F428306

General Info

Members Datasets Scaffolds Average Seq Length
379 211 758 334

Family's Representative Sequence

Representative Sequence 3300006042|Ga0075368_10044722|Ga0075368_100447222
Length 347
Sequence MSTWFDESRLDDEGSLAAADPLLRRLAESGARVRLQAGEAAAATAEAVERARELARPRAVIAAGPDSRLLRAVLEPWCPVPFVAWPNPGLPGWAGSLDLVVVLAPDGSDAGTASAVAEGVRRGCQVVVACPPGSLVAEHAAGRWTTILPTVAGDQLATAVVMLSYLDQVSLGPAADAEQVARALDDVAIASSPHRDLAVNPAKMLAIALADTNPLVWGGSVLAARAARRVAESVRRASGRTALAGDAEHLLPVIEAARPRDVFDDPFADTLAAPAELRPMLLVLDDGSEEPVVREQRGRLQAAAAARGVRVETVTAEAPSEVARYASLLLSGTYAAAYLGIGLVEEG

Samples

Sample ID Description Type Environment
1 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
2 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
3 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
4 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
5 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
6 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
7 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
8 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
9 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
10 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
11 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
12 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
13 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
14 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
15 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
16 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
17 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
18 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
19 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
20 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
21 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
22 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
23 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
24 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
25 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
26 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
27 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
28 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
29 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
30 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
31 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
32 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
33 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
34 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
35 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
36 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
37 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
38 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
39 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
40 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
41 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
42 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
43 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
44 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
45 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
46 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
47 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
48 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
49 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
50 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
51 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
52 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
53 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
54 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
55 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
56 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
57 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
58 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
59 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
60 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
61 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
62 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
63 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
64 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
65 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
66 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
67 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
68 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
69 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
70 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
71 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
72 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
73 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
74 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
75 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
76 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
77 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
78 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
79 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
80 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
81 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
82 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
83 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
84 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
85 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
86 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
87 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
88 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
89 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
90 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
91 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
92 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
93 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
94 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
95 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
96 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
97 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
98 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
99 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
100 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
101 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
102 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
103 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
104 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
105 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
106 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
107 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
108 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
109 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
110 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
111 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
112 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
113 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
114 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
115 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
116 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
117 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
118 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
119 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
120 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
121 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
122 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
123 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
124 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
125 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
126 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
127 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
128 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
129 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
130 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
131 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
132 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
133 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
134 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
135 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
136 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
137 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
138 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
139 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
140 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
141 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
142 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
143 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
144 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
145 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
146 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
147 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
148 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
149 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
150 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
151 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
152 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
153 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
154 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
155 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
156 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
157 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
158 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
159 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
160 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
161 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
162 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
163 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
164 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
165 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
166 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
167 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
168 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
169 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
170 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
171 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
172 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
173 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
174 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
175 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
176 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
177 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
178 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
179 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
180 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
181 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
182 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
183 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
184 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
185 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
186 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
187 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
188 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
189 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
190 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
191 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
192 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
193 2643221561 Nocardioides sp. Root151 Isolate Unclassified
194 2643221576 Nocardioides sp. Root614 Isolate Unclassified
195 2643221590 Nocardioides sp. Root682 Isolate Unclassified
196 2643221604 Nocardioides sp. Root190 Isolate Unclassified
197 2643221615 Nocardioides sp. Root224 Isolate Unclassified
198 2643221617 Nocardioides sp. Root79 Isolate Unclassified
199 2643221620 Nocardioides sp. Root240 Isolate Unclassified
200 2643221641 Nocardioides sp. Root122 Isolate Unclassified
201 2643221657 Nocardioides sp. Root1257 Isolate Unclassified
202 2643221696 Nocardioides sp. Root140 Isolate Unclassified
203 2738541305 Nocardioides sp. CF167 Isolate Unclassified
204 2739367898 Nocardioides sp. CF479 Isolate Unclassified
205 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
206 2811994874 Nocardioides sp. SLBN-35 Isolate Unclassified
207 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
208 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
209 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
210 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
211 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 94.46
Metatranscriptomes 0.53
Isolates 5.01

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 13.72
Nodule 0.26
Rhizoplane 10.55
Rhizosphere 69.92
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075368_10044722 3300006042 Bacteria 1748
2 rootL2_10051455 3300003322 Bacteria 1142
3 Ga0070658_10020268 3300005327 Bacteria 5328
4 Ga0070658_10143149 3300005327 Bacteria 1998
5 Ga0070683_100000255 3300005329 Bacteria 36630
6 Ga0070683_100005222 3300005329 Bacteria 10812
7 Ga0070683_100028833 3300005329 Bacteria 5021
8 Ga0070683_100117088 3300005329 Bacteria 2516
9 Ga0070683_100309309 3300005329 Bacteria 1503
10 Ga0070682_100007944 3300005337 Bacteria 5968
11 Ga0070682_100028019 3300005337 Bacteria 3385
12 Ga0068868_100042552 3300005338 Bacteria 3546
13 Ga0070660_100144683 3300005339 Bacteria 1909
14 Ga0070687_100061627 3300005343 Bacteria 1983
15 Ga0070661_100166527 3300005344 Bacteria 1672
16 Ga0070661_100306639 3300005344 Bacteria 1237
17 Ga0070675_100050607 3300005354 Bacteria 3412
18 Ga0070674_100007958 3300005356 Bacteria 6278
19 Ga0070673_100247576 3300005364 Bacteria 1552
20 Ga0070688_100108490 3300005365 Bacteria 1842
21 Ga0070659_100010380 3300005366 Bacteria 6850
22 Ga0070667_100009931 3300005367 Bacteria 7890
23 Ga0070701_10001347 3300005438 Bacteria 9052
24 Ga0070701_10070007 3300005438 Bacteria 1873
25 Ga0070700_100005033 3300005441 Bacteria 6970
26 Ga0070694_100209174 3300005444 Bacteria 1458
27 Ga0070708_100194404 3300005445 Bacteria 1898
28 Ga0070662_100074323 3300005457 Bacteria 2514
29 Ga0068867_100041478 3300005459 Bacteria 3363
30 Ga0070685_10105265 3300005466 Bacteria 1729
31 Ga0070698_100000984 3300005471 Bacteria 31337
32 Ga0070679_100034724 3300005530 Bacteria 4999
33 Ga0070684_100032009 3300005535 Bacteria 4480
34 Ga0070684_100065666 3300005535 Bacteria 3185
35 Ga0070672_100010596 3300005543 Bacteria 6397
36 Ga0070665_100008449 3300005548 Bacteria 10414
37 Ga0070665_100415150 3300005548 Bacteria 1354
38 Ga0070664_100063348 3300005564 Bacteria 3153
39 Ga0068857_100118372 3300005577 Bacteria 2384
40 Ga0068854_100049017 3300005578 Bacteria 3015
41 Ga0070702_100003328 3300005615 Bacteria 7172
42 Ga0070702_100060968 3300005615 Bacteria 2195
43 Ga0068852_100030362 3300005616 Bacteria 4448
44 Ga0068852_100306532 3300005616 Bacteria 1539
45 Ga0068864_100151954 3300005618 Bacteria 2098
46 Ga0068861_100054211 3300005719 Bacteria 3054
47 Ga0068861_100179645 3300005719 Bacteria 1760
48 Ga0068870_10002535 3300005840 Bacteria 7629
49 Ga0068858_100063672 3300005842 Bacteria 3412
50 Ga0068860_100002101 3300005843 Bacteria 21002
51 Ga0068862_100207267 3300005844 Bacteria 1770
52 Ga0081539_10047421 3300005985 Bacteria 2453
53 Ga0075365_10002520 3300006038 Bacteria 9025
54 Ga0075365_10006994 3300006038 Bacteria 6273
55 Ga0075365_10009863 3300006038 Bacteria 5524
56 Ga0075365_10018097 3300006038 Bacteria 4326
57 Ga0075365_10018388 3300006038 Bacteria 4296
58 Ga0075365_10024482 3300006038 Bacteria 3809
59 Ga0075365_10026383 3300006038 Bacteria 3688
60 Ga0075365_10029860 3300006038 Bacteria 3487
61 Ga0075365_10123002 3300006038 Bacteria 1791
62 Ga0075365_10137943 3300006038 Bacteria 1692
63 Ga0075368_10002116 3300006042 Bacteria 6411
64 Ga0075368_10005949 3300006042 Bacteria 4227
65 Ga0075363_100041791 3300006048 Bacteria 2419
66 Ga0075363_100043169 3300006048 Bacteria 2384
67 Ga0075363_100094714 3300006048 Bacteria 1646
68 Ga0075364_10016209 3300006051 Bacteria 4635
69 Ga0075364_10061044 3300006051 Bacteria 2472
70 Ga0075364_10066000 3300006051 Bacteria 2376
71 Ga0075364_10069017 3300006051 Bacteria 2325
72 Ga0075364_10243019 3300006051 Bacteria 1223
73 Ga0075367_10109055 3300006178 Bacteria 1698
74 Ga0075370_10014529 3300006353 Bacteria 4202
75 Ga0075370_10083543 3300006353 Bacteria 1837
76 Ga0068865_100052195 3300006881 Bacteria 2833
77 Ga0105245_10006236 3300009098 Bacteria 10489
78 Ga0105245_10032002 3300009098 Bacteria 4656
79 Ga0105248_10077628 3300009177 Bacteria 3734
80 Ga0105249_10033341 3300009553 Bacteria 4662
81 Ga0105239_10048074 3300010375 Bacteria 4677
82 Ga0105239_10116477 3300010375 Bacteria 2965
83 Ga0105246_10007485 3300011119 Bacteria 6692
84 Ga0157369_10013191 3300013105 Bacteria 9353
85 Ga0157374_10415088 3300013296 Bacteria 1344
86 Ga0163162_10052965 3300013306 Bacteria 4078
87 Ga0157372_10005608 3300013307 Bacteria 13347
88 Ga0157375_10142815 3300013308 Bacteria 2522
89 Ga0157375_10284807 3300013308 Bacteria 1816
90 Ga0157375_10470186 3300013308 Bacteria 1422
91 Ga0157375_10678110 3300013308 Bacteria 1185
92 Ga0163163_10120318 3300014325 Bacteria 2659
93 Ga0157380_10251672 3300014326 Bacteria 1599
94 Ga0157380_10265731 3300014326 Bacteria 1561
95 Ga0157380_10572641 3300014326 Bacteria 1112
96 Ga0157377_10017433 3300014745 Bacteria 3714
97 Ga0157379_10122653 3300014968 Bacteria 2338
98 Ga0163161_10137108 3300017792 Bacteria 1850
99 Ga0163161_10157688 3300017792 Bacteria 1729
100 Ga0206353_10568748 3300020082 Bacteria 2211
101 Ga0206353_11508149 3300020082 Bacteria 5340
102 Ga0207682_10097752 3300025893 Bacteria 1280
103 Ga0207688_10004341 3300025901 Bacteria 7730
104 Ga0207688_10017084 3300025901 Bacteria 3942
105 Ga0207643_10011924 3300025908 Bacteria 4693
106 Ga0207643_10093005 3300025908 Bacteria 1760
107 Ga0207705_10026146 3300025909 Bacteria 4164
108 Ga0207707_10074083 3300025912 Bacteria 2969
109 Ga0207662_10063721 3300025918 Bacteria 2217
110 Ga0207662_10097808 3300025918 Bacteria 1815
111 Ga0207657_10232007 3300025919 Bacteria 1476
112 Ga0207649_10072848 3300025920 Bacteria 2199
113 Ga0207649_10246938 3300025920 Bacteria 1284
114 Ga0207652_10021632 3300025921 Bacteria 5309
115 Ga0207694_10377969 3300025924 Bacteria 1176
116 Ga0207659_10261286 3300025926 Bacteria 1409
117 Ga0207687_10007998 3300025927 Bacteria 6922
118 Ga0207690_10023206 3300025932 Bacteria 3870
119 Ga0207690_10057361 3300025932 Bacteria 2631
120 Ga0207706_10068600 3300025933 Bacteria 3120
121 Ga0207709_10046774 3300025935 Bacteria 2627
122 Ga0207704_10132541 3300025938 Bacteria 1729
123 Ga0207691_10019885 3300025940 Bacteria 6352
124 Ga0207711_10168174 3300025941 Bacteria 1988
125 Ga0207661_10151587 3300025944 Bacteria 2004
126 Ga0207679_10192571 3300025945 Bacteria 1697
127 Ga0207651_10181026 3300025960 Bacteria 1672
128 Ga0207712_10106564 3300025961 Bacteria 2094
129 Ga0207640_10046458 3300025981 Bacteria 2794
130 Ga0207677_10039928 3300026023 Bacteria 3090
131 Ga0207677_10279597 3300026023 Bacteria 1369
132 Ga0207703_10097490 3300026035 Bacteria 2484
133 Ga0207639_10209201 3300026041 Bacteria 1678
134 Ga0207678_10061271 3300026067 Bacteria 3236
135 Ga0207708_10024559 3300026075 Bacteria 4560
136 Ga0207708_10070508 3300026075 Bacteria 2676
137 Ga0207648_10014649 3300026089 Bacteria 7239
138 Ga0207676_10009641 3300026095 Bacteria 6871
139 Ga0207674_10064350 3300026116 Bacteria 3700
140 Ga0207675_100030704 3300026118 Bacteria 5005
141 Ga0207675_100200591 3300026118 Bacteria 1916
142 Ga0207675_100326353 3300026118 Bacteria 1499
143 Ga0207683_10206426 3300026121 Bacteria 1787
144 Ga0207683_10228513 3300026121 Bacteria 1696
145 Ga0209813_10001882 3300027866 Bacteria 4735
146 Ga0268266_10002962 3300028379 Bacteria 17512
147 Ga0268266_10374991 3300028379 Bacteria 1341
148 Ga0268265_10157748 3300028380 Bacteria 1923
149 Ga0268264_10000552 3300028381 Bacteria 46800
150 Ga0268264_10027515 3300028381 Bacteria 4647
151 Ga0307405_10323966 3300031731 Bacteria 1178
152 Ga0307413_10109673 3300031824 Bacteria 1845
153 Ga0307410_10248902 3300031852 Bacteria 1381
154 Ga0307410_10315194 3300031852 Bacteria 1239
155 Ga0307406_10193823 3300031901 Bacteria 1490
156 Ga0307407_10198027 3300031903 Bacteria 1344
157 Ga0307412_10172156 3300031911 Bacteria 1620
158 Ga0307409_100032732 3300031995 Bacteria 3774
159 Ga0307409_100087161 3300031995 Bacteria 2543
160 Ga0307409_100216129 3300031995 Bacteria 1727
161 Ga0307416_100498662 3300032002 Bacteria 1281
162 Ga0395900_0021087 3300037418 Bacteria 6659
163 Ga0395900_0031363 3300037418 Bacteria 5460
164 Ga0395898_0104264 3300037466 Bacteria 2720
165 Ga0395898_0230376 3300037466 Bacteria 1767
166 Ga0436364_1381926 3300037853 Bacteria 2265
167 Ga0395901_0044925 3300038443 Bacteria 4583
168 Ga0439436_0036651 3300041404 Bacteria 1414
169 Ga0439447_029878 3300041407 Bacteria 1377
170 Ga0451791_1727271 3300041451 Bacteria 3754
171 Ga0451837_1505888 3300041494 Bacteria 2534
172 Ga0439431_0025350 3300041997 Bacteria 1447
173 Ga0450907_003736 3300042146 Bacteria 2673
174 Ga0439446_0026165 3300042156 Bacteria 1670
175 Ga0439434_0001834 3300042435 Bacteria 6170
176 Ga0439464_0010386 3300042439 Bacteria 2457
177 Ga0466969_0005530 3300044656 Bacteria 6714
178 Ga0466972_0040786 3300044658 Bacteria 2261
179 Ga0466966_0003147 3300044684 Bacteria 10863
180 Ga0466966_0015824 3300044684 Bacteria 4984
181 Ga0466966_0089102 3300044684 Bacteria 1917
182 Ga0466966_0155658 3300044684 Bacteria 1392
183 Ga0466961_0004707 3300044693 Bacteria 8584
184 Ga0466961_0008597 3300044693 Bacteria 6505
185 Ga0466961_0038718 3300044693 Bacteria 3059
186 Ga0466963_0003054 3300044694 Bacteria 9476
187 Ga0466963_0093719 3300044694 Bacteria 2048
188 Ga0466963_0383490 3300044694 Bacteria 991
189 Ga0466964_0032455 3300044706 Bacteria 2075
190 Ga0466971_0007081 3300044719 Bacteria 4882
191 Ga0466970_0009143 3300044765 Bacteria 5001
192 Ga0466970_0009446 3300044765 Bacteria 4930
193 Ga0466970_0051460 3300044765 Bacteria 2198
194 Ga0466970_0056846 3300044765 Bacteria 2091
195 Ga0466970_0152708 3300044765 Bacteria 1275
196 Ga0466957_0005435 3300044842 Bacteria 7154
197 Ga0466957_0007470 3300044842 Bacteria 6173
198 Ga0466957_0036540 3300044842 Bacteria 2954
199 Ga0466957_0067184 3300044842 Bacteria 2212
200 Ga0466960_0015190 3300044901 Bacteria 3315
201 Ga0466960_0018666 3300044901 Bacteria 3044
202 Ga0466960_0026905 3300044901 Bacteria 2617
203 Ga0466959_0034484 3300045049 Bacteria 3743
204 Ga0466959_0098981 3300045049 Bacteria 2089
205 Ga0466958_0019268 3300045836 Bacteria 3971
206 Ga0466958_0019953 3300045836 Bacteria 3906
207 Ga0466967_0002004 3300045976 Bacteria 12396
208 Ga0466967_0029055 3300045976 Bacteria 4622
209 Ga0466967_0031931 3300045976 Bacteria 4440
210 Ga0466967_0051506 3300045976 Bacteria 3608
211 Ga0466967_0362480 3300045976 Bacteria 1405
212 Ga0495603_0146439 3300046455 Bacteria 1373
213 Ga0496100_0029894 3300048903 Bacteria 3375
214 Ga0496100_0084734 3300048903 Bacteria 2149
215 Ga0496100_0272918 3300048903 Bacteria 1258
216 Ga0496101_0013593 3300048904 Bacteria 5459
217 Ga0496101_0023997 3300048904 Bacteria 4219
218 Ga0496102_0010362 3300048905 Bacteria 8018
219 Ga0496102_0010725 3300048905 Bacteria 7894
220 Ga0496102_0015426 3300048905 Bacteria 6655
221 Ga0496102_0015732 3300048905 Bacteria 6591
222 Ga0496102_0139753 3300048905 Bacteria 2270
223 Ga0496103_0018499 3300048906 Bacteria 4179
224 Ga0496104_0011699 3300048907 Bacteria 7868
225 Ga0496104_0058781 3300048907 Bacteria 3640
226 Ga0496105_0158552 3300048908 Bacteria 1858
227 Ga0496107_0004260 3300048910 Bacteria 9674
228 Ga0496107_0040865 3300048910 Bacteria 3330
229 Ga0496108_0049499 3300048911 Bacteria 3515
230 Ga0496108_0107979 3300048911 Bacteria 2377
231 Ga0496108_0157490 3300048911 Bacteria 1961
232 Ga0496109_0002618 3300048912 Bacteria 15088
233 Ga0496109_0004100 3300048912 Bacteria 12177
234 Ga0496109_0099853 3300048912 Bacteria 2692
235 Ga0496109_0142508 3300048912 Bacteria 2242
236 Ga0496109_0251881 3300048912 Bacteria 1663
237 Ga0496109_0363892 3300048912 Bacteria 1366
238 Ga0496110_0027914 3300048913 Bacteria 4842
239 Ga0496110_0134231 3300048913 Bacteria 2236
240 Ga0496111_0007178 3300048914 Bacteria 7282
241 Ga0496111_0014825 3300048914 Bacteria 5335
242 Ga0496112_0054445 3300048915 Bacteria 3931
243 Ga0496113_0122324 3300048916 Bacteria 2036
244 Ga0496113_0299492 3300048916 Bacteria 1287
245 Ga0496114_0000460 3300048917 Bacteria 29879
246 Ga0496114_0020186 3300048917 Bacteria 5407
247 Ga0496114_0100477 3300048917 Bacteria 2468
248 Ga0496114_0106901 3300048917 Bacteria 2394
249 Ga0496114_0271030 3300048917 Bacteria 1496
250 Ga0496114_0299993 3300048917 Bacteria 1418
251 Ga0496114_0404172 3300048917 Bacteria 1209
252 Ga0501031_0011180 3300049568 Bacteria 5849
253 Ga0501031_0045205 3300049568 Bacteria 2873
254 Ga0501031_0129355 3300049568 Bacteria 1649
255 Ga0501032_0028594 3300049569 Bacteria 3829
256 Ga0501033_0111454 3300049570 Bacteria 1991
257 Ga0501034_0033892 3300049571 Bacteria 5177
258 Ga0501034_0066021 3300049571 Bacteria 3632
259 Ga0501034_0166927 3300049571 Bacteria 2170
260 Ga0501036_0090914 3300049572 Bacteria 2578
261 Ga0501037_0000979 3300049573 Bacteria 21235
262 Ga0501038_0049112 3300049574 Bacteria 3649
263 Ga0501038_0052086 3300049574 Bacteria 3529
264 Ga0501038_0095190 3300049574 Bacteria 2488
265 Ga0501039_0007583 3300049575 Bacteria 8287
266 Ga0501039_0063310 3300049575 Bacteria 2866
267 Ga0501039_0075652 3300049575 Bacteria 2617
268 Ga0501040_0025827 3300049576 Bacteria 3951
269 Ga0501040_0379034 3300049576 Bacteria 1015
270 Ga0501041_0022971 3300049577 Bacteria 3737
271 Ga0501041_0045301 3300049577 Bacteria 2674
272 Ga0501042_0006982 3300049578 Bacteria 7370
273 Ga0501043_0047852 3300049579 Bacteria 3362
274 Ga0501043_0455585 3300049579 Bacteria 960
275 Ga0501046_0000573 3300049580 Bacteria 36317
276 Ga0501046_0019271 3300049580 Bacteria 5659
277 Ga0501047_0042538 3300049581 Bacteria 4390
278 Ga0501048_0013106 3300049582 Bacteria 6155
279 Ga0501048_0020440 3300049582 Bacteria 4852
280 Ga0501067_0032663 3300049583 Bacteria 2888
281 Ga0501067_0038284 3300049583 Bacteria 2663
282 Ga0501068_0009208 3300049584 Bacteria 5518
283 Ga0501068_0042790 3300049584 Bacteria 2723
284 Ga0501069_0041263 3300049585 Bacteria 2550
285 Ga0501069_0090984 3300049585 Bacteria 1726
286 Ga0501070_0006103 3300049586 Bacteria 10269
287 Ga0501070_0009054 3300049586 Bacteria 8421
288 Ga0501070_0041300 3300049586 Bacteria 3843
289 Ga0501070_0077021 3300049586 Bacteria 2760
290 Ga0501071_0004606 3300049587 Bacteria 8749
291 Ga0501071_0023523 3300049587 Bacteria 4304
292 Ga0501071_0041680 3300049587 Bacteria 3288
293 Ga0501071_0174912 3300049587 Bacteria 1608
294 Ga0501072_0054054 3300049588 Bacteria 3163
295 Ga0501072_0118028 3300049588 Bacteria 2114
296 Ga0501072_0118249 3300049588 Bacteria 2112
297 Ga0501073_0007398 3300049589 Bacteria 8163
298 Ga0501073_0037246 3300049589 Bacteria 3455
299 Ga0501073_0118291 3300049589 Bacteria 1836
300 Ga0501073_0130598 3300049589 Bacteria 1741
301 Ga0501074_0004473 3300049590 Bacteria 10003
302 Ga0501074_0005417 3300049590 Bacteria 9182
303 Ga0501074_0006102 3300049590 Bacteria 8700
304 Ga0501074_0049996 3300049590 Bacteria 3018
305 Ga0501074_0100815 3300049590 Bacteria 2067
306 Ga0501074_0152790 3300049590 Bacteria 1650
307 Ga0501075_0026830 3300049591 Bacteria 4243
308 Ga0501076_0150942 3300049592 Bacteria 1890
309 Ga0501079_0288624 3300049741 Bacteria 1283
310 Ga0501080_0003871 3300049742 Bacteria 13239
311 Ga0501080_0013063 3300049742 Bacteria 7625
312 Ga0501080_0066155 3300049742 Bacteria 3361
313 Ga0501080_0173169 3300049742 Bacteria 1990
314 Ga0501080_0310361 3300049742 Bacteria 1429
315 Ga0501080_0335250 3300049742 Bacteria 1367
316 Ga0501081_0054094 3300049743 Bacteria 2773
317 Ga0501083_0002526 3300049744 Bacteria 12559
318 Ga0501035_0142917 3300049822 Bacteria 2079
319 Ga0501035_0358937 3300049822 Bacteria 1218
320 Ga0501045_0071377 3300049824 Bacteria 2556
321 Ga0501045_0076937 3300049824 Bacteria 2459
322 Ga0501045_0146397 3300049824 Bacteria 1757
323 nmdc:mga03n38_10125_c1 3300050490 Bacteria 3457
324 nmdc:mga03n38_10995_c1 3300050490 Bacteria 3356
325 nmdc:mga00v17_120236_c1 3300050491 Bacteria 1672
326 nmdc:mga00v17_20625_c1 3300050491 Bacteria 3778
327 nmdc:mga00v17_20677_c1 3300050491 Bacteria 3774
328 nmdc:mga00v17_39347_c1 3300050491 Bacteria 2832
329 nmdc:mga00v17_7337_c1 3300050491 Bacteria 5876
330 nmdc:mga0yw44_10167_c1 3300050492 Bacteria 4795
331 nmdc:mga0yw44_114757_c1 3300050492 Bacteria 1729
332 nmdc:mga0yw44_122890_c1 3300050492 Bacteria 1674
333 nmdc:mga0yw44_166945_c1 3300050492 Bacteria 1444
334 nmdc:mga0yw44_27165_c1 3300050492 Bacteria 3276
335 nmdc:mga0yw44_4060_c1 3300050492 Bacteria 6628
336 nmdc:mga0yw44_5696_c1 3300050492 Bacteria 5113
337 nmdc:mga0yw44_9710_c1 3300050492 Bacteria 4885
338 nmdc:mga0yw44_97349_c1 3300050492 Bacteria 1869
339 nmdc:mga0yw44_98140_c1 3300050492 Bacteria 1862
340 nmdc:mga06z11_162554_c1 3300050494 Bacteria 1277
341 nmdc:mga06z11_6456_c1 3300050494 Bacteria 4774
342 nmdc:mga04h51_2876_c1 3300050495 Bacteria 4128
343 nmdc:mga07m45_16315_c1 3300050496 Bacteria 3976
344 nmdc:mga07m45_32503_c1 3300050496 Bacteria 2894
345 nmdc:mga07m45_43849_c2 3300050496 Bacteria 2191
346 nmdc:mga07m45_58107_c1 3300050496 Bacteria 2188
347 nmdc:mga07m45_7507_c1 3300050496 Bacteria 5572
348 nmdc:mga08y16_26349_c1 3300050511 Bacteria 6130
349 nmdc:mga0sz30_49468_c2 3300050516 Bacteria 1106
350 Ga0495595_0075100 3300053084 Bacteria 1603
351 Ga0500644_0000177 3300053088 Bacteria 40984
352 Ga0501084_0009419 3300054114 Bacteria 8082
353 Ga0501084_0103062 3300054114 Bacteria 2396
354 Ga0501084_0286416 3300054114 Bacteria 1391
355 Ga0501082_0008206 3300060353 Bacteria 9010
356 Ga0501082_0364565 3300060353 Bacteria 1260
357 Ga0466962_0021332 3300061719 Bacteria 3111
358 Ga0466962_0060486 3300061719 Bacteria 1808
359 Ga0530510_0050886 3300061734 Bacteria 2993
360 Ga0530510_0139010 3300061734 Bacteria 1789
361 2643823857 2643221561 Bacteria 4984412
362 2643892565 2643221576 Bacteria 5214352
363 2643961617 2643221590 Bacteria 5214697
364 2644032485 2643221604 Bacteria 5014917
365 2644090597 2643221615 Bacteria 5487866
366 2644102626 2643221617 Bacteria 5139111
367 2644118288 2643221620 Bacteria 5134593
368 2644231510 2643221641 Bacteria 4490190
369 2644320401 2643221657 Bacteria 5490246
370 2644533133 2643221696 Bacteria 5431823
371 2738870668 2738541305 Bacteria 4910150
372 2740167408 2739367898 Bacteria 4367674
373 2774396556 2773857762 Bacteria 5971770
374 2812334046 2811994874 Bacteria 5367947
375 2812353107 2811994878 Bacteria 5992952
376 2855389183 2855386786 Bacteria 4752232
377 2857482839 2857481737 Bacteria 4761446
378 2891969266 2891968417 Bacteria 5821697
379 8054614384 8054609563 Bacteria 5170090
380 Ga0075368_10044722
381 rootL2_10051455
382 Ga0070658_10020268
383 Ga0070658_10143149
384 Ga0070683_100000255
385 Ga0070683_100005222
386 Ga0070683_100028833
387 Ga0070683_100117088
388 Ga0070683_100309309
389 Ga0070682_100007944
390 Ga0070682_100028019
391 Ga0068868_100042552
392 Ga0070660_100144683
393 Ga0070687_100061627
394 Ga0070661_100166527
395 Ga0070661_100306639
396 Ga0070675_100050607
397 Ga0070674_100007958
398 Ga0070673_100247576
399 Ga0070688_100108490
400 Ga0070659_100010380
401 Ga0070667_100009931
402 Ga0070701_10001347
403 Ga0070701_10070007
404 Ga0070700_100005033
405 Ga0070694_100209174
406 Ga0070708_100194404
407 Ga0070662_100074323
408 Ga0068867_100041478
409 Ga0070685_10105265
410 Ga0070698_100000984
411 Ga0070679_100034724
412 Ga0070684_100032009
413 Ga0070684_100065666
414 Ga0070672_100010596
415 Ga0070665_100008449
416 Ga0070665_100415150
417 Ga0070664_100063348
418 Ga0068857_100118372
419 Ga0068854_100049017
420 Ga0070702_100003328
421 Ga0070702_100060968
422 Ga0068852_100030362
423 Ga0068852_100306532
424 Ga0068864_100151954
425 Ga0068861_100054211
426 Ga0068861_100179645
427 Ga0068870_10002535
428 Ga0068858_100063672
429 Ga0068860_100002101
430 Ga0068862_100207267
431 Ga0081539_10047421
432 Ga0075365_10002520
433 Ga0075365_10006994
434 Ga0075365_10009863
435 Ga0075365_10018097
436 Ga0075365_10018388
437 Ga0075365_10024482
438 Ga0075365_10026383
439 Ga0075365_10029860
440 Ga0075365_10123002
441 Ga0075365_10137943
442 Ga0075368_10002116
443 Ga0075368_10005949
444 Ga0075363_100041791
445 Ga0075363_100043169
446 Ga0075363_100094714
447 Ga0075364_10016209
448 Ga0075364_10061044
449 Ga0075364_10066000
450 Ga0075364_10069017
451 Ga0075364_10243019
452 Ga0075367_10109055
453 Ga0075370_10014529
454 Ga0075370_10083543
455 Ga0068865_100052195
456 Ga0105245_10006236
457 Ga0105245_10032002
458 Ga0105248_10077628
459 Ga0105249_10033341
460 Ga0105239_10048074
461 Ga0105239_10116477
462 Ga0105246_10007485
463 Ga0157369_10013191
464 Ga0157374_10415088
465 Ga0163162_10052965
466 Ga0157372_10005608
467 Ga0157375_10142815
468 Ga0157375_10284807
469 Ga0157375_10470186
470 Ga0157375_10678110
471 Ga0163163_10120318
472 Ga0157380_10251672
473 Ga0157380_10265731
474 Ga0157380_10572641
475 Ga0157377_10017433
476 Ga0157379_10122653
477 Ga0163161_10137108
478 Ga0163161_10157688
479 Ga0206353_10568748
480 Ga0206353_11508149
481 Ga0207682_10097752
482 Ga0207688_10004341
483 Ga0207688_10017084
484 Ga0207643_10011924
485 Ga0207643_10093005
486 Ga0207705_10026146
487 Ga0207707_10074083
488 Ga0207662_10063721
489 Ga0207662_10097808
490 Ga0207657_10232007
491 Ga0207649_10072848
492 Ga0207649_10246938
493 Ga0207652_10021632
494 Ga0207694_10377969
495 Ga0207659_10261286
496 Ga0207687_10007998
497 Ga0207690_10023206
498 Ga0207690_10057361
499 Ga0207706_10068600
500 Ga0207709_10046774
501 Ga0207704_10132541
502 Ga0207691_10019885
503 Ga0207711_10168174
504 Ga0207661_10151587
505 Ga0207679_10192571
506 Ga0207651_10181026
507 Ga0207712_10106564
508 Ga0207640_10046458
509 Ga0207677_10039928
510 Ga0207677_10279597
511 Ga0207703_10097490
512 Ga0207639_10209201
513 Ga0207678_10061271
514 Ga0207708_10024559
515 Ga0207708_10070508
516 Ga0207648_10014649
517 Ga0207676_10009641
518 Ga0207674_10064350
519 Ga0207675_100030704
520 Ga0207675_100200591
521 Ga0207675_100326353
522 Ga0207683_10206426
523 Ga0207683_10228513
524 Ga0209813_10001882
525 Ga0268266_10002962
526 Ga0268266_10374991
527 Ga0268265_10157748
528 Ga0268264_10000552
529 Ga0268264_10027515
530 Ga0307405_10323966
531 Ga0307413_10109673
532 Ga0307410_10248902
533 Ga0307410_10315194
534 Ga0307406_10193823
535 Ga0307407_10198027
536 Ga0307412_10172156
537 Ga0307409_100032732
538 Ga0307409_100087161
539 Ga0307409_100216129
540 Ga0307416_100498662
541 Ga0395900_0021087
542 Ga0395900_0031363
543 Ga0395898_0104264
544 Ga0395898_0230376
545 Ga0436364_1381926
546 Ga0395901_0044925
547 Ga0439436_0036651
548 Ga0439447_029878
549 Ga0451791_1727271
550 Ga0451837_1505888
551 Ga0439431_0025350
552 Ga0450907_003736
553 Ga0439446_0026165
554 Ga0439434_0001834
555 Ga0439464_0010386
556 Ga0466969_0005530
557 Ga0466972_0040786
558 Ga0466966_0003147
559 Ga0466966_0015824
560 Ga0466966_0089102
561 Ga0466966_0155658
562 Ga0466961_0004707
563 Ga0466961_0008597
564 Ga0466961_0038718
565 Ga0466963_0003054
566 Ga0466963_0093719
567 Ga0466963_0383490
568 Ga0466964_0032455
569 Ga0466971_0007081
570 Ga0466970_0009143
571 Ga0466970_0009446
572 Ga0466970_0051460
573 Ga0466970_0056846
574 Ga0466970_0152708
575 Ga0466957_0005435
576 Ga0466957_0007470
577 Ga0466957_0036540
578 Ga0466957_0067184
579 Ga0466960_0015190
580 Ga0466960_0018666
581 Ga0466960_0026905
582 Ga0466959_0034484
583 Ga0466959_0098981
584 Ga0466958_0019268
585 Ga0466958_0019953
586 Ga0466967_0002004
587 Ga0466967_0029055
588 Ga0466967_0031931
589 Ga0466967_0051506
590 Ga0466967_0362480
591 Ga0495603_0146439
592 Ga0496100_0029894
593 Ga0496100_0084734
594 Ga0496100_0272918
595 Ga0496101_0013593
596 Ga0496101_0023997
597 Ga0496102_0010362
598 Ga0496102_0010725
599 Ga0496102_0015426
600 Ga0496102_0015732
601 Ga0496102_0139753
602 Ga0496103_0018499
603 Ga0496104_0011699
604 Ga0496104_0058781
605 Ga0496105_0158552
606 Ga0496107_0004260
607 Ga0496107_0040865
608 Ga0496108_0049499
609 Ga0496108_0107979
610 Ga0496108_0157490
611 Ga0496109_0002618
612 Ga0496109_0004100
613 Ga0496109_0099853
614 Ga0496109_0142508
615 Ga0496109_0251881
616 Ga0496109_0363892
617 Ga0496110_0027914
618 Ga0496110_0134231
619 Ga0496111_0007178
620 Ga0496111_0014825
621 Ga0496112_0054445
622 Ga0496113_0122324
623 Ga0496113_0299492
624 Ga0496114_0000460
625 Ga0496114_0020186
626 Ga0496114_0100477
627 Ga0496114_0106901
628 Ga0496114_0271030
629 Ga0496114_0299993
630 Ga0496114_0404172
631 Ga0501031_0011180
632 Ga0501031_0045205
633 Ga0501031_0129355
634 Ga0501032_0028594
635 Ga0501033_0111454
636 Ga0501034_0033892
637 Ga0501034_0066021
638 Ga0501034_0166927
639 Ga0501036_0090914
640 Ga0501037_0000979
641 Ga0501038_0049112
642 Ga0501038_0052086
643 Ga0501038_0095190
644 Ga0501039_0007583
645 Ga0501039_0063310
646 Ga0501039_0075652
647 Ga0501040_0025827
648 Ga0501040_0379034
649 Ga0501041_0022971
650 Ga0501041_0045301
651 Ga0501042_0006982
652 Ga0501043_0047852
653 Ga0501043_0455585
654 Ga0501046_0000573
655 Ga0501046_0019271
656 Ga0501047_0042538
657 Ga0501048_0013106
658 Ga0501048_0020440
659 Ga0501067_0032663
660 Ga0501067_0038284
661 Ga0501068_0009208
662 Ga0501068_0042790
663 Ga0501069_0041263
664 Ga0501069_0090984
665 Ga0501070_0006103
666 Ga0501070_0009054
667 Ga0501070_0041300
668 Ga0501070_0077021
669 Ga0501071_0004606
670 Ga0501071_0023523
671 Ga0501071_0041680
672 Ga0501071_0174912
673 Ga0501072_0054054
674 Ga0501072_0118028
675 Ga0501072_0118249
676 Ga0501073_0007398
677 Ga0501073_0037246
678 Ga0501073_0118291
679 Ga0501073_0130598
680 Ga0501074_0004473
681 Ga0501074_0005417
682 Ga0501074_0006102
683 Ga0501074_0049996
684 Ga0501074_0100815
685 Ga0501074_0152790
686 Ga0501075_0026830
687 Ga0501076_0150942
688 Ga0501079_0288624
689 Ga0501080_0003871
690 Ga0501080_0013063
691 Ga0501080_0066155
692 Ga0501080_0173169
693 Ga0501080_0310361
694 Ga0501080_0335250
695 Ga0501081_0054094
696 Ga0501083_0002526
697 Ga0501035_0142917
698 Ga0501035_0358937
699 Ga0501045_0071377
700 Ga0501045_0076937
701 Ga0501045_0146397
702 nmdc:mga03n38_10125_c1
703 nmdc:mga03n38_10995_c1
704 nmdc:mga00v17_120236_c1
705 nmdc:mga00v17_20625_c1
706 nmdc:mga00v17_20677_c1
707 nmdc:mga00v17_39347_c1
708 nmdc:mga00v17_7337_c1
709 nmdc:mga0yw44_10167_c1
710 nmdc:mga0yw44_114757_c1
711 nmdc:mga0yw44_122890_c1
712 nmdc:mga0yw44_166945_c1
713 nmdc:mga0yw44_27165_c1
714 nmdc:mga0yw44_4060_c1
715 nmdc:mga0yw44_5696_c1
716 nmdc:mga0yw44_9710_c1
717 nmdc:mga0yw44_97349_c1
718 nmdc:mga0yw44_98140_c1
719 nmdc:mga06z11_162554_c1
720 nmdc:mga06z11_6456_c1
721 nmdc:mga04h51_2876_c1
722 nmdc:mga07m45_16315_c1
723 nmdc:mga07m45_32503_c1
724 nmdc:mga07m45_43849_c2
725 nmdc:mga07m45_58107_c1
726 nmdc:mga07m45_7507_c1
727 nmdc:mga08y16_26349_c1
728 nmdc:mga0sz30_49468_c2
729 Ga0495595_0075100
730 Ga0500644_0000177
731 Ga0501084_0009419
732 Ga0501084_0103062
733 Ga0501084_0286416
734 Ga0501082_0008206
735 Ga0501082_0364565
736 Ga0466962_0021332
737 Ga0466962_0060486
738 Ga0530510_0050886
739 Ga0530510_0139010
740 2643823857
741 2643892565
742 2643961617
743 2644032485
744 2644090597
745 2644102626
746 2644118288
747 2644231510
748 2644320401
749 2644533133
750 2738870668
751 2740167408
752 2774396556
753 2812334046
754 2812353107
755 2855389183
756 2857482839
757 2891969266
758 8054614384

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10432

bact-PGI_C

Bacterial phospho-glucose isomerase C-terminal SIS domain

198

343

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
7d0m-assembly1.cif.gz_A crystal structure of mouse cry1 with bound cryoprotectant 0.8037 275 313
3trj-assembly1.cif.gz_D structure of a phosphoheptose isomerase from francisella tularensis 0.7313 22 170
3c3j-assembly2.cif.gz_C crystal structure of tagatose-6-phosphate ketose/aldose isomerase from escherichia coli 0.7046 26 343
3sho-assembly1.cif.gz_B crystal structure of rpir transcription factor from sphaerobacter thermophilus (sugar isomerase domain) 0.7017 20 168
3bjz-assembly1.cif.gz_B crystal structure of pseudomonas aeruginosa phosphoheptose isomerase 0.6932 20 171
ID Description Score Start End Superfamily
1wiwB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8151 192 341 3.40.50.10490
1wiwB02 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.8037 192 341 3.40.50.10490
3fj1C01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Glucose-6-phosphate isomerase like protein; domain 1 0.7683 22 189 3.40.50.10490
af_O05899_49_341_1.20.140.150 Mainly Alpha;Up-down Bundle;Butyryl-CoA Dehydrogenase, subunit A; domain 3; 0.7593 55 335 1.20.140.150
af_Q9USL5_270_390_3.30.1330.30 Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;Ribosomal protein L30/S12 0.742 284 314 3.30.1330.30
ID Description Score Start End GO Terms
AF-A0A3N2CVM2-F1-model_v4 Phosphoglucose isomerase-like protein 0.9775 4 343 GO:0004347
GO:0004476
GO:0005975
GO:0097367
GO:1901135
AF-A0A7K0WZG8-F1-model_v4 Bifunctional glucose-6-phosphate/mannose-6-phosphate isomerase C-terminal domain-containing protein 0.9737 4 339 GO:0004347
GO:0004476
GO:0005975
GO:0097367
GO:1901135
AF-A0A3N2CVM2-F1-model_v4 Phosphoglucose isomerase-like protein 0.9719 4 343 GO:0004347
GO:0004476
GO:0005975
GO:0097367
GO:1901135
AF-A0A6J4JY89-F1-model_v4 Bifunctional glucose-6-phosphate/mannose-6-phosphate isomerase C-terminal domain-containing protein 0.9672 166 342 GO:0004347
GO:0004476
GO:0005975
GO:0097367
GO:1901135
AF-A0A4S4ZKB5-F1-model_v4 Bifunctional glucose-6-phosphate/mannose-6-phosphate isomerase C-terminal domain-containing protein 0.9567 95 343 GO:0004347
GO:0004476
GO:0005975
GO:0097367
GO:1901135

Map