F428310

General Info

Members Datasets Scaffolds Average Seq Length
379 227 379 147

Family's Representative Sequence

Representative Sequence 3300006175|Ga0070712_100606240|Ga0070712_1006062402
Length 161
Sequence VTPDSPDPTRTPAPEPDDRSVTELVFDVSERASVLVREEIELAKAEISEKVGKLLRGSAVGVAAGAFAFLALILIMEGVAWLLNEQVFDNSWAGFFVEAAIFLLVAAGAGYFAYRSVQAGAPPVPDQAIEEAKLTRAVLEGESEGTQAASPGSDAGGAGPR

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
6 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
7 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
8 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
9 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
10 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
11 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
12 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
13 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
14 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
15 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
16 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
19 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
23 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
24 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
25 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
26 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
27 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
28 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
29 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
30 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
31 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
32 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
33 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
34 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
35 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
36 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
37 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
38 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
39 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
40 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
41 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
42 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
43 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
44 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
45 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
46 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
47 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
48 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
49 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
50 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
51 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
52 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
53 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
54 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
55 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
56 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
57 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
58 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
59 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
60 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
61 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
62 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
63 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
64 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
65 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
66 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
67 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
68 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
69 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
70 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
85 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
86 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
87 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
90 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
91 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
92 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
94 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
96 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
97 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
98 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
100 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
101 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
102 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
103 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
104 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
105 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
106 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
107 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
108 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
109 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
110 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
111 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
112 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
113 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
114 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
115 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
116 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
117 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
118 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
119 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
120 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
121 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
122 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
123 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
124 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
125 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
126 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
127 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
128 3300032133 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JBrBrA Metagenome Rhizosphere
129 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
130 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
131 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
132 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
133 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
134 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
135 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
136 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
137 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
138 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
139 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
140 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
141 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
142 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
143 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
144 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
145 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
146 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
147 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
148 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
149 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
150 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
151 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
152 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
153 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
154 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
155 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
156 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
157 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
158 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
159 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
160 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
161 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
162 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
163 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
164 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
165 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
166 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
167 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
168 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
169 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
170 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
171 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
172 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
173 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
174 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
175 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
176 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
177 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
178 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
179 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
180 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
181 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
182 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
183 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
184 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
185 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
186 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
187 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
188 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
189 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
190 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
191 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
192 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
193 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
194 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
195 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
196 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
197 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
198 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
199 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
200 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
201 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
202 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
203 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
204 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
205 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
206 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
207 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
208 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
209 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
210 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
211 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
212 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
213 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
214 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
215 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
216 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
217 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
218 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
219 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
220 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
221 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
222 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
223 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
224 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
225 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
226 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
227 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.74
Metatranscriptomes 0.26
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.58
Nodule 0
Rhizoplane 12.14
Rhizosphere 84.43
Stem 0
Stem Tuber 0
Unclassified 1.85

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009317 3300001979 Bacteria 3853
2 JGI24748J21848_1000232 3300002074 Bacteria 6730
3 JGI24742J22300_10000730 3300002244 Bacteria 5001
4 Ga0070683_100024078 3300005329 Bacteria 5448
5 Ga0070683_100369086 3300005329 Bacteria 1367
6 Ga0068869_100225910 3300005334 Bacteria 1486
7 Ga0070680_100291072 3300005336 Bacteria 1384
8 Ga0070680_100868322 3300005336 Bacteria 778
9 Ga0070682_100000009 3300005337 Bacteria 291635
10 Ga0070691_10000003 3300005341 Bacteria 86538
11 Ga0070691_10003056 3300005341 Bacteria 7491
12 Ga0070668_100005535 3300005347 Bacteria 9371
13 Ga0070674_100000006 3300005356 Bacteria 150063
14 Ga0070674_100000660 3300005356 Bacteria 17428
15 Ga0070674_100450954 3300005356 Bacteria 1062
16 Ga0070673_100000704 3300005364 Bacteria 18468
17 Ga0070667_100003653 3300005367 Bacteria 13089
18 Ga0070703_10034425 3300005406 Unclassified 1546
19 Ga0070714_100146157 3300005435 Bacteria 2127
20 Ga0070714_100808270 3300005435 Unclassified 908
21 Ga0070710_10205073 3300005437 Unclassified 1247
22 Ga0070711_100028366 3300005439 Bacteria 3684
23 Ga0070700_100086449 3300005441 Bacteria 2036
24 Ga0070700_100495874 3300005441 Bacteria 938
25 Ga0070663_100016320 3300005455 Bacteria 4820
26 Ga0070678_100017899 3300005456 Bacteria 4577
27 Ga0070662_100000001 3300005457 Bacteria 317995
28 Ga0068867_100000437 3300005459 Bacteria 27827
29 Ga0070679_100000134 3300005530 Bacteria 59591
30 Ga0070679_100005071 3300005530 Bacteria 12162
31 Ga0070684_100044047 3300005535 Bacteria 3858
32 Ga0070684_100372933 3300005535 Bacteria 1314
33 Ga0068853_100004945 3300005539 Bacteria 10382
34 Ga0070686_100033355 3300005544 Bacteria 3164
35 Ga0070695_100307450 3300005545 Bacteria 1174
36 Ga0070695_100954585 3300005545 Bacteria 695
37 Ga0070693_100002496 3300005547 Bacteria 8477
38 Ga0070665_100056281 3300005548 Bacteria 3943
39 Ga0070665_101464694 3300005548 Archaea 691
40 Ga0068855_100200864 3300005563 Bacteria 2244
41 Ga0070664_100490926 3300005564 Bacteria 1131
42 Ga0068857_100173624 3300005577 Bacteria 1960
43 Ga0068854_100573591 3300005578 Bacteria 960
44 Ga0068856_100034850 3300005614 Bacteria 4932
45 Ga0068856_101267357 3300005614 Bacteria 753
46 Ga0070702_101228628 3300005615 Bacteria 605
47 Ga0068859_100301709 3300005617 Bacteria 1695
48 Ga0068866_10000007 3300005718 Bacteria 121729
49 Ga0068866_10009163 3300005718 Bacteria 4196
50 Ga0068863_100036779 3300005841 Bacteria 4662
51 Ga0068863_100051824 3300005841 Bacteria 3889
52 Ga0068863_101543523 3300005841 Bacteria 673
53 Ga0068858_100000329 3300005842 Bacteria 50177
54 Ga0068858_100000763 3300005842 Bacteria 33724
55 Ga0068858_100464563 3300005842 Bacteria 1220
56 Ga0068858_100929770 3300005842 Archaea 851
57 Ga0068860_100005016 3300005843 Bacteria 13475
58 Ga0068860_100698519 3300005843 Bacteria 1024
59 Ga0068862_100005566 3300005844 Bacteria 10523
60 Ga0081455_10015431 3300005937 Bacteria 7421
61 Ga0081540_1000545 3300005983 Bacteria 36477
62 Ga0081540_1044500 3300005983 Bacteria 2265
63 Ga0081539_10001387 3300005985 Bacteria 41711
64 Ga0070715_10000003 3300006163 Bacteria 345282
65 Ga0070716_101148695 3300006173 Bacteria 621
66 Ga0070712_100606240 3300006175 Unclassified 927
67 Ga0097621_101260969 3300006237 Bacteria 697
68 Ga0075430_100452805 3300006846 Bacteria 1059
69 Ga0075431_100349364 3300006847 Bacteria 1487
70 Ga0075433_10002298 3300006852 Bacteria 14559
71 Ga0075434_100225174 3300006871 Bacteria 1895
72 Ga0068865_100080528 3300006881 Bacteria 2336
73 Ga0097620_100301721 3300006931 Bacteria 1695
74 Ga0105245_10000022 3300009098 Bacteria 181225
75 Ga0105245_10000735 3300009098 Bacteria 29523
76 Ga0105247_10000064 3300009101 Bacteria 123994
77 Ga0105247_10112582 3300009101 Bacteria 1753
78 Ga0105243_10046255 3300009148 Bacteria 3423
79 Ga0105243_10517183 3300009148 Bacteria 1134
80 Ga0105242_10000421 3300009176 Bacteria 33769
81 Ga0105242_10005496 3300009176 Bacteria 9784
82 Ga0105242_10014779 3300009176 Bacteria 6045
83 Ga0105242_10793187 3300009176 Bacteria 937
84 Ga0105249_10000054 3300009553 Bacteria 162883
85 Ga0105249_10006797 3300009553 Bacteria 9970
86 Ga0105249_10019317 3300009553 Bacteria 6078
87 Ga0105249_11819301 3300009553 Bacteria 682
88 Ga0157370_10001761 3300013104 Bacteria 26694
89 Ga0157374_10001491 3300013296 Bacteria 19772
90 Ga0157374_10544551 3300013296 Bacteria 1168
91 Ga0157374_10724890 3300013296 Bacteria 1008
92 Ga0157374_11060001 3300013296 Bacteria 831
93 Ga0157378_10125256 3300013297 Bacteria 2373
94 Ga0163162_11326021 3300013306 Bacteria 818
95 Ga0157375_10000153 3300013308 Bacteria 67321
96 Ga0157375_10103110 3300013308 Bacteria 2939
97 Ga0163163_10053467 3300014325 Bacteria 3986
98 Ga0163163_10178162 3300014325 Bacteria 2173
99 Ga0163163_10285623 3300014325 Bacteria 1702
100 Ga0163163_10330611 3300014325 Bacteria 1578
101 Ga0157380_10004516 3300014326 Bacteria 9653
102 Ga0157379_10003657 3300014968 Bacteria 13057
103 Ga0157379_10017532 3300014968 Bacteria 6302
104 Ga0157379_10277687 3300014968 Bacteria 1524
105 Ga0157376_10009596 3300014969 Bacteria 7038
106 Ga0163161_10000013 3300017792 Bacteria 258747
107 Ga0163161_10034584 3300017792 Bacteria 3615
108 Ga0163161_10564192 3300017792 Bacteria 934
109 Ga0206354_10550867 3300020081 Bacteria 579
110 Ga0207682_10000050 3300025893 Bacteria 49908
111 Ga0207642_10000008 3300025899 Bacteria 132651
112 Ga0207642_10000038 3300025899 Bacteria 38220
113 Ga0207642_10009643 3300025899 Bacteria 3368
114 Ga0207710_10000165 3300025900 Bacteria 69714
115 Ga0207710_10215607 3300025900 Bacteria 951
116 Ga0207710_10221626 3300025900 Unclassified 939
117 Ga0207647_10094958 3300025904 Bacteria 1776
118 Ga0207685_10000003 3300025905 Bacteria 344527
119 Ga0207695_10227165 3300025913 Bacteria 1772
120 Ga0207663_10013537 3300025916 Bacteria 4436
121 Ga0207660_10124001 3300025917 Bacteria 1960
122 Ga0207652_10001670 3300025921 Bacteria 19427
123 Ga0207652_10002993 3300025921 Bacteria 14109
124 Ga0207694_10000012 3300025924 Bacteria 411218
125 Ga0207687_10001123 3300025927 Bacteria 18222
126 Ga0207687_10001519 3300025927 Bacteria 15898
127 Ga0207664_10025185 3300025929 Bacteria 4478
128 Ga0207664_10664296 3300025929 Unclassified 937
129 Ga0207644_10166801 3300025931 Bacteria 1716
130 Ga0207706_10000003 3300025933 Bacteria 345011
131 Ga0207686_10000066 3300025934 Bacteria 95095
132 Ga0207686_10002580 3300025934 Bacteria 9850
133 Ga0207686_10013202 3300025934 Bacteria 4567
134 Ga0207686_10346642 3300025934 Bacteria 1117
135 Ga0207686_10579035 3300025934 Bacteria 881
136 Ga0207709_10016389 3300025935 Bacteria 4118
137 Ga0207669_10000010 3300025937 Bacteria 150070
138 Ga0207669_10000475 3300025937 Bacteria 17506
139 Ga0207669_10030772 3300025937 Bacteria 2988
140 Ga0207704_10444020 3300025938 Unclassified 1034
141 Ga0207665_10172452 3300025939 Bacteria 1563
142 Ga0207689_11237718 3300025942 Unclassified 628
143 Ga0207661_10053194 3300025944 Bacteria 3239
144 Ga0207661_11009153 3300025944 Bacteria 766
145 Ga0207679_10116699 3300025945 Bacteria 2117
146 Ga0207667_10470020 3300025949 Bacteria 1277
147 Ga0207651_10056056 3300025960 Bacteria 2710
148 Ga0207712_10000032 3300025961 Bacteria 210628
149 Ga0207712_10001536 3300025961 Bacteria 15630
150 Ga0207712_10903571 3300025961 Bacteria 780
151 Ga0207668_10007541 3300025972 Bacteria 6476
152 Ga0207640_10007455 3300025981 Bacteria 6041
153 Ga0207658_10002943 3300025986 Bacteria 12197
154 Ga0207658_10013444 3300025986 Bacteria 5591
155 Ga0207703_10000070 3300026035 Bacteria 123480
156 Ga0207703_10000122 3300026035 Bacteria 92656
157 Ga0207703_10050430 3300026035 Bacteria 3369
158 Ga0207639_10151020 3300026041 Bacteria 1945
159 Ga0207678_10013059 3300026067 Bacteria 7287
160 Ga0207708_10126034 3300026075 Bacteria 1999
161 Ga0207708_10518623 3300026075 Bacteria 1001
162 Ga0207702_10002891 3300026078 Bacteria 16062
163 Ga0207641_10018787 3300026088 Bacteria 5668
164 Ga0207641_10075503 3300026088 Bacteria 2910
165 Ga0207641_10431729 3300026088 Bacteria 1270
166 Ga0207648_10012153 3300026089 Bacteria 8069
167 Ga0207674_10048809 3300026116 Bacteria 4331
168 Ga0207683_10040813 3300026121 Bacteria 4052
169 Ga0207698_10971915 3300026142 Bacteria 859
170 Ga0268266_10000029 3300028379 Bacteria 424015
171 Ga0268266_10221750 3300028379 Bacteria 1738
172 Ga0268266_10322408 3300028379 Bacteria 1446
173 Ga0268265_10002086 3300028380 Bacteria 15580
174 Ga0268264_10001856 3300028381 Bacteria 19212
175 Ga0268264_10395461 3300028381 Bacteria 1327
176 Ga0265326_10000132 3300028558 Bacteria 38517
177 Ga0265319_1000030 3300028563 Bacteria 129742
178 Ga0265322_10000012 3300028654 Bacteria 152373
179 Ga0265336_10020891 3300028666 Bacteria 2097
180 Ga0265338_10000156 3300028800 Bacteria 125065
181 Ga0265338_11073553 3300028800 Unclassified 543
182 Ga0265324_10025032 3300029957 Bacteria 2118
183 Ga0265324_10058394 3300029957 Bacteria 1320
184 Ga0307511_10086027 3300030521 Bacteria 2169
185 Ga0265328_10003240 3300031239 Bacteria 7215
186 Ga0265320_10000001 3300031240 Bacteria 847191
187 Ga0265325_10008148 3300031241 Bacteria 6209
188 Ga0265340_10263122 3300031247 Bacteria 768
189 Ga0265339_10059904 3300031249 Bacteria 2052
190 Ga0265331_10020602 3300031250 Bacteria 3383
191 Ga0265327_10000003 3300031251 Bacteria 852750
192 Ga0265316_10335947 3300031344 Bacteria 1095
193 Ga0265313_10223760 3300031595 Unclassified 775
194 Ga0265314_10000334 3300031711 Bacteria 66204
195 Ga0316583_10101221 3300032133 Bacteria 1004
196 Ga0373933_0228092 3300035724 Bacteria 1196
197 Ga0373937_0040589 3300036401 Bacteria 4242
198 Ga0451791_1179435 3300041451 Unclassified 685
199 Ga0451853_0570090 3300041512 Bacteria 1878
200 Ga0451853_3198654 3300041512 Bacteria 5929
201 Ga0466963_0250081 3300044694 Bacteria 1244
202 Ga0466957_0807105 3300044842 Bacteria 667
203 Ga0466967_0106900 3300045976 Bacteria 2566
204 Ga0466967_0140208 3300045976 Bacteria 2251
205 Ga0466967_1670661 3300045976 Unclassified 634
206 Ga0495592_0045984 3300046454 Bacteria 3255
207 Ga0495603_0000083 3300046455 Bacteria 42311
208 Ga0495591_047615 3300046458 Bacteria 1186
209 Ga0495629_0001767 3300046459 Bacteria 16948
210 Ga0495629_0004416 3300046459 Bacteria 10538
211 Ga0495629_0355585 3300046459 Unclassified 999
212 Ga0495641_0000010 3300046461 Bacteria 158798
213 Ga0495641_0026769 3300046461 Bacteria 2811
214 Ga0495651_0133065 3300046462 Bacteria 1813
215 Ga0495651_0307470 3300046462 Bacteria 1061
216 Ga0495651_0390242 3300046462 Bacteria 911
217 Ga0495651_0900086 3300046462 Bacteria 541
218 Ga0495653_0012807 3300046463 Bacteria 6847
219 Ga0495653_0266485 3300046463 Bacteria 1130
220 Ga0495582_0000006 3300046473 Bacteria 140434
221 Ga0495639_0549932 3300046475 Bacteria 591
222 Ga0495662_0262446 3300046476 Bacteria 850
223 Ga0495584_0437599 3300046491 Bacteria 665
224 Ga0495608_0000585 3300046511 Bacteria 25014
225 Ga0495608_0066234 3300046511 Bacteria 2365
226 Ga0495608_0080660 3300046511 Bacteria 2115
227 Ga0495608_0698937 3300046511 Bacteria 603
228 Ga0495618_0139173 3300046514 Bacteria 1553
229 Ga0495618_0193515 3300046514 Bacteria 1289
230 Ga0495618_0273992 3300046514 Bacteria 1054
231 Ga0495620_0000782 3300046515 Bacteria 19484
232 Ga0495620_0306923 3300046515 Bacteria 603
233 Ga0495628_0000628 3300046516 Bacteria 32247
234 Ga0495628_0010374 3300046516 Bacteria 7918
235 Ga0495628_0050697 3300046516 Bacteria 3283
236 Ga0495628_0088338 3300046516 Bacteria 2402
237 Ga0495628_0123771 3300046516 Bacteria 1982
238 Ga0495628_0127406 3300046516 Bacteria 1949
239 Ga0495630_0000599 3300046517 Bacteria 26251
240 Ga0495630_0223458 3300046517 Bacteria 1438
241 Ga0495630_0495125 3300046517 Bacteria 937
242 Ga0495630_1092572 3300046517 Bacteria 605
243 Ga0495644_0004542 3300046523 Bacteria 5455
244 Ga0495652_0025744 3300046529 Bacteria 5200
245 Ga0495640_0343978 3300046533 Bacteria 921
246 Ga0495586_0000500 3300046535 Bacteria 23110
247 Ga0495587_0021968 3300046536 Bacteria 3933
248 Ga0495598_0000588 3300046537 Bacteria 6867
249 Ga0495621_0171866 3300046539 Bacteria 861
250 Ga0495645_0046611 3300046543 Bacteria 3159
251 Ga0495645_0047978 3300046543 Bacteria 3111
252 Ga0495667_0155885 3300046559 Bacteria 1470
253 Ga0495667_0209035 3300046559 Bacteria 1247
254 Ga0495667_0503757 3300046559 Bacteria 758
255 Ga0495625_0000029 3300046660 Bacteria 244646
256 Ga0495657_0010730 3300046675 Bacteria 6887
257 Ga0495599_0001797 3300046678 Bacteria 12445
258 Ga0495623_0467538 3300046679 Unclassified 669
259 Ga0495647_0000002 3300046681 Bacteria 174959
260 Ga0495658_0000027 3300046683 Bacteria 74322
261 Ga0495669_0015192 3300046684 Bacteria 3295
262 Ga0495669_0096521 3300046684 Bacteria 1370
263 Ga0495613_0086775 3300046689 Bacteria 2269
264 Ga0495624_0000005 3300046690 Bacteria 158127
265 Ga0495670_0016385 3300046691 Bacteria 3642
266 Ga0495649_0003752 3300046694 Bacteria 10087
267 Ga0495600_0092836 3300046809 Bacteria 1969
268 Ga0495600_0453748 3300046809 Bacteria 792
269 Ga0495604_0000255 3300047317 Bacteria 47375
270 Ga0495604_0328858 3300047317 Bacteria 1020
271 Ga0495674_0000961 3300047319 Bacteria 27559
272 Ga0495672_0219322 3300047320 Bacteria 940
273 Ga0495676_0000089 3300047321 Bacteria 67896
274 Ga0495676_0001442 3300047321 Bacteria 20517
275 Ga0495676_0077522 3300047321 Bacteria 2534
276 Ga0495676_0251884 3300047321 Bacteria 1204
277 Ga0495680_0000332 3300047322 Bacteria 52925
278 Ga0495680_0110254 3300047322 Bacteria 2040
279 Ga0495680_0333054 3300047322 Bacteria 1060
280 Ga0495675_0092889 3300047444 Bacteria 1893
281 Ga0495679_102433 3300047446 Bacteria 794
282 Ga0495686_0008917 3300047472 Bacteria 7291
283 Ga0495593_0129776 3300047673 Bacteria 1280
284 Ga0495602_0003237 3300048088 Bacteria 16812
285 Ga0495602_0073683 3300048088 Bacteria 2905
286 Ga0495602_0467658 3300048088 Bacteria 887
287 Ga0495614_0161397 3300048089 Bacteria 1003
288 Ga0496100_0000006 3300048903 Bacteria 297429
289 Ga0496100_0000028 3300048903 Bacteria 113912
290 Ga0496101_0000005 3300048904 Bacteria 331455
291 Ga0496101_0000009 3300048904 Bacteria 297429
292 Ga0496102_0038034 3300048905 Bacteria 4341
293 Ga0496102_0190949 3300048905 Bacteria 1930
294 Ga0496103_0000001 3300048906 Bacteria 643471
295 Ga0496103_0113118 3300048906 Bacteria 1725
296 Ga0496104_0000008 3300048907 Bacteria 516976
297 Ga0496104_0000029 3300048907 Bacteria 202968
298 Ga0496104_0000214 3300048907 Bacteria 51141
299 Ga0496104_0157134 3300048907 Bacteria 2182
300 Ga0496104_0162259 3300048907 Bacteria 2144
301 Ga0496105_0000002 3300048908 Bacteria 753215
302 Ga0496105_0000003 3300048908 Bacteria 713251
303 Ga0496105_0000876 3300048908 Bacteria 20602
304 Ga0496105_0001571 3300048908 Bacteria 16191
305 Ga0496106_0000033 3300048909 Bacteria 131412
306 Ga0496106_0000090 3300048909 Bacteria 72270
307 Ga0496106_0000101 3300048909 Bacteria 65644
308 Ga0496106_0298847 3300048909 Bacteria 1291
309 Ga0496107_0000004 3300048910 Bacteria 297680
310 Ga0496107_0000015 3300048910 Bacteria 173644
311 Ga0496108_0000004 3300048911 Bacteria 545055
312 Ga0496108_0000178 3300048911 Bacteria 58913
313 Ga0496108_0028252 3300048911 Bacteria 4640
314 Ga0496109_0000031 3300048912 Bacteria 163998
315 Ga0496109_0000286 3300048912 Bacteria 47952
316 Ga0496109_0263724 3300048912 Bacteria 1623
317 Ga0496109_0524441 3300048912 Bacteria 1118
318 Ga0496110_0004876 3300048913 Bacteria 10466
319 Ga0496110_0069309 3300048913 Bacteria 3123
320 Ga0496110_0478239 3300048913 Bacteria 1135
321 Ga0496111_0045967 3300048914 Bacteria 3143
322 Ga0496112_0481599 3300048915 Bacteria 1177
323 Ga0496113_0018796 3300048916 Bacteria 4820
324 Ga0496113_0118804 3300048916 Bacteria 2065
325 Ga0496113_0156491 3300048916 Bacteria 1800
326 Ga0496113_0161076 3300048916 Bacteria 1774
327 Ga0496113_0274998 3300048916 Bacteria 1346
328 Ga0496114_0000159 3300048917 Bacteria 47728
329 Ga0496114_0002516 3300048917 Bacteria 14000
330 Ga0496115_0000005 3300048918 Bacteria 290756
331 Ga0496115_0000257 3300048918 Bacteria 47123
332 Ga0496115_0005201 3300048918 Bacteria 9463
333 Ga0496119_0005680 3300048922 Bacteria 11832
334 Ga0496119_0021550 3300048922 Bacteria 4652
335 Ga0496120_0027707 3300048923 Bacteria 3480
336 Ga0496125_0106896 3300048928 Bacteria 2041
337 Ga0501042_0012990 3300049578 Bacteria 5658
338 Ga0501047_0053597 3300049581 Bacteria 3901
339 Ga0501047_0080788 3300049581 Bacteria 3125
340 Ga0501048_0207009 3300049582 Bacteria 1391
341 Ga0501048_0218731 3300049582 Bacteria 1351
342 Ga0501068_0066679 3300049584 Bacteria 2193
343 Ga0501068_0074349 3300049584 Bacteria 2077
344 Ga0501070_0004676 3300049586 Bacteria 11728
345 Ga0501070_0186885 3300049586 Bacteria 1704
346 Ga0501071_0172216 3300049587 Bacteria 1620
347 Ga0501071_0564865 3300049587 Bacteria 874
348 Ga0501072_0045984 3300049588 Bacteria 3434
349 Ga0501074_0010437 3300049590 Bacteria 6740
350 Ga0501074_0543692 3300049590 Bacteria 822
351 Ga0501075_0017368 3300049591 Bacteria 5198
352 Ga0501079_0628157 3300049741 Unclassified 845
353 Ga0501080_0070020 3300049742 Bacteria 3262
354 Ga0501081_0595591 3300049743 Bacteria 827
355 Ga0501044_0648980 3300049823 Bacteria 944
356 nmdc:mga0qj67_78763_c1 3300050509 Bacteria 2638
357 nmdc:mga0a205_352_c1 3300050515 Bacteria 34822
358 Ga0495601_0009383 3300053077 Bacteria 5787
359 Ga0495601_0011518 3300053077 Bacteria 5295
360 Ga0495601_0056662 3300053077 Bacteria 2482
361 Ga0495601_0217621 3300053077 Bacteria 1247
362 Ga0495601_0393656 3300053077 Bacteria 899
363 Ga0495612_0000672 3300053078 Bacteria 13816
364 Ga0495612_0002240 3300053078 Bacteria 7950
365 Ga0495655_0000008 3300053083 Bacteria 153535
366 Ga0495595_0000066 3300053084 Bacteria 51901
367 Ga0495595_0097150 3300053084 Bacteria 1419
368 Ga0495619_0000001 3300053085 Bacteria 586054
369 Ga0495619_0000119 3300053085 Bacteria 58302
370 Ga0495619_0001545 3300053085 Bacteria 15164
371 Ga0495619_0017555 3300053085 Bacteria 4532
372 Ga0495619_0049559 3300053085 Bacteria 2770
373 Ga0495619_0573079 3300053085 Bacteria 773
374 Ga0500566_0003624 3300053094 Bacteria 9213
375 Ga0500566_0209609 3300053094 Unclassified 977
376 Ga0500641_0005031 3300053096 Bacteria 4688
377 Ga0500595_036673 3300053119 Bacteria 1605
378 Ga0500614_000992 3300053123 Bacteria 7047
379 Ga0500628_000043 3300053129 Bacteria 45301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300014325 Ga0163163_10053467 Ga0163163_100534673 115
2 3300048907 Ga0496104_0157134 Ga0496104_0157134_981_1436 115
3 3300048908 Ga0496105_0001571 Ga0496105_0001571_11129_11584 115
4 3300047322 Ga0495680_0000332 Ga0495680_0000332_21839_22300 117
5 3300049582 Ga0501048_0218731 Ga0501048_0218731_546_977 118
6 3300049588 Ga0501072_0045984 Ga0501072_0045984_1004_1435 118
7 3300005539 Ga0068853_100004945 Ga0068853_10000494510 120
8 3300026041 Ga0207639_10151020 Ga0207639_101510201 120
9 3300053096 Ga0500641_0005031 Ga0500641_0005031_795_1238 120
10 3300005334 Ga0068869_100225910 Ga0068869_1002259103 121
11 3300005341 Ga0070691_10003056 Ga0070691_100030565 121
12 3300005544 Ga0070686_100033355 Ga0070686_1000333552 121
13 3300005545 Ga0070695_100307450 Ga0070695_1003074503 121
14 3300006852 Ga0075433_10002298 Ga0075433_1000229811 121
15 3300013104 Ga0157370_10001761 Ga0157370_1000176121 121
16 3300014969 Ga0157376_10009596 Ga0157376_100095966 121
17 3300025942 Ga0207689_11237718 Ga0207689_112377181 121
18 3300045976 Ga0466967_0140208 Ga0466967_0140208_361_858 121
19 3300046514 Ga0495618_0273992 Ga0495618_0273992_336_779 121
20 3300050515 nmdc:mga0a205_352_c1 nmdc:mga0a205_352_c1_28800_29231 121
21 3300005329 Ga0070683_100024078 Ga0070683_1000240785 122
22 3300005336 Ga0070680_100868322 Ga0070680_1008683222 122
23 3300005356 Ga0070674_100000006 Ga0070674_100000006137 122
24 3300005455 Ga0070663_100016320 Ga0070663_1000163203 122
25 3300005530 Ga0070679_100005071 Ga0070679_1000050719 122
26 3300005535 Ga0070684_100044047 Ga0070684_1000440475 122
27 3300005548 Ga0070665_101464694 Ga0070665_1014646942 122
28 3300005577 Ga0068857_100173624 Ga0068857_1001736244 122
29 3300005617 Ga0068859_100301709 Ga0068859_1003017094 122
30 3300005718 Ga0068866_10009163 Ga0068866_100091634 122
31 3300005841 Ga0068863_100051824 Ga0068863_1000518243 122
32 3300005842 Ga0068858_100464563 Ga0068858_1004645632 122
33 3300005842 Ga0068858_100929770 Ga0068858_1009297702 122
34 3300005843 Ga0068860_100698519 Ga0068860_1006985192 122
35 3300006173 Ga0070716_101148695 Ga0070716_1011486951 122
36 3300006237 Ga0097621_101260969 Ga0097621_1012609692 122
37 3300006931 Ga0097620_100301721 Ga0097620_1003017214 122
38 3300009101 Ga0105247_10112582 Ga0105247_101125822 122
39 3300009148 Ga0105243_10046255 Ga0105243_100462555 122
40 3300009176 Ga0105242_10014779 Ga0105242_100147796 122
41 3300013296 Ga0157374_11060001 Ga0157374_110600013 122
42 3300014325 Ga0163163_10285623 Ga0163163_102856232 122
43 3300017792 Ga0163161_10000013 Ga0163161_1000001378 122
44 3300020081 Ga0206354_10550867 Ga0206354_105508671 122
45 3300025899 Ga0207642_10000038 Ga0207642_1000003846 122
46 3300025900 Ga0207710_10215607 Ga0207710_102156073 122
47 3300025913 Ga0207695_10227165 Ga0207695_102271653 122
48 3300025921 Ga0207652_10001670 Ga0207652_100016709 122
49 3300025931 Ga0207644_10166801 Ga0207644_101668013 122
50 3300025934 Ga0207686_10013202 Ga0207686_100132025 122
51 3300025935 Ga0207709_10016389 Ga0207709_100163893 122
52 3300025937 Ga0207669_10000010 Ga0207669_1000001022 122
53 3300025939 Ga0207665_10172452 Ga0207665_101724523 122
54 3300025944 Ga0207661_11009153 Ga0207661_110091532 122
55 3300026035 Ga0207703_10050430 Ga0207703_100504303 122
56 3300026067 Ga0207678_10013059 Ga0207678_100130592 122
57 3300026088 Ga0207641_10075503 Ga0207641_100755033 122
58 3300026116 Ga0207674_10048809 Ga0207674_100488092 122
59 3300026142 Ga0207698_10971915 Ga0207698_109719152 122
60 3300028381 Ga0268264_10395461 Ga0268264_103954612 122
61 3300028563 Ga0265319_1000030 Ga0265319_1000030126 122
62 3300028666 Ga0265336_10020891 Ga0265336_100208913 122
63 3300028800 Ga0265338_10000156 Ga0265338_10000156125 122
64 3300028800 Ga0265338_11073553 Ga0265338_110735531 122
65 3300029957 Ga0265324_10058394 Ga0265324_100583943 122
66 3300031241 Ga0265325_10008148 Ga0265325_100081485 122
67 3300031595 Ga0265313_10223760 Ga0265313_102237602 122
68 3300044694 Ga0466963_0250081 Ga0466963_0250081_544_1005 122
69 3300044842 Ga0466957_0807105 Ga0466957_0807105_76_516 122
70 3300045976 Ga0466967_0106900 Ga0466967_0106900_1226_1651 122
71 3300046455 Ga0495603_0000083 Ga0495603_0000083_410_838 122
72 3300046461 Ga0495641_0026769 Ga0495641_0026769_2301_2750 122
73 3300046476 Ga0495662_0262446 Ga0495662_0262446_116_547 122
74 3300046511 Ga0495608_0000585 Ga0495608_0000585_23018_23446 122
75 3300046516 Ga0495628_0010374 Ga0495628_0010374_6185_6613 122
76 3300046533 Ga0495640_0343978 Ga0495640_0343978_155_610 122
77 3300046536 Ga0495587_0021968 Ga0495587_0021968_2594_3049 122
78 3300047317 Ga0495604_0000255 Ga0495604_0000255_11893_12321 122
79 3300047319 Ga0495674_0000961 Ga0495674_0000961_420_875 122
80 3300047444 Ga0495675_0092889 Ga0495675_0092889_284_739 122
81 3300047472 Ga0495686_0008917 Ga0495686_0008917_3915_4370 122
82 3300048088 Ga0495602_0073683 Ga0495602_0073683_2052_2480 122
83 3300048905 Ga0496102_0038034 Ga0496102_0038034_3191_3646 122
84 3300048906 Ga0496103_0113118 Ga0496103_0113118_548_1003 122
85 3300048907 Ga0496104_0162259 Ga0496104_0162259_1146_1592 122
86 3300048912 Ga0496109_0263724 Ga0496109_0263724_1087_1533 122
87 3300048913 Ga0496110_0069309 Ga0496110_0069309_307_753 122
88 3300048915 Ga0496112_0481599 Ga0496112_0481599_235_681 122
89 3300048916 Ga0496113_0118804 Ga0496113_0118804_1300_1746 122
90 3300048918 Ga0496115_0000005 Ga0496115_0000005_45790_46203 122
91 3300048922 Ga0496119_0021550 Ga0496119_0021550_2674_3165 122
92 3300049581 Ga0501047_0053597 Ga0501047_0053597_1118_1573 122
93 3300049581 Ga0501047_0080788 Ga0501047_0080788_1937_2398 122
94 3300049582 Ga0501048_0207009 Ga0501048_0207009_811_1272 122
95 3300049584 Ga0501068_0066679 Ga0501068_0066679_1450_1911 122
96 3300049586 Ga0501070_0004676 Ga0501070_0004676_11014_11463 122
97 3300049586 Ga0501070_0186885 Ga0501070_0186885_1069_1506 122
98 3300049587 Ga0501071_0172216 Ga0501071_0172216_722_1183 122
99 3300049590 Ga0501074_0010437 Ga0501074_0010437_5087_5548 122
100 3300049590 Ga0501074_0543692 Ga0501074_0543692_47_508 122
101 3300049741 Ga0501079_0628157 Ga0501079_0628157_41_502 122
102 3300049742 Ga0501080_0070020 Ga0501080_0070020_473_934 122
103 3300049823 Ga0501044_0648980 Ga0501044_0648980_212_673 122
104 3300053084 Ga0495595_0000066 Ga0495595_0000066_46487_46915 122
105 3300053085 Ga0495619_0000119 Ga0495619_0000119_34530_34976 122
106 3300053094 Ga0500566_0209609 Ga0500566_0209609_72_563 122
107 3300053119 Ga0500595_036673 Ga0500595_036673_473_967 122
108 3300028558 Ga0265326_10000132 Ga0265326_1000013211 123
109 3300028654 Ga0265322_10000012 Ga0265322_10000012151 123
110 3300029957 Ga0265324_10025032 Ga0265324_100250324 123
111 3300031239 Ga0265328_10003240 Ga0265328_100032402 123
112 3300031240 Ga0265320_10000001 Ga0265320_10000001849 123
113 3300031247 Ga0265340_10263122 Ga0265340_102631222 123
114 3300031249 Ga0265339_10059904 Ga0265339_100599044 123
115 3300031250 Ga0265331_10020602 Ga0265331_100206022 123
116 3300031251 Ga0265327_10000003 Ga0265327_10000003849 123
117 3300031344 Ga0265316_10335947 Ga0265316_103359473 123
118 3300031711 Ga0265314_10000334 Ga0265314_1000033411 123
119 3300045976 Ga0466967_1670661 Ga0466967_1670661_11_490 123
120 3300046516 Ga0495628_0000628 Ga0495628_0000628_1583_2029 123
121 3300046691 Ga0495670_0016385 Ga0495670_0016385_2260_2688 123
122 3300048088 Ga0495602_0003237 Ga0495602_0003237_3473_3919 123
123 3300048911 Ga0496108_0028252 Ga0496108_0028252_2422_2847 123
124 3300048918 Ga0496115_0005201 Ga0496115_0005201_6696_7127 123
125 3300049584 Ga0501068_0074349 Ga0501068_0074349_855_1295 123
126 3300050509 nmdc:mga0qj67_78763_c1 nmdc:mga0qj67_78763_c1_1318_1818 123
127 3300005329 Ga0070683_100369086 Ga0070683_1003690862 124
128 3300005336 Ga0070680_100291072 Ga0070680_1002910724 124
129 3300005337 Ga0070682_100000009 Ga0070682_100000009192 124
130 3300005356 Ga0070674_100000660 Ga0070674_10000066011 124
131 3300005364 Ga0070673_100000704 Ga0070673_1000007044 124
132 3300005406 Ga0070703_10034425 Ga0070703_100344253 124
133 3300005439 Ga0070711_100028366 Ga0070711_1000283663 124
134 3300005441 Ga0070700_100086449 Ga0070700_1000864495 124
135 3300005456 Ga0070678_100017899 Ga0070678_1000178994 124
136 3300005457 Ga0070662_100000001 Ga0070662_100000001325 124
137 3300005459 Ga0068867_100000437 Ga0068867_10000043720 124
138 3300005530 Ga0070679_100000134 Ga0070679_10000013427 124
139 3300005547 Ga0070693_100002496 Ga0070693_1000024968 124
140 3300005563 Ga0068855_100200864 Ga0068855_1002008644 124
141 3300005578 Ga0068854_100573591 Ga0068854_1005735913 124
142 3300005614 Ga0068856_100034850 Ga0068856_10003485011 124
143 3300005614 Ga0068856_101267357 Ga0068856_1012673573 124
144 3300005615 Ga0070702_101228628 Ga0070702_1012286281 124
145 3300005718 Ga0068866_10000007 Ga0068866_10000007112 124
146 3300005842 Ga0068858_100000763 Ga0068858_10000076312 124
147 3300005843 Ga0068860_100005016 Ga0068860_10000501610 124
148 3300005983 Ga0081540_1044500 Ga0081540_10445002 124
149 3300006163 Ga0070715_10000003 Ga0070715_10000003342 124
150 3300006846 Ga0075430_100452805 Ga0075430_1004528052 124
151 3300006881 Ga0068865_100080528 Ga0068865_1000805284 124
152 3300009098 Ga0105245_10000022 Ga0105245_1000002289 124
153 3300009098 Ga0105245_10000735 Ga0105245_1000073521 124
154 3300009553 Ga0105249_10000054 Ga0105249_10000054147 124
155 3300009553 Ga0105249_10019317 Ga0105249_100193178 124
156 3300013296 Ga0157374_10001491 Ga0157374_1000149113 124
157 3300013296 Ga0157374_10544551 Ga0157374_105445514 124
158 3300013308 Ga0157375_10103110 Ga0157375_101031103 124
159 3300014325 Ga0163163_10178162 Ga0163163_101781624 124
160 3300014326 Ga0157380_10004516 Ga0157380_100045166 124
161 3300014968 Ga0157379_10017532 Ga0157379_1001753210 124
162 3300014968 Ga0157379_10277687 Ga0157379_102776873 124
163 3300017792 Ga0163161_10564192 Ga0163161_105641922 124
164 3300025893 Ga0207682_10000050 Ga0207682_1000005012 124
165 3300025899 Ga0207642_10000008 Ga0207642_10000008120 124
166 3300025904 Ga0207647_10094958 Ga0207647_100949584 124
167 3300025905 Ga0207685_10000003 Ga0207685_10000003336 124
168 3300025916 Ga0207663_10013537 Ga0207663_100135376 124
169 3300025917 Ga0207660_10124001 Ga0207660_101240013 124
170 3300025921 Ga0207652_10002993 Ga0207652_1000299315 124
171 3300025924 Ga0207694_10000012 Ga0207694_10000012383 124
172 3300025927 Ga0207687_10001123 Ga0207687_100011239 124
173 3300025927 Ga0207687_10001519 Ga0207687_100015198 124
174 3300025933 Ga0207706_10000003 Ga0207706_100000037 124
175 3300025934 Ga0207686_10346642 Ga0207686_103466423 124
176 3300025937 Ga0207669_10000475 Ga0207669_1000047511 124
177 3300025938 Ga0207704_10444020 Ga0207704_104440203 124
178 3300025944 Ga0207661_10053194 Ga0207661_100531942 124
179 3300025949 Ga0207667_10470020 Ga0207667_104700202 124
180 3300025960 Ga0207651_10056056 Ga0207651_100560563 124
181 3300025961 Ga0207712_10000032 Ga0207712_1000003218 124
182 3300025961 Ga0207712_10903571 Ga0207712_109035711 124
183 3300025981 Ga0207640_10007455 Ga0207640_100074558 124
184 3300026035 Ga0207703_10000070 Ga0207703_1000007055 124
185 3300026075 Ga0207708_10126034 Ga0207708_101260345 124
186 3300026078 Ga0207702_10002891 Ga0207702_1000289117 124
187 3300026089 Ga0207648_10012153 Ga0207648_100121538 124
188 3300026121 Ga0207683_10040813 Ga0207683_100408134 124
189 3300028379 Ga0268266_10000029 Ga0268266_10000029158 124
190 3300028381 Ga0268264_10001856 Ga0268264_100018569 124
191 3300032133 Ga0316583_10101221 Ga0316583_101012213 124
192 3300035724 Ga0373933_0228092 Ga0373933_0228092_449_886 124
193 3300036401 Ga0373937_0040589 Ga0373937_0040589_1120_1536 124
194 3300041512 Ga0451853_3198654 Ga0451853_3198654_3664_4125 124
195 3300046458 Ga0495591_047615 Ga0495591_047615_621_1052 124
196 3300046461 Ga0495641_0000010 Ga0495641_0000010_71135_71596 124
197 3300046463 Ga0495653_0266485 Ga0495653_0266485_158_595 124
198 3300046473 Ga0495582_0000006 Ga0495582_0000006_117058_117492 124
199 3300046475 Ga0495639_0549932 Ga0495639_0549932_61_498 124
200 3300046511 Ga0495608_0066234 Ga0495608_0066234_171_632 124
201 3300046515 Ga0495620_0000782 Ga0495620_0000782_12163_12618 124
202 3300046515 Ga0495620_0306923 Ga0495620_0306923_33_503 124
203 3300046516 Ga0495628_0050697 Ga0495628_0050697_1820_2278 124
204 3300046517 Ga0495630_0495125 Ga0495630_0495125_88_549 124
205 3300046523 Ga0495644_0004542 Ga0495644_0004542_1144_1587 124
206 3300046535 Ga0495586_0000500 Ga0495586_0000500_19462_19899 124
207 3300046537 Ga0495598_0000588 Ga0495598_0000588_4825_5259 124
208 3300046539 Ga0495621_0171866 Ga0495621_0171866_242_679 124
209 3300046543 Ga0495645_0046611 Ga0495645_0046611_1289_1750 124
210 3300046559 Ga0495667_0503757 Ga0495667_0503757_150_593 124
211 3300046678 Ga0495599_0001797 Ga0495599_0001797_5075_5536 124
212 3300046679 Ga0495623_0467538 Ga0495623_0467538_113_550 124
213 3300046681 Ga0495647_0000002 Ga0495647_0000002_70332_70769 124
214 3300046683 Ga0495658_0000027 Ga0495658_0000027_22943_23377 124
215 3300046684 Ga0495669_0015192 Ga0495669_0015192_1074_1538 124
216 3300046690 Ga0495624_0000005 Ga0495624_0000005_69422_69859 124
217 3300046694 Ga0495649_0003752 Ga0495649_0003752_1932_2393 124
218 3300046809 Ga0495600_0453748 Ga0495600_0453748_201_638 124
219 3300047317 Ga0495604_0328858 Ga0495604_0328858_275_712 124
220 3300047320 Ga0495672_0219322 Ga0495672_0219322_467_925 124
221 3300047321 Ga0495676_0000089 Ga0495676_0000089_50089_50550 124
222 3300047446 Ga0495679_102433 Ga0495679_102433_48_509 124
223 3300047673 Ga0495593_0129776 Ga0495593_0129776_453_890 124
224 3300048903 Ga0496100_0000006 Ga0496100_0000006_217159_217623 124
225 3300048904 Ga0496101_0000009 Ga0496101_0000009_217159_217623 124
226 3300048905 Ga0496102_0190949 Ga0496102_0190949_1343_1780 124
227 3300048907 Ga0496104_0000008 Ga0496104_0000008_406176_406634 124
228 3300048907 Ga0496104_0000214 Ga0496104_0000214_1667_2098 124
229 3300048908 Ga0496105_0000003 Ga0496105_0000003_406176_406634 124
230 3300048908 Ga0496105_0000876 Ga0496105_0000876_1349_1780 124
231 3300048909 Ga0496106_0000090 Ga0496106_0000090_15607_16071 124
232 3300048909 Ga0496106_0000101 Ga0496106_0000101_52705_53145 124
233 3300048909 Ga0496106_0298847 Ga0496106_0298847_378_815 124
234 3300048910 Ga0496107_0000015 Ga0496107_0000015_113387_113851 124
235 3300048911 Ga0496108_0000004 Ga0496108_0000004_164499_164960 124
236 3300048912 Ga0496109_0000031 Ga0496109_0000031_10712_11173 124
237 3300048913 Ga0496110_0004876 Ga0496110_0004876_1062_1523 124
238 3300048914 Ga0496111_0045967 Ga0496111_0045967_180_641 124
239 3300048916 Ga0496113_0018796 Ga0496113_0018796_1508_1945 124
240 3300048916 Ga0496113_0161076 Ga0496113_0161076_135_596 124
241 3300048917 Ga0496114_0002516 Ga0496114_0002516_8566_9003 124
242 3300048928 Ga0496125_0106896 Ga0496125_0106896_1476_1937 124
243 3300049578 Ga0501042_0012990 Ga0501042_0012990_974_1408 124
244 3300049587 Ga0501071_0564865 Ga0501071_0564865_89_523 124
245 3300049591 Ga0501075_0017368 Ga0501075_0017368_4601_5035 124
246 3300049743 Ga0501081_0595591 Ga0501081_0595591_343_777 124
247 3300053077 Ga0495601_0011518 Ga0495601_0011518_3309_3740 124
248 3300053077 Ga0495601_0217621 Ga0495601_0217621_36_467 124
249 3300053078 Ga0495612_0000672 Ga0495612_0000672_9599_10060 124
250 3300053085 Ga0495619_0001545 Ga0495619_0001545_1736_2170 124
251 3300053123 Ga0500614_000992 Ga0500614_000992_3446_3907 124
252 3300005842 Ga0068858_100000329 Ga0068858_10000032916 125
253 3300005983 Ga0081540_1000545 Ga0081540_100054520 125
254 3300013296 Ga0157374_10724890 Ga0157374_107248903 125
255 3300013308 Ga0157375_10000153 Ga0157375_1000015355 125
256 3300026035 Ga0207703_10000122 Ga0207703_100001223 125
257 3300030521 Ga0307511_10086027 Ga0307511_100860274 125
258 3300046462 Ga0495651_0133065 Ga0495651_0133065_1285_1719 125
259 3300046462 Ga0495651_0307470 Ga0495651_0307470_212_664 125
260 3300046463 Ga0495653_0012807 Ga0495653_0012807_4934_5368 125
261 3300046491 Ga0495584_0437599 Ga0495584_0437599_191_652 125
262 3300046511 Ga0495608_0080660 Ga0495608_0080660_367_819 125
263 3300046516 Ga0495628_0088338 Ga0495628_0088338_1357_1809 125
264 3300046559 Ga0495667_0209035 Ga0495667_0209035_522_974 125
265 3300046689 Ga0495613_0086775 Ga0495613_0086775_50_502 125
266 3300048911 Ga0496108_0000178 Ga0496108_0000178_36984_37442 125
267 3300048912 Ga0496109_0000286 Ga0496109_0000286_37368_37826 125
268 3300053084 Ga0495595_0097150 Ga0495595_0097150_610_1119 125
269 3300053085 Ga0495619_0000001 Ga0495619_0000001_40504_40956 125
270 3300005356 Ga0070674_100450954 Ga0070674_1004509543 126
271 3300005985 Ga0081539_10001387 Ga0081539_100013878 126
272 3300009148 Ga0105243_10517183 Ga0105243_105171833 126
273 3300025937 Ga0207669_10030772 Ga0207669_100307724 126
274 3300028379 Ga0268266_10221750 Ga0268266_102217503 126
275 3300046660 Ga0495625_0000029 Ga0495625_0000029_237361_237828 126
276 3300046514 Ga0495618_0193515 Ga0495618_0193515_642_1085 128
277 3300046516 Ga0495628_0123771 Ga0495628_0123771_131_574 128
278 3300053078 Ga0495612_0002240 Ga0495612_0002240_3356_3799 128
279 3300005435 Ga0070714_100146157 Ga0070714_1001461572 129
280 3300025929 Ga0207664_10025185 Ga0207664_100251854 129
281 3300048917 Ga0496114_0000159 Ga0496114_0000159_1277_1777 129
282 3300048918 Ga0496115_0000257 Ga0496115_0000257_1277_1777 129
283 3300002074 JGI24748J21848_1000232 JGI24748J21848_100023212 130
284 3300002244 JGI24742J22300_10000730 JGI24742J22300_100007302 130
285 3300005347 Ga0070668_100005535 Ga0070668_1000055359 130
286 3300005367 Ga0070667_100003653 Ga0070667_1000036534 130
287 3300005437 Ga0070710_10205073 Ga0070710_102050733 130
288 3300005548 Ga0070665_100056281 Ga0070665_1000562812 130
289 3300005841 Ga0068863_101543523 Ga0068863_1015435231 130
290 3300005844 Ga0068862_100005566 Ga0068862_1000055665 130
291 3300005937 Ga0081455_10015431 Ga0081455_100154316 130
292 3300009553 Ga0105249_10006797 Ga0105249_100067977 130
293 3300013306 Ga0163162_11326021 Ga0163162_113260212 130
294 3300014325 Ga0163163_10330611 Ga0163163_103306112 130
295 3300014968 Ga0157379_10003657 Ga0157379_100036577 130
296 3300025961 Ga0207712_10001536 Ga0207712_100015367 130
297 3300025972 Ga0207668_10007541 Ga0207668_100075417 130
298 3300025986 Ga0207658_10002943 Ga0207658_100029436 130
299 3300026088 Ga0207641_10431729 Ga0207641_104317291 130
300 3300028379 Ga0268266_10322408 Ga0268266_103224083 130
301 3300028380 Ga0268265_10002086 Ga0268265_1000208612 130
302 3300046517 Ga0495630_1092572 Ga0495630_1092572_58_486 130
303 3300047322 Ga0495680_0333054 Ga0495680_0333054_18_488 130
304 3300053077 Ga0495601_0393656 Ga0495601_0393656_369_797 130
305 3300053085 Ga0495619_0017555 Ga0495619_0017555_2746_3216 130
306 3300025900 Ga0207710_10221626 Ga0207710_102216261 131
307 3300046454 Ga0495592_0045984 Ga0495592_0045984_2530_3024 131
308 3300046559 Ga0495667_0155885 Ga0495667_0155885_727_1200 131
309 3300047322 Ga0495680_0110254 Ga0495680_0110254_355_858 131
310 3300053077 Ga0495601_0056662 Ga0495601_0056662_831_1319 132
311 3300046516 Ga0495628_0127406 Ga0495628_0127406_1393_1887 133
312 3300047321 Ga0495676_0251884 Ga0495676_0251884_720_1193 133
313 3300046459 Ga0495629_0004416 Ga0495629_0004416_308_757 134
314 3300046462 Ga0495651_0900086 Ga0495651_0900086_25_501 134
315 3300046514 Ga0495618_0139173 Ga0495618_0139173_278_766 134
316 3300046517 Ga0495630_0000599 Ga0495630_0000599_17263_17739 134
317 3300046529 Ga0495652_0025744 Ga0495652_0025744_1265_1759 134
318 3300046675 Ga0495657_0010730 Ga0495657_0010730_846_1322 134
319 3300046809 Ga0495600_0092836 Ga0495600_0092836_1422_1883 134
320 3300053077 Ga0495601_0009383 Ga0495601_0009383_4472_4948 134
321 3300053085 Ga0495619_0573079 Ga0495619_0573079_210_686 134
322 3300053094 Ga0500566_0003624 Ga0500566_0003624_2274_2723 134
323 3300009553 Ga0105249_11819301 Ga0105249_118193012 135
324 3300046459 Ga0495629_0355585 Ga0495629_0355585_343_807 135
325 3300046511 Ga0495608_0698937 Ga0495608_0698937_116_580 135
326 3300046684 Ga0495669_0096521 Ga0495669_0096521_701_1159 135
327 3300048912 Ga0496109_0524441 Ga0496109_0524441_238_696 135
328 3300048913 Ga0496110_0478239 Ga0496110_0478239_82_540 135
329 3300048916 Ga0496113_0274998 Ga0496113_0274998_267_725 135
330 3300053085 Ga0495619_0049559 Ga0495619_0049559_933_1397 135
331 3300046462 Ga0495651_0390242 Ga0495651_0390242_144_620 136
332 3300046543 Ga0495645_0047978 Ga0495645_0047978_2252_2740 136
333 3300048088 Ga0495602_0467658 Ga0495602_0467658_331_819 136
334 3300005535 Ga0070684_100372933 Ga0070684_1003729332 137
335 3300005564 Ga0070664_100490926 Ga0070664_1004909262 137
336 3300006175 Ga0070712_100606240 Ga0070712_1006062402 137
337 3300009101 Ga0105247_10000064 Ga0105247_1000006425 137
338 3300009176 Ga0105242_10005496 Ga0105242_1000549610 137
339 3300013297 Ga0157378_10125256 Ga0157378_101252563 137
340 3300025900 Ga0207710_10000165 Ga0207710_1000016511 137
341 3300025934 Ga0207686_10002580 Ga0207686_100025803 137
342 3300025945 Ga0207679_10116699 Ga0207679_101166994 137
343 3300048089 Ga0495614_0161397 Ga0495614_0161397_54_524 137
344 3300001979 JGI24740J21852_10009317 JGI24740J21852_100093175 138
345 3300005341 Ga0070691_10000003 Ga0070691_1000000323 138
346 3300005435 Ga0070714_100808270 Ga0070714_1008082701 138
347 3300005441 Ga0070700_100495874 Ga0070700_1004958741 138
348 3300005545 Ga0070695_100954585 Ga0070695_1009545852 138
349 3300005841 Ga0068863_100036779 Ga0068863_1000367795 138
350 3300006847 Ga0075431_100349364 Ga0075431_1003493643 138
351 3300006871 Ga0075434_100225174 Ga0075434_1002251741 138
352 3300009176 Ga0105242_10000421 Ga0105242_1000042119 138
353 3300009176 Ga0105242_10793187 Ga0105242_107931873 138
354 3300017792 Ga0163161_10034584 Ga0163161_100345845 138
355 3300025899 Ga0207642_10009643 Ga0207642_100096432 138
356 3300025929 Ga0207664_10664296 Ga0207664_106642963 138
357 3300025934 Ga0207686_10000066 Ga0207686_1000006610 138
358 3300025934 Ga0207686_10579035 Ga0207686_105790352 138
359 3300025986 Ga0207658_10013444 Ga0207658_100134446 138
360 3300026075 Ga0207708_10518623 Ga0207708_105186233 138
361 3300026088 Ga0207641_10018787 Ga0207641_100187876 138
362 3300041451 Ga0451791_1179435 Ga0451791_1179435_10_519 138
363 3300041512 Ga0451853_0570090 Ga0451853_0570090_600_1118 138
364 3300046459 Ga0495629_0001767 Ga0495629_0001767_3131_3655 138
365 3300046517 Ga0495630_0223458 Ga0495630_0223458_759_1283 138
366 3300047321 Ga0495676_0001442 Ga0495676_0001442_6571_7095 138
367 3300047321 Ga0495676_0077522 Ga0495676_0077522_754_1278 138
368 3300048903 Ga0496100_0000028 Ga0496100_0000028_30198_30722 138
369 3300048904 Ga0496101_0000005 Ga0496101_0000005_180197_180721 138
370 3300048906 Ga0496103_0000001 Ga0496103_0000001_489212_489718 138
371 3300048907 Ga0496104_0000029 Ga0496104_0000029_120540_121043 138
372 3300048908 Ga0496105_0000002 Ga0496105_0000002_120540_121043 138
373 3300048909 Ga0496106_0000033 Ga0496106_0000033_130186_130710 138
374 3300048910 Ga0496107_0000004 Ga0496107_0000004_180414_180938 138
375 3300048916 Ga0496113_0156491 Ga0496113_0156491_697_1221 138
376 3300048922 Ga0496119_0005680 Ga0496119_0005680_5284_5787 138
377 3300048923 Ga0496120_0027707 Ga0496120_0027707_2481_2984 138
378 3300053083 Ga0495655_0000008 Ga0495655_0000008_32992_33498 138
379 3300053129 Ga0500628_000043 Ga0500628_000043_11599_12105 138

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF07332

Phage_holin_3_6

Putative Actinobacterial Holin-X, holin superfamily III

22

140

0.96

Feature Viewer

pLDDT pTM Quality
71.83 0.36 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map