 Ga0068862_100074158
492 Ga0068862_100458296
493 Ga0068862_100512850
494 Ga0081455_10136435
495 Ga0075365_10113722
496 Ga0075364_10176473
497 Ga0075367_10048890
498 Ga0075367_10106778
499 Ga0075366_10064118
500 Ga0097621_100069929
501 Ga0075370_10020170
502 Ga0068871_100021214
503 Ga0068871_100054986
504 Ga0068871_100106257
505 Ga0075428_100016339
506 Ga0075428_100070574
507 Ga0075428_100139235
508 Ga0075428_100145952
509 Ga0075428_100190987
510 Ga0075430_100007744
511 Ga0075430_100115015
512 Ga0075430_100605319
513 Ga0075431_100020669
514 Ga0075431_100069583
515 Ga0075431_100083232
516 Ga0075431_100615222
517 Ga0075433_10002455
518 Ga0075429_100003757
519 Ga0075429_100051014
520 Ga0075429_100155789
521 Ga0068865_100012078
522 Ga0068865_100028344
523 Ga0097620_100191623
524 Ga0097620_100213280
525 Ga0097620_100449267
526 Ga0111539_10004011
527 Ga0111539_10005096
528 Ga0111539_10013230
529 Ga0111539_10195755
530 Ga0111539_10390484
531 Ga0111539_10575540
532 Ga0105245_10271128
533 Ga0105247_10336071
534 Ga0114129_10090374
535 Ga0114129_10190433
536 Ga0105241_10009923
537 Ga0105248_10052553
538 Ga0105248_10185753
539 Ga0105249_10003271
540 Ga0105249_10100276
541 Ga0105239_10220043
542 Ga0105246_10022021
543 Ga0105246_10098052
544 Ga0157374_10075403
545 Ga0157378_10190804
546 Ga0157378_10834757
547 Ga0163162_10037167
548 Ga0163162_10251822
549 Ga0157375_10088277
550 Ga0157375_10613937
551 Ga0163163_10026501
552 Ga0163163_10258093
553 Ga0157380_10049515
554 Ga0157380_10953340
555 Ga0157379_10274360
556 Ga0157379_10737062
557 Ga0157376_10034535
558 Ga0157376_10085263
559 Ga0163161_10044739
560 Ga0163161_10057043
561 Ga0163161_10198590
562 Ga0209026_1001143
563 Ga0207666_1026657
564 Ga0209758_1000894
565 Ga0209050_1000173
566 Ga0209257_1000196
567 Ga0207697_10002564
568 Ga0207697_10029984
569 Ga0207697_10044843
570 Ga0207682_10003387
571 Ga0207682_10011546
572 Ga0207682_10052353
573 Ga0207692_10281323
574 Ga0207710_10055258
575 Ga0207688_10000759
576 Ga0207688_10068062
577 Ga0207680_10044493
578 Ga0207680_10120598
579 Ga0207680_10528993
580 Ga0207645_10001553
581 Ga0207645_10009419
582 Ga0207643_10002505
583 Ga0207643_10113799
584 Ga0207684_10865536
585 Ga0207663_10213330
586 Ga0207662_10004023
587 Ga0207662_10226664
588 Ga0207649_10082384
589 Ga0207681_10009196
590 Ga0207681_10013412
591 Ga0207650_10133590
592 Ga0207650_10256832
593 Ga0207687_10585910
594 Ga0207700_10054975
595 Ga0207644_10039005
596 Ga0207644_10100182
597 Ga0207706_10015704
598 Ga0207706_10344441
599 Ga0207686_10219794
600 Ga0207670_10483407
601 Ga0207669_10068085
602 Ga0207669_10203137
603 Ga0207704_10467323
604 Ga0207691_10001136
605 Ga0207691_10021791
606 Ga0207691_10058955
607 Ga0207711_10178800
608 Ga0207689_10002594
609 Ga0207689_10008407
610 Ga0207689_10023416
611 Ga0207689_10504761
612 Ga0207679_10038579
613 Ga0207679_10132237
614 Ga0207679_10175225
615 Ga0207651_10004893
616 Ga0207651_10033708
617 Ga0207651_10184894
618 Ga0207651_10211522
619 Ga0207712_10031366
620 Ga0207712_10538598
621 Ga0207668_10191278
622 Ga0207658_10077431
623 Ga0207658_10184741
624 Ga0207677_10070430
625 Ga0207677_10092584
626 Ga0207677_10240429
627 Ga0207703_10249127
628 Ga0207703_10312744
629 Ga0207678_10081844
630 Ga0207678_10340772
631 Ga0207708_10144541
632 Ga0207708_10550682
633 Ga0207702_10061134
634 Ga0207641_10082506
635 Ga0207641_10137934
636 Ga0207648_10127225
637 Ga0207648_10211625
638 Ga0207648_10473191
639 Ga0207676_10014603
640 Ga0207676_10265806
641 Ga0207676_10330517
642 Ga0207674_10066052
643 Ga0207675_100000920
644 Ga0207675_100048132
645 Ga0207675_100088517
646 Ga0207675_100425747
647 Ga0207683_10000198
648 Ga0207683_10033765
649 Ga0207683_10468894
650 Ga0209813_10005945
651 Ga0207428_10001173
652 Ga0207428_10014934
653 Ga0207428_10029266
654 Ga0268266_10718826
655 Ga0268265_10066426
656 Ga0268265_10104645
657 Ga0268264_10031544
658 Ga0268264_10039280
659 Ga0265313_10005222
660 Ga0265314_10000503
661 Ga0307410_10175207
662 Ga0307416_100440855
663 Ga0307416_101123165
664 Ga0307510_10197918
665 Ga0373934_0000814
666 Ga0373934_0035031
667 Ga0373923_0022924
668 Ga0373932_0006054
669 Ga0373945_0143150
670 Ga0373953_0295019
671 Ga0373954_0007108
672 Ga0373955_0073654
673 Ga0373924_0124548
674 Ga0373931_0058648
675 Ga0373927_0025858
676 Ga0373933_0003665
677 Ga0373947_0006710
678 Ga0373937_0013322
679 Ga0373937_0035454
680 Ga0373937_0050128
681 Ga0373937_0917872
682 Ga0373925_0004186
683 Ga0439453_0012244
684 Ga0451807_2351741
685 Ga0450920_010012
686 Ga0450894_004141
687 Ga0450895_010370
688 Ga0450896_001232
689 Ga0439435_0003386
690 Ga0439435_0021357
691 Ga0451577_0071441
692 Ga0453684_0056378
693 Ga0451576_0017425
694 Ga0495628_0172656
695 Ga0495630_0006036
696 Ga0495666_0021823
697 Ga0495652_0020257
698 Ga0495645_0095217
699 Ga0495667_0031996
700 Ga0495668_0029306
701 Ga0495599_0000984
702 Ga0495613_0223027
703 Ga0495613_0330469
704 Ga0495670_0440186
705 Ga0495676_0528634
706 Ga0495675_0178125
707 Ga0495686_0001454
708 Ga0496100_0310770
709 Ga0496101_0420036
710 Ga0496104_0008372
711 Ga0496104_0051214
712 Ga0496104_0445201
713 Ga0496105_0053297
714 Ga0496107_0214140
715 Ga0496108_0010680
716 Ga0496109_0661452
717 Ga0496111_0030199
718 Ga0496112_0006466
719 Ga0496113_0090097
720 Ga0501073_0056707
721 Ga0501080_0161863
722 Ga0501081_0171814
723 nmdc:mga00v17_154503_c1
724 nmdc:mga00v17_48844_c1
725 nmdc:mga0yw44_109099_c1
726 nmdc:mga0k408_115068_c1
727 nmdc:mga0k408_15059_c1
728 nmdc:mga0k408_195922_c1
729 nmdc:mga06z11_114194_c1
730 nmdc:mga06z11_140690_c1
731 nmdc:mga06z11_47228_c1
732 nmdc:mga04h51_109644_c1
733 nmdc:mga07m45_237336_c1
734 nmdc:mga07m45_42471_c1
735 nmdc:mga07m45_8180_c1
736 nmdc:mga05p37_230486_c1
737 nmdc:mga05p37_514031_c1
738 nmdc:mga05p37_68957_c1
739 nmdc:mga09592_238900_c1
740 nmdc:mga09592_32443_c1
741 nmdc:mga0qj67_111360_c1
742 nmdc:mga0qj67_344241_c1
743 nmdc:mga0qj67_564695_c1
744 nmdc:mga06r32_13419_c1
745 nmdc:mga06r32_3817_c1
746 nmdc:mga06r32_406135_c1
747 nmdc:mga06r32_46864_c1
748 nmdc:mga08y16_12228_c1
749 nmdc:mga08y16_196658_c1
750 nmdc:mga08y16_199486_c1
751 nmdc:mga08y16_29252_c1
752 nmdc:mga08y16_4742_c1
753 nmdc:mga0a205_1171_c1
754 nmdc:mga0a205_358753_c1
755 Ga0495619_0372649
756 Ga0500593_058017
757 Ga0500608_151401
758 Ga0500645_003307

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00174

Oxidored_molyb

Oxidoreductase molybdopterin binding domain

93

237

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
2bpb-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella 0.9008 94 225
2c9x-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella y236f mutant 0.898 94 225
1xdy-assembly7.cif.gz_G structural and biochemical identification of a novel bacterial oxidoreductase, w-containing cofactor 0.898 96 224
2ca4-assembly1.cif.gz_A sulfite dehydrogenase from starkeya novella mutant 0.8956 94 225
1xdq-assembly3.cif.gz_C structural and biochemical identification of a novel bacterial oxidoreductase 0.8944 96 224
ID Description Score Start End Superfamily
1xdyH00 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9101 96 224 3.90.420.10
2ca4A01 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.9026 94 225 3.90.420.10
af_P96400_291_442_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8546 94 225 3.90.420.10
af_I1N786_1_262_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.835 97 234 3.90.420.10
af_P11035_116_359_3.90.420.10 Alpha Beta;Alpha-Beta Complex;Sulfite Oxidase; Chain A, domain 2;Oxidoreductase, molybdopterin-binding domain 0.8149 69 225 3.90.420.10
ID Description Score Start End GO Terms
AF-A0A6I4SVQ0-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9426 78 205
AF-A0A3D0WIJ7-F1-model_v4 deleted 0.9401 85 229
AF-A0A832WPZ1-F1-model_v4 Molybdopterin-dependent oxidoreductase 0.9239 97 224
AF-A0A534HTF7-F1-model_v4 Oxidoreductase molybdopterin-binding domain-containing protein 0.9235 102 229
AF-A0A2I0NV58-F1-model_v4 Oxidoreductase 0.9229 104 224

Map