F428356

General Info

Members Datasets Scaffolds Average Seq Length
379 215 758 40

Family's Representative Sequence

Representative Sequence 3300013296|Ga0157374_11505802|Ga0157374_115058022
Length 44
Sequence MTFMDEEDKVNHPREDDRNEQVDESPVPDPEAKDTDAGDDPQAD

Samples

Sample ID Description Type Environment
1 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
2 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
3 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
4 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
5 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
6 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
7 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
8 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
9 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
10 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
11 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
12 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
13 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
14 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
15 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
16 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
17 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
18 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
19 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
20 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
21 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
22 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
23 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
24 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
25 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
26 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
27 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
28 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
29 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
30 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
31 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
32 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
33 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
34 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
35 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
36 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
37 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
38 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
39 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
40 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
41 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
42 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
43 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
44 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
45 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
46 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
47 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
48 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
49 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
50 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
51 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
52 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
53 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
54 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
55 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
56 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
57 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
58 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
59 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
60 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
61 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
62 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
83 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
84 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
95 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
96 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
97 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
98 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
99 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
100 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
101 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
102 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
103 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
104 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
105 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
106 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
107 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
108 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
109 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
110 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
111 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
112 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
113 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
114 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
115 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
116 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
117 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
118 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
119 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
123 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
124 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
125 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
126 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
127 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
128 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
129 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
130 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
131 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
132 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
133 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
134 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
135 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
136 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
137 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
138 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
139 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
140 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
141 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
142 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
143 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
144 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
145 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
146 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
147 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
148 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
149 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
150 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
151 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
152 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
156 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
157 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
158 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
159 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
160 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
161 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
162 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
163 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
164 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
165 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
166 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
167 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
168 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
169 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
170 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
171 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
172 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
173 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
174 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
175 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
176 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
177 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
178 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
179 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
180 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
181 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
182 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
183 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
184 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
185 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
186 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
187 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
188 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
189 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
190 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
191 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
192 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
193 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
194 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
195 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
196 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
197 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
198 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
199 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
200 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
201 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
202 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
203 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
204 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
205 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
206 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
207 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
208 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
209 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
210 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
211 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
212 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
213 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
214 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
215 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.21
Metatranscriptomes 0.79
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 16.36
Rhizosphere 83.11
Stem 0
Stem Tuber 0
Unclassified 10.03

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0157374_11505802 3300013296 Bacteria 696
2 Ga0070658_10038710 3300005327 Bacteria 3845
3 Ga0070683_100018340 3300005329 Bacteria 6196
4 Ga0070683_100360415 3300005329 Bacteria 1385
5 Ga0068868_100656024 3300005338 Bacteria 935
6 Ga0070660_101325719 3300005339 Bacteria 611
7 Ga0070661_101466075 3300005344 Unclassified 575
8 Ga0070671_100096767 3300005355 Bacteria 2475
9 Ga0070709_11780900 3300005434 Bacteria 504
10 Ga0070714_100185214 3300005435 Bacteria 1897
11 Ga0070710_10207348 3300005437 Bacteria 1241
12 Ga0070711_100046831 3300005439 Bacteria 2949
13 Ga0070678_100719443 3300005456 Bacteria 901
14 Ga0070706_100082511 3300005467 Bacteria 2978
15 Ga0070707_100606780 3300005468 Bacteria 1057
16 Ga0070679_100512376 3300005530 Bacteria 1144
17 Ga0068853_101663283 3300005539 Bacteria 619
18 Ga0070696_101223708 3300005546 Bacteria 635
19 Ga0070693_101054031 3300005547 Bacteria 618
20 Ga0070693_101138042 3300005547 Bacteria 597
21 Ga0070693_101434351 3300005547 Bacteria 538
22 Ga0068855_102519960 3300005563 Bacteria 511
23 Ga0068854_100763659 3300005578 Bacteria 840
24 Ga0068856_100045358 3300005614 Bacteria 4328
25 Ga0068856_100738064 3300005614 Bacteria 1005
26 Ga0070702_100805258 3300005615 Bacteria 727
27 Ga0068864_100385022 3300005618 Bacteria 1330
28 Ga0068863_102255936 3300005841 Bacteria 554
29 Ga0070716_100533762 3300006173 Bacteria 872
30 Ga0070716_101234811 3300006173 Unclassified 602
31 Ga0070712_100084429 3300006175 Bacteria 2309
32 Ga0070712_101225794 3300006175 Bacteria 653
33 Ga0097621_101481893 3300006237 Bacteria 644
34 Ga0068871_100333172 3300006358 Bacteria 1339
35 Ga0068871_101868431 3300006358 Bacteria 571
36 Ga0105245_10488725 3300009098 Bacteria 1245
37 Ga0105245_11231109 3300009098 Bacteria 797
38 Ga0105243_10425615 3300009148 Bacteria 1240
39 Ga0105237_11755005 3300009545 Bacteria 628
40 Ga0105237_11811825 3300009545 Bacteria 618
41 Ga0105239_10682504 3300010375 Bacteria 1174
42 Ga0105239_11931687 3300010375 Unclassified 685
43 Ga0105246_10300731 3300011119 Bacteria 1295
44 Ga0157370_10655025 3300013104 Unclassified 960
45 Ga0157370_10697947 3300013104 Bacteria 926
46 Ga0157369_10004273 3300013105 Bacteria 16886
47 Ga0157374_10462697 3300013296 Bacteria 1270
48 Ga0157378_10103140 3300013297 Bacteria 2606
49 Ga0163162_10364608 3300013306 Bacteria 1578
50 Ga0157375_10891017 3300013308 Unclassified 1034
51 Ga0182008_10036238 3300014497 Bacteria 2469
52 Ga0157377_10086025 3300014745 Bacteria 1847
53 Ga0157376_10029750 3300014969 Bacteria 4354
54 Ga0182007_10085309 3300015262 Bacteria 1037
55 Ga0197907_10436757 3300020069 Bacteria 796
56 Ga0197907_11192729 3300020069 Bacteria 631
57 Ga0224712_10237356 3300022467 Unclassified 839
58 Ga0207653_10023817 3300025885 Bacteria 1952
59 Ga0207692_10052273 3300025898 Bacteria 2076
60 Ga0207692_10432206 3300025898 Bacteria 826
61 Ga0207642_10140354 3300025899 Unclassified 1273
62 Ga0207710_10045067 3300025900 Bacteria 1966
63 Ga0207680_10069640 3300025903 Bacteria 2174
64 Ga0207699_10044550 3300025906 Bacteria 2583
65 Ga0207684_10223091 3300025910 Bacteria 1626
66 Ga0207654_10064536 3300025911 Bacteria 2153
67 Ga0207671_10154478 3300025914 Bacteria 1774
68 Ga0207693_10006660 3300025915 Bacteria 9543
69 Ga0207693_10018544 3300025915 Bacteria 5540
70 Ga0207663_10045596 3300025916 Bacteria 2697
71 Ga0207663_10287566 3300025916 Bacteria 1223
72 Ga0207662_10120233 3300025918 Bacteria 1647
73 Ga0207657_10023695 3300025919 Bacteria 5709
74 Ga0207657_10591425 3300025919 Bacteria 866
75 Ga0207657_11057404 3300025919 Bacteria 621
76 Ga0207649_11487146 3300025920 Unclassified 536
77 Ga0207652_10673673 3300025921 Unclassified 924
78 Ga0207681_10083716 3300025923 Bacteria 2259
79 Ga0207694_10100144 3300025924 Bacteria 2296
80 Ga0207687_10035558 3300025927 Bacteria 3389
81 Ga0207687_10418942 3300025927 Unclassified 1105
82 Ga0207664_10583365 3300025929 Unclassified 1004
83 Ga0207664_10650435 3300025929 Unclassified 947
84 Ga0207664_10851634 3300025929 Bacteria 819
85 Ga0207644_10068037 3300025931 Bacteria 2597
86 Ga0207644_10102039 3300025931 Bacteria 2157
87 Ga0207690_10094931 3300025932 Bacteria 2117
88 Ga0207686_10141211 3300025934 Bacteria 1665
89 Ga0207686_11396194 3300025934 Bacteria 576
90 Ga0207709_10050128 3300025935 Bacteria 2552
91 Ga0207670_10031291 3300025936 Bacteria 3408
92 Ga0207669_10060694 3300025937 Bacteria 2319
93 Ga0207704_10007914 3300025938 Bacteria 5050
94 Ga0207704_10779488 3300025938 Bacteria 797
95 Ga0207665_10291945 3300025939 Bacteria 1216
96 Ga0207665_11680095 3300025939 Unclassified 503
97 Ga0207691_11089905 3300025940 Bacteria 665
98 Ga0207711_10023465 3300025941 Bacteria 5164
99 Ga0207711_10556440 3300025941 Bacteria 1070
100 Ga0207661_10839066 3300025944 Unclassified 846
101 Ga0207661_11074552 3300025944 Unclassified 741
102 Ga0207679_10588875 3300025945 Bacteria 1001
103 Ga0207667_10582310 3300025949 Unclassified 1130
104 Ga0207651_10155383 3300025960 Bacteria 1786
105 Ga0207712_10012620 3300025961 Bacteria 5399
106 Ga0207668_10016000 3300025972 Bacteria 4673
107 Ga0207640_10701167 3300025981 Bacteria 868
108 Ga0207658_10230600 3300025986 Bacteria 1563
109 Ga0207677_10019796 3300026023 Bacteria 4073
110 Ga0207677_10445800 3300026023 Unclassified 1108
111 Ga0207677_10755382 3300026023 Bacteria 867
112 Ga0207703_10379649 3300026035 Bacteria 1307
113 Ga0207639_10230739 3300026041 Bacteria 1604
114 Ga0207639_10307190 3300026041 Bacteria 1404
115 Ga0207678_10014900 3300026067 Bacteria 6838
116 Ga0207708_10000618 3300026075 Bacteria 27289
117 Ga0207702_10019768 3300026078 Bacteria 5576
118 Ga0207702_10025845 3300026078 Bacteria 4874
119 Ga0207702_10086773 3300026078 Bacteria 2730
120 Ga0207702_10542817 3300026078 Bacteria 1137
121 Ga0207648_10003274 3300026089 Bacteria 17031
122 Ga0207674_12300960 3300026116 Unclassified 501
123 Ga0207675_100599860 3300026118 Bacteria 1104
124 Ga0207683_10006342 3300026121 Bacteria 10133
125 Ga0207683_10827273 3300026121 Bacteria 860
126 Ga0207698_10027092 3300026142 Bacteria 4064
127 Ga0268266_10037942 3300028379 Bacteria 4103
128 Ga0268265_10080954 3300028380 Bacteria 2563
129 Ga0268264_10130380 3300028381 Bacteria 2228
130 Ga0265319_1000701 3300028563 Bacteria 21865
131 Ga0265334_10226916 3300028573 Bacteria 645
132 Ga0265318_10005495 3300028577 Bacteria 5949
133 Ga0265318_10101287 3300028577 Bacteria 1060
134 Ga0265322_10003901 3300028654 Bacteria 4473
135 Ga0265330_10218145 3300031235 Bacteria 805
136 Ga0265328_10111675 3300031239 Bacteria 1016
137 Ga0265329_10064148 3300031242 Bacteria 1162
138 Ga0265340_10195792 3300031247 Bacteria 910
139 Ga0265339_10148387 3300031249 Bacteria 1188
140 Ga0265327_10493862 3300031251 Bacteria 528
141 Ga0265316_10082970 3300031344 Bacteria 2455
142 Ga0265314_10029644 3300031711 Bacteria 4062
143 Ga0265342_10010175 3300031712 Bacteria 6550
144 Ga0373960_0052737 3300035121 Bacteria 1212
145 Ga0373955_0227155 3300035172 Bacteria 1116
146 Ga0373947_0873639 3300035725 Unclassified 614
147 Ga0373925_1453955 3300037068 Bacteria 561
148 Ga0395899_0411243 3300037312 Bacteria 893
149 Ga0395900_0020635 3300037418 Bacteria 6732
150 Ga0395900_0125965 3300037418 Bacteria 2627
151 Ga0395898_0338423 3300037466 Bacteria 1435
152 Ga0395898_0443192 3300037466 Bacteria 1237
153 Ga0395898_0642097 3300037466 Bacteria 1004
154 Ga0395898_0874446 3300037466 Unclassified 837
155 Ga0395901_0092166 3300038443 Bacteria 3172
156 Ga0395901_0508165 3300038443 Bacteria 1226
157 Ga0436360_1242120 3300039438 Bacteria 6465
158 Ga0436363_0604770 3300039450 Unclassified 579
159 Ga0451845_0767187 3300041501 Bacteria 576
160 Ga0466969_0097096 3300044656 Bacteria 1390
161 Ga0466969_0150394 3300044656 Bacteria 1073
162 Ga0466972_0064080 3300044658 Bacteria 1760
163 Ga0466965_0292513 3300044683 Bacteria 882
164 Ga0466966_0020354 3300044684 Bacteria 4365
165 Ga0466966_0032511 3300044684 Bacteria 3380
166 Ga0466966_0867575 3300044684 Bacteria 544
167 Ga0466961_0022430 3300044693 Bacteria 4061
168 Ga0466961_0050200 3300044693 Bacteria 2664
169 Ga0466961_0330915 3300044693 Bacteria 928
170 Ga0466961_0436003 3300044693 Bacteria 793
171 Ga0466961_0947538 3300044693 Bacteria 512
172 Ga0466963_0012229 3300044694 Bacteria 5249
173 Ga0466963_0100770 3300044694 Bacteria 1977
174 Ga0466963_0153148 3300044694 Bacteria 1602
175 Ga0466963_0477288 3300044694 Bacteria 880
176 Ga0466964_0038338 3300044706 Bacteria 1926
177 Ga0466964_0076017 3300044706 Bacteria 1431
178 Ga0466964_0086580 3300044706 Bacteria 1355
179 Ga0466964_0214802 3300044706 Unclassified 931
180 Ga0466964_0372647 3300044706 Unclassified 739
181 Ga0466964_0419757 3300044706 Unclassified 703
182 Ga0466964_0435409 3300044706 Bacteria 692
183 Ga0466971_0008684 3300044719 Bacteria 4432
184 Ga0466971_0015858 3300044719 Bacteria 3319
185 Ga0466968_0054004 3300044735 Bacteria 1722
186 Ga0466968_0069646 3300044735 Bacteria 1529
187 Ga0466957_0530828 3300044842 Bacteria 818
188 Ga0466957_1018407 3300044842 Bacteria 595
189 Ga0466957_1177606 3300044842 Bacteria 554
190 Ga0466957_1241852 3300044842 Bacteria 540
191 Ga0466960_0222266 3300044901 Bacteria 1040
192 Ga0466960_0351787 3300044901 Unclassified 840
193 Ga0466960_0426147 3300044901 Bacteria 768
194 Ga0466960_0597465 3300044901 Bacteria 655
195 Ga0466960_0614510 3300044901 Bacteria 646
196 Ga0466960_0903651 3300044901 Bacteria 539
197 Ga0466959_0004458 3300045049 Bacteria 9376
198 Ga0466959_0139677 3300045049 Bacteria 1713
199 Ga0466959_0281139 3300045049 Bacteria 1142
200 Ga0466959_0629840 3300045049 Bacteria 720
201 Ga0466959_0695547 3300045049 Bacteria 681
202 Ga0466959_0804268 3300045049 Bacteria 628
203 Ga0466958_0044814 3300045836 Bacteria 2666
204 Ga0466958_0051749 3300045836 Bacteria 2487
205 Ga0466958_0125954 3300045836 Bacteria 1606
206 Ga0466967_0056892 3300045976 Bacteria 3450
207 Ga0466967_0057061 3300045976 Bacteria 3445
208 Ga0466967_0064153 3300045976 Bacteria 3266
209 Ga0466967_0132118 3300045976 Bacteria 2318
210 Ga0466967_0151015 3300045976 Bacteria 2171
211 Ga0466967_0160988 3300045976 Bacteria 2106
212 Ga0466967_0165426 3300045976 Bacteria 2078
213 Ga0466967_0398622 3300045976 Bacteria 1338
214 Ga0466967_1457343 3300045976 Bacteria 682
215 Ga0466967_1955320 3300045976 Bacteria 583
216 Ga0495592_0022653 3300046454 Bacteria 4778
217 Ga0495629_0287631 3300046459 Bacteria 1127
218 Ga0495641_0486972 3300046461 Bacteria 562
219 Ga0495651_0040460 3300046462 Bacteria 3625
220 Ga0495651_0106823 3300046462 Bacteria 2074
221 Ga0495651_0251287 3300046462 Bacteria 1207
222 Ga0495651_0376428 3300046462 Bacteria 932
223 Ga0495653_0416292 3300046463 Bacteria 851
224 Ga0495582_0027206 3300046473 Bacteria 3134
225 Ga0495605_0078788 3300046474 Bacteria 1544
226 Ga0495664_0020093 3300046477 Bacteria 3848
227 Ga0495664_0060315 3300046477 Bacteria 2259
228 Ga0495584_0156406 3300046491 Unclassified 1158
229 Ga0495596_0090695 3300046500 Unclassified 1186
230 Ga0495607_0290324 3300046501 Bacteria 773
231 Ga0495608_0014863 3300046511 Bacteria 5401
232 Ga0495608_0448189 3300046511 Bacteria 785
233 Ga0495608_0449178 3300046511 Bacteria 784
234 Ga0495618_0676099 3300046514 Bacteria 609
235 Ga0495628_0049284 3300046516 Bacteria 3335
236 Ga0495628_0127518 3300046516 Bacteria 1948
237 Ga0495630_0040677 3300046517 Bacteria 3474
238 Ga0495637_0145887 3300046520 Bacteria 896
239 Ga0495644_0041486 3300046523 Bacteria 1733
240 Ga0495666_0148967 3300046526 Bacteria 1089
241 Ga0495642_0041060 3300046528 Bacteria 1881
242 Ga0495652_0014927 3300046529 Bacteria 6961
243 Ga0495652_0062284 3300046529 Bacteria 3146
244 Ga0495640_0183032 3300046533 Bacteria 1334
245 Ga0495640_0938051 3300046533 Bacteria 512
246 Ga0495587_0020351 3300046536 Bacteria 4097
247 Ga0495645_0220027 3300046543 Bacteria 1277
248 Ga0495645_0953707 3300046543 Unclassified 507
249 Ga0495667_0075402 3300046559 Bacteria 2195
250 Ga0495667_0150341 3300046559 Bacteria 1499
251 Ga0495667_0154876 3300046559 Bacteria 1475
252 Ga0495656_0093264 3300046615 Bacteria 1380
253 Ga0495634_0030172 3300046642 Bacteria 3747
254 Ga0495635_0109192 3300046663 Bacteria 1890
255 Ga0495635_0738306 3300046663 Unclassified 637
256 Ga0495657_0020195 3300046675 Bacteria 4792
257 Ga0495657_0044822 3300046675 Bacteria 3005
258 Ga0495657_0837747 3300046675 Bacteria 524
259 Ga0495599_0054061 3300046678 Bacteria 2515
260 Ga0495599_0741403 3300046678 Bacteria 564
261 Ga0495623_0124317 3300046679 Bacteria 1550
262 Ga0495646_0072687 3300046680 Bacteria 2022
263 Ga0495658_1052645 3300046683 Bacteria 519
264 Ga0495669_0673574 3300046684 Bacteria 503
265 Ga0495613_0384933 3300046689 Unclassified 959
266 Ga0495613_0646074 3300046689 Bacteria 700
267 Ga0495671_0652550 3300046692 Bacteria 500
268 Ga0495589_0038038 3300046794 Bacteria 2410
269 Ga0495581_0460718 3300047315 Bacteria 740
270 Ga0495604_0253434 3300047317 Bacteria 1199
271 Ga0495636_0647607 3300047318 Bacteria 519
272 Ga0495674_0091857 3300047319 Bacteria 2592
273 Ga0495680_0002078 3300047322 Bacteria 20832
274 Ga0495680_0172729 3300047322 Bacteria 1564
275 Ga0495680_0213571 3300047322 Bacteria 1380
276 Ga0495602_0081040 3300048088 Bacteria 2731
277 Ga0495614_0142788 3300048089 Bacteria 1065
278 Ga0496100_0001352 3300048903 Bacteria 12009
279 Ga0496100_0005000 3300048903 Bacteria 7094
280 Ga0496100_0411581 3300048903 Bacteria 1031
281 Ga0496100_0483360 3300048903 Bacteria 953
282 Ga0496101_0040776 3300048904 Bacteria 3307
283 Ga0496101_0058101 3300048904 Bacteria 2799
284 Ga0496101_0228416 3300048904 Bacteria 1446
285 Ga0496101_0748100 3300048904 Bacteria 771
286 Ga0496101_1482446 3300048904 Bacteria 528
287 Ga0496102_0010808 3300048905 Bacteria 7862
288 Ga0496102_0069751 3300048905 Bacteria 3226
289 Ga0496102_0637525 3300048905 Bacteria 989
290 Ga0496103_0017006 3300048906 Bacteria 4346
291 Ga0496103_0037154 3300048906 Bacteria 2984
292 Ga0496104_0004275 3300048907 Bacteria 12413
293 Ga0496104_0028004 3300048907 Bacteria 5219
294 Ga0496104_0285669 3300048907 Bacteria 1562
295 Ga0496104_0680734 3300048907 Unclassified 937
296 Ga0496104_0959309 3300048907 Bacteria 759
297 Ga0496105_0010579 3300048908 Bacteria 7257
298 Ga0496105_0026367 3300048908 Bacteria 4740
299 Ga0496105_0053995 3300048908 Bacteria 3318
300 Ga0496105_0276352 3300048908 Bacteria 1355
301 Ga0496106_0003498 3300048909 Bacteria 11702
302 Ga0496106_0009705 3300048909 Bacteria 7107
303 Ga0496106_0560357 3300048909 Unclassified 917
304 Ga0496107_0019194 3300048910 Bacteria 4823
305 Ga0496107_0022775 3300048910 Bacteria 4428
306 Ga0496107_0383231 3300048910 Unclassified 1046
307 Ga0496108_0009015 3300048911 Bacteria 8082
308 Ga0496108_0107572 3300048911 Bacteria 2381
309 Ga0496108_0276664 3300048911 Bacteria 1461
310 Ga0496108_0304074 3300048911 Bacteria 1389
311 Ga0496109_0010553 3300048912 Bacteria 7897
312 Ga0496109_0028341 3300048912 Bacteria 5007
313 Ga0496109_0287552 3300048912 Bacteria 1550
314 Ga0496110_0020374 3300048913 Bacteria 5600
315 Ga0496110_0247265 3300048913 Bacteria 1623
316 Ga0496110_0408595 3300048913 Bacteria 1238
317 Ga0496110_1071485 3300048913 Unclassified 714
318 Ga0496110_1203674 3300048913 Bacteria 666
319 Ga0496111_0055728 3300048914 Bacteria 2859
320 Ga0496111_0178196 3300048914 Bacteria 1580
321 Ga0496111_0443688 3300048914 Bacteria 958
322 Ga0496112_0013424 3300048915 Bacteria 7561
323 Ga0496112_0201230 3300048915 Bacteria 1951
324 Ga0496112_0225706 3300048915 Bacteria 1828
325 Ga0496112_0968641 3300048915 Bacteria 771
326 Ga0496112_1436402 3300048915 Bacteria 604
327 Ga0496113_0106299 3300048916 Bacteria 2180
328 Ga0496113_0156134 3300048916 Bacteria 1802
329 Ga0496113_0208197 3300048916 Bacteria 1556
330 Ga0496113_0674397 3300048916 Unclassified 826
331 Ga0496114_0002127 3300048917 Bacteria 15061
332 Ga0496114_0004033 3300048917 Bacteria 11338
333 Ga0496114_0513316 3300048917 Unclassified 1060
334 Ga0496114_0676167 3300048917 Bacteria 906
335 Ga0496114_1259779 3300048917 Bacteria 626
336 Ga0496115_0005139 3300048918 Bacteria 9519
337 Ga0496115_0021298 3300048918 Bacteria 5006
338 Ga0496115_0165837 3300048918 Bacteria 1827
339 Ga0496115_0277733 3300048918 Bacteria 1375
340 Ga0501032_0319718 3300049569 Bacteria 1002
341 Ga0501043_0731023 3300049579 Bacteria 721
342 Ga0501043_1121951 3300049579 Bacteria 555
343 Ga0501046_0889130 3300049580 Bacteria 622
344 Ga0501047_0065799 3300049581 Bacteria 3494
345 Ga0501047_0137806 3300049581 Bacteria 2320
346 Ga0501047_0204771 3300049581 Bacteria 1833
347 Ga0501068_0229777 3300049584 Bacteria 1180
348 Ga0501069_0101749 3300049585 Bacteria 1631
349 Ga0501070_0009243 3300049586 Bacteria 8335
350 Ga0501070_0166177 3300049586 Bacteria 1818
351 Ga0501070_0169202 3300049586 Bacteria 1800
352 Ga0501070_0478537 3300049586 Bacteria 1002
353 Ga0501070_0628656 3300049586 Bacteria 854
354 Ga0501070_0915493 3300049586 Unclassified 683
355 Ga0501072_0060759 3300049588 Bacteria 2979
356 Ga0501073_0116023 3300049589 Bacteria 1856
357 Ga0501073_0716318 3300049589 Bacteria 690
358 Ga0501074_0028076 3300049590 Bacteria 4078
359 Ga0501074_0061756 3300049590 Bacteria 2699
360 Ga0501079_0032483 3300049741 Bacteria 4013
361 Ga0501080_0022522 3300049742 Bacteria 5837
362 Ga0501080_0055507 3300049742 Bacteria 3689
363 Ga0501083_0001534 3300049744 Bacteria 15790
364 Ga0501035_0939914 3300049822 Bacteria 683
365 Ga0501035_1369181 3300049822 Bacteria 543
366 Ga0501044_0364942 3300049823 Bacteria 1362
367 Ga0501044_0487042 3300049823 Bacteria 1136
368 nmdc:mga05p37_1662019_c1 3300050507 Bacteria 625
369 Ga0495601_0391864 3300053077 Unclassified 901
370 Ga0495612_0020637 3300053078 Bacteria 2641
371 Ga0495655_0085933 3300053083 Bacteria 908
372 Ga0495595_0010707 3300053084 Bacteria 3819
373 Ga0495595_0407597 3300053084 Bacteria 689
374 Ga0495619_0082699 3300053085 Bacteria 2164
375 Ga0495619_0113727 3300053085 Bacteria 1851
376 Ga0501082_0148447 3300060353 Bacteria 2036
377 Ga0466962_0017317 3300061719 Bacteria 3470
378 Ga0466962_0031762 3300061719 Bacteria 2528
379 Ga0466962_0530151 3300061719 Bacteria 597
380 Ga0157374_11505802
381 Ga0070658_10038710
382 Ga0070683_100018340
383 Ga0070683_100360415
384 Ga0068868_100656024
385 Ga0070660_101325719
386 Ga0070661_101466075
387 Ga0070671_100096767
388 Ga0070709_11780900
389 Ga0070714_100185214
390 Ga0070710_10207348
391 Ga0070711_100046831
392 Ga0070678_100719443
393 Ga0070706_100082511
394 Ga0070707_100606780
395 Ga0070679_100512376
396 Ga0068853_101663283
397 Ga0070696_101223708
398 Ga0070693_101054031
399 Ga0070693_101138042
400 Ga0070693_101434351
401 Ga0068855_102519960
402 Ga0068854_100763659
403 Ga0068856_100045358
404 Ga0068856_100738064
405 Ga0070702_100805258
406 Ga0068864_100385022
407 Ga0068863_102255936
408 Ga0070716_100533762
409 Ga0070716_101234811
410 Ga0070712_100084429
411 Ga0070712_101225794
412 Ga0097621_101481893
413 Ga0068871_100333172
414 Ga0068871_101868431
415 Ga0105245_10488725
416 Ga0105245_11231109
417 Ga0105243_10425615
418 Ga0105237_11755005
419 Ga0105237_11811825
420 Ga0105239_10682504
421 Ga0105239_11931687
422 Ga0105246_10300731
423 Ga0157370_10655025
424 Ga0157370_10697947
425 Ga0157369_10004273
426 Ga0157374_10462697
427 Ga0157378_10103140
428 Ga0163162_10364608
429 Ga0157375_10891017
430 Ga0182008_10036238
431 Ga0157377_10086025
432 Ga0157376_10029750
433 Ga0182007_10085309
434 Ga0197907_10436757
435 Ga0197907_11192729
436 Ga0224712_10237356
437 Ga0207653_10023817
438 Ga0207692_10052273
439 Ga0207692_10432206
440 Ga0207642_10140354
441 Ga0207710_10045067
442 Ga0207680_10069640
443 Ga0207699_10044550
444 Ga0207684_10223091
445 Ga0207654_10064536
446 Ga0207671_10154478
447 Ga0207693_10006660
448 Ga0207693_10018544
449 Ga0207663_10045596
450 Ga0207663_10287566
451 Ga0207662_10120233
452 Ga0207657_10023695
453 Ga0207657_10591425
454 Ga0207657_11057404
455 Ga0207649_11487146
456 Ga0207652_10673673
457 Ga0207681_10083716
458 Ga0207694_10100144
459 Ga0207687_10035558
460 Ga0207687_10418942
461 Ga0207664_10583365
462 Ga0207664_10650435
463 Ga0207664_10851634
464 Ga0207644_10068037
465 Ga0207644_10102039
466 Ga0207690_10094931
467 Ga0207686_10141211
468 Ga0207686_11396194
469 Ga0207709_10050128
470 Ga0207670_10031291
471 Ga0207669_10060694
472 Ga0207704_10007914
473 Ga0207704_10779488
474 Ga0207665_10291945
475 Ga0207665_11680095
476 Ga0207691_11089905
477 Ga0207711_10023465
478 Ga0207711_10556440
479 Ga0207661_10839066
480 Ga0207661_11074552
481 Ga0207679_10588875
482 Ga0207667_10582310
483 Ga0207651_10155383
484 Ga0207712_10012620
485 Ga0207668_10016000
486 Ga0207640_10701167
487 Ga0207658_10230600
488 Ga0207677_10019796
489 Ga0207677_10445800
490 Ga0207677_10755382
491 Ga0207703_10379649
492 Ga0207639_10230739
493 Ga0207639_10307190
494 Ga0207678_10014900
495 Ga0207708_10000618
496 Ga0207702_10019768
497 Ga0207702_10025845
498 Ga0207702_10086773
499 Ga0207702_10542817
500 Ga0207648_10003274
501 Ga0207674_12300960
502 Ga0207675_100599860
503 Ga0207683_10006342
504 Ga0207683_10827273
505 Ga0207698_10027092
506 Ga0268266_10037942
507 Ga0268265_10080954
508 Ga0268264_10130380
509 Ga0265319_1000701
510 Ga0265334_10226916
511 Ga0265318_10005495
512 Ga0265318_10101287
513 Ga0265322_10003901
514 Ga0265330_10218145
515 Ga0265328_10111675
516 Ga0265329_10064148
517 Ga0265340_10195792
518 Ga0265339_10148387
519 Ga0265327_10493862
520 Ga0265316_10082970
521 Ga0265314_10029644
522 Ga0265342_10010175
523 Ga0373960_0052737
524 Ga0373955_0227155
525 Ga0373947_0873639
526 Ga0373925_1453955
527 Ga0395899_0411243
528 Ga0395900_0020635
529 Ga0395900_0125965
530 Ga0395898_0338423
531 Ga0395898_0443192
532 Ga0395898_0642097
533 Ga0395898_0874446
534 Ga0395901_0092166
535 Ga0395901_0508165
536 Ga0436360_1242120
537 Ga0436363_0604770
538 Ga0451845_0767187
539 Ga0466969_0097096
540 Ga0466969_0150394
541 Ga0466972_0064080
542 Ga0466965_0292513
543 Ga0466966_0020354
544 Ga0466966_0032511
545 Ga0466966_0867575
546 Ga0466961_0022430
547 Ga0466961_0050200
548 Ga0466961_0330915
549 Ga0466961_0436003
550 Ga0466961_0947538
551 Ga0466963_0012229
552 Ga0466963_0100770
553 Ga0466963_0153148
554 Ga0466963_0477288
555 Ga0466964_0038338
556 Ga0466964_0076017
557 Ga0466964_0086580
558 Ga0466964_0214802
559 Ga0466964_0372647
560 Ga0466964_0419757
561 Ga0466964_0435409
562 Ga0466971_0008684
563 Ga0466971_0015858
564 Ga0466968_0054004
565 Ga0466968_0069646
566 Ga0466957_0530828
567 Ga0466957_1018407
568 Ga0466957_1177606
569 Ga0466957_1241852
570 Ga0466960_0222266
571 Ga0466960_0351787
572 Ga0466960_0426147
573 Ga0466960_0597465
574 Ga0466960_0614510
575 Ga0466960_0903651
576 Ga0466959_0004458
577 Ga0466959_0139677
578 Ga0466959_0281139
579 Ga0466959_0629840
580 Ga0466959_0695547
581 Ga0466959_0804268
582 Ga0466958_0044814
583 Ga0466958_0051749
584 Ga0466958_0125954
585 Ga0466967_0056892
586 Ga0466967_0057061
587 Ga0466967_0064153
588 Ga0466967_0132118
589 Ga0466967_0151015
590 Ga0466967_0160988
591 Ga0466967_0165426
592 Ga0466967_0398622
593 Ga0466967_1457343
594 Ga0466967_1955320
595 Ga0495592_0022653
596 Ga0495629_0287631
597 Ga0495641_0486972
598 Ga0495651_0040460
599 Ga0495651_0106823
600 Ga0495651_0251287
601 Ga0495651_0376428
602 Ga0495653_0416292
603 Ga0495582_0027206
604 Ga0495605_0078788
605 Ga0495664_0020093
606 Ga0495664_0060315
607 Ga0495584_0156406
608 Ga0495596_0090695
609 Ga0495607_0290324
610 Ga0495608_0014863
611 Ga0495608_0448189
612 Ga0495608_0449178
613 Ga0495618_0676099
614 Ga0495628_0049284
615 Ga0495628_0127518
616 Ga0495630_0040677
617 Ga0495637_0145887
618 Ga0495644_0041486
619 Ga0495666_0148967
620 Ga0495642_0041060
621 Ga0495652_0014927
622 Ga0495652_0062284
623 Ga0495640_0183032
624 Ga0495640_0938051
625 Ga0495587_0020351
626 Ga0495645_0220027
627 Ga0495645_0953707
628 Ga0495667_0075402
629 Ga0495667_0150341
630 Ga0495667_0154876
631 Ga0495656_0093264
632 Ga0495634_0030172
633 Ga0495635_0109192
634 Ga0495635_0738306
635 Ga0495657_0020195
636 Ga0495657_0044822
637 Ga0495657_0837747
638 Ga0495599_0054061
639 Ga0495599_0741403
640 Ga0495623_0124317
641 Ga0495646_0072687
642 Ga0495658_1052645
643 Ga0495669_0673574
644 Ga0495613_0384933
645 Ga0495613_0646074
646 Ga0495671_0652550
647 Ga0495589_0038038
648 Ga0495581_0460718
649 Ga0495604_0253434
650 Ga0495636_0647607
651 Ga0495674_0091857
652 Ga0495680_0002078
653 Ga0495680_0172729
654 Ga0495680_0213571
655 Ga0495602_0081040
656 Ga0495614_0142788
657 Ga0496100_0001352
658 Ga0496100_0005000
659 Ga0496100_0411581
660 Ga0496100_0483360
661 Ga0496101_0040776
662 Ga0496101_0058101
663 Ga0496101_0228416
664 Ga0496101_0748100
665 Ga0496101_1482446
666 Ga0496102_0010808
667 Ga0496102_0069751
668 Ga0496102_0637525
669 Ga0496103_0017006
670 Ga0496103_0037154
671 Ga0496104_0004275
672 Ga0496104_0028004
673 Ga0496104_0285669
674 Ga0496104_0680734
675 Ga0496104_0959309
676 Ga0496105_0010579
677 Ga0496105_0026367
678 Ga0496105_0053995
679 Ga0496105_0276352
680 Ga0496106_0003498
681 Ga0496106_0009705
682 Ga0496106_0560357
683 Ga0496107_0019194
684 Ga0496107_0022775
685 Ga0496107_0383231
686 Ga0496108_0009015
687 Ga0496108_0107572
688 Ga0496108_0276664
689 Ga0496108_0304074
690 Ga0496109_0010553
691 Ga0496109_0028341
692 Ga0496109_0287552
693 Ga0496110_0020374
694 Ga0496110_0247265
695 Ga0496110_0408595
696 Ga0496110_1071485
697 Ga0496110_1203674
698 Ga0496111_0055728
699 Ga0496111_0178196
700 Ga0496111_0443688
701 Ga0496112_0013424
702 Ga0496112_0201230
703 Ga0496112_0225706
704 Ga0496112_0968641
705 Ga0496112_1436402
706 Ga0496113_0106299
707 Ga0496113_0156134
708 Ga0496113_0208197
709 Ga0496113_0674397
710 Ga0496114_0002127
711 Ga0496114_0004033
712 Ga0496114_0513316
713 Ga0496114_0676167
714 Ga0496114_1259779
715 Ga0496115_0005139
716 Ga0496115_0021298
717 Ga0496115_0165837
718 Ga0496115_0277733
719 Ga0501032_0319718
720 Ga0501043_0731023
721 Ga0501043_1121951
722 Ga0501046_0889130
723 Ga0501047_0065799
724 Ga0501047_0137806
725 Ga0501047_0204771
726 Ga0501068_0229777
727 Ga0501069_0101749
728 Ga0501070_0009243
729 Ga0501070_0166177
730 Ga0501070_0169202
731 Ga0501070_0478537
732 Ga0501070_0628656
733 Ga0501070_0915493
734 Ga0501072_0060759
735 Ga0501073_0116023
736 Ga0501073_0716318
737 Ga0501074_0028076
738 Ga0501074_0061756
739 Ga0501079_0032483
740 Ga0501080_0022522
741 Ga0501080_0055507
742 Ga0501083_0001534
743 Ga0501035_0939914
744 Ga0501035_1369181
745 Ga0501044_0364942
746 Ga0501044_0487042
747 nmdc:mga05p37_1662019_c1
748 Ga0495601_0391864
749 Ga0495612_0020637
750 Ga0495655_0085933
751 Ga0495595_0010707
752 Ga0495595_0407597
753 Ga0495619_0082699
754 Ga0495619_0113727
755 Ga0501082_0148447
756 Ga0466962_0017317
757 Ga0466962_0031762
758 Ga0466962_0530151

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Map